2BPQA

Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (apo structure)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
344
structure length
344
Chain Sequence
b'PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
publication title The Crystal Structure of Trpd, a Metabolic Enzyme Essential for Lung Colonization by Mycobacterium Tuberculosis, in Complex with its Substrate Phosphoribosylpyrophosphate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 118
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2005-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 2bpqA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 2bpqA02
4GA4A 1BRWA 4N8QA 2WK6A 4X5AA 4XR5A 4OWOA 3QR9A 4YYYA 5EP8A 4YEKA 2GVQA 5EY3A 1AZYA 4OWQA 3R88A 4HKMA 3UU1A 4ZOFA 1V8GA 5BYTA 1UOUA 5BO2A 3QSAA 4IJ1A 4X5CA 4OWMA 5C7SA 3QS8A 4LHMA 2DSJA 4GA6A 5C2LA 5BO3A 4X5DA 5BNEA 4GIUA 4X59A 1O17A 3TWPA 1KHDA 4X46A 4OWUA 4ZTVA 1ZVWA 4GTNA 1VQUA 3H5QA 4X5EA 2ELCA 4X58A 3R6CA 1ZYKA 1OTPA 4MUOA 4OWNA 4YI7A 4GA5A 4OWVA 1ZXYA 4EADA 5C1RA 1GXBA 3QQSA 2WK5A 2J0FA 4OWSA 4GKMA 4EAFA 4X5BA 4ZOKA 4N93A 2BPQA 3GBRA 1KGZA 4N5VA 4ZOJA 2TPTA 4M0RA
chains in the Genus database with same CATH superfamily
4GA4A 1BRWA 4N8QA 2WK6A 4X5AA 4XR5A 1RRZA 4OWOA 3QR9A 4YYYA 5EP8A 4YEKA 2GVQA 1AZYA 5EY3A 4OWQA 3R88A 4HKMA 3UU1A 4ZOFA 1V8GA 5BYTA 1UOUA 5BO2A 3QSAA 4IJ1A 4X5CA 4OWMA 5C7SA 3QS8A 4LHMA 2DSJA 4GA6A 5C2LA 1RF8B 5BO3A 4X5DA 5BNEA 4F3FC 4GIUA 4X59A 1O17A 3TWPA 1KHDA 4X46A 4OWUA 4ZTVA 1ZVWA 4GTNA 1VQUA 3H5QA 4X5EA 2ELCA 4X58A 3R6CA 1ZYKA 1OTPA 4MUOA 4OWNA 4YI7A 4GA5A 4OWVA 1ZXYA 4EADA 5C1RA 1GXBA 3QQSA 2WK5A 2J0FA 4OWSA 4GKMA 4EAFA 4X5BA 4ZOKA 4N93A 2BPQA 3GBRA 1KGZA 4N5VA 4ZOJA 2TPTA 4M0RA
chains in the Genus database with same CATH topology
4GA4A 1BRWA 4N8QA 2WK6A 4X5AA 4XR5A 4OWOA 3QR9A 4YYYA 5EP8A 4YEKA 2GVQA 5EY3A 1AZYA 4OWQA 3R88A 4HKMA 3UU1A 4ZOFA 1V8GA 5BYTA 1UOUA 5BO2A 3QSAA 4IJ1A 4X5CA 4OWMA 5C7SA 3QS8A 4LHMA 2DSJA 4GA6A 5C2LA 5BO3A 4X5DA 5BNEA 4GIUA 4X59A 1O17A 3TWPA 1KHDA 4X46A 4OWUA 4ZTVA 1ZVWA 4GTNA 1VQUA 3H5QA 4X5EA 2ELCA 4X58A 3R6CA 1ZYKA 1OTPA 4MUOA 4OWNA 4YI7A 4GA5A 4OWVA 1ZXYA 4EADA 5C1RA 1GXBA 3QQSA 2WK5A 2J0FA 4OWSA 4GKMA 4EAFA 4X5BA 4ZOKA 4N93A 2BPQA 3GBRA 1KGZA 4N5VA 4ZOJA 2TPTA 4M0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA4 A;  1BRW A;  4N8Q A;  2WK6 A;  4X5A A;  4XR5 A;  4OWO A;  3QR9 A;  4YYY A;  5EP8 A;  4YEK A;  2GVQ A;  5EY3 A;  1AZY A;  4OWQ A;  3R88 A;  4HKM A;  3UU1 A;  4ZOF A;  1V8G A;  5BYT A;  1UOU A;  5BO2 A;  3QSA A;  4IJ1 A;  4X5C A;  4OWM A;  5C7S A;  3QS8 A;  4LHM A;  2DSJ A;  4GA6 A;  5C2L A;  5BO3 A;  4X5D A;  5BNE A;  4GIU A;  4X59 A;  1O17 A;  3TWP A;  1KHD A;  4X46 A;  4OWU A;  4ZTV A;  1ZVW A;  4GTN A;  1VQU A;  3H5Q A;  4X5E A;  2ELC A;  4X58 A;  3R6C A;  1ZYK A;  1OTP A;  4MUO A;  4OWN A;  4YI7 A;  4GA5 A;  4OWV A;  1ZXY A;  4EAD A;  5C1R A;  1GXB A;  3QQS A;  2WK5 A;  2J0F A;  4OWS A;  4GKM A;  4EAF A;  4X5B A;  4ZOK A;  4N93 A;  2BPQ A;  3GBR A;  1KGZ A;  4N5V A;  4ZOJ A;  2TPT A;  4M0R A; 
#chains in the Genus database with same CATH topology
 4GA4 A;  1BRW A;  4N8Q A;  2WK6 A;  4X5A A;  4XR5 A;  1RRZ A;  4OWO A;  3QR9 A;  4YYY A;  5EP8 A;  4YEK A;  2GVQ A;  1AZY A;  5EY3 A;  4OWQ A;  3R88 A;  4HKM A;  3UU1 A;  4ZOF A;  1V8G A;  5BYT A;  1UOU A;  5BO2 A;  3QSA A;  4IJ1 A;  4X5C A;  4OWM A;  5C7S A;  3QS8 A;  4LHM A;  2DSJ A;  4GA6 A;  5C2L A;  1RF8 B;  5BO3 A;  4X5D A;  5BNE A;  4F3F C;  4GIU A;  4X59 A;  1O17 A;  3TWP A;  1KHD A;  4X46 A;  4OWU A;  4ZTV A;  1ZVW A;  4GTN A;  1VQU A;  3H5Q A;  4X5E A;  2ELC A;  4X58 A;  3R6C A;  1ZYK A;  1OTP A;  4MUO A;  4OWN A;  4YI7 A;  4GA5 A;  4OWV A;  1ZXY A;  4EAD A;  5C1R A;  1GXB A;  3QQS A;  2WK5 A;  2J0F A;  4OWS A;  4GKM A;  4EAF A;  4X5B A;  4ZOK A;  4N93 A;  2BPQ A;  3GBR A;  1KGZ A;  4N5V A;  4ZOJ A;  2TPT A;  4M0R A; 
#chains in the Genus database with same CATH homology
 4GA4 A;  1BRW A;  4N8Q A;  2WK6 A;  4X5A A;  4XR5 A;  4OWO A;  3QR9 A;  4YYY A;  5EP8 A;  4YEK A;  2GVQ A;  5EY3 A;  1AZY A;  4OWQ A;  3R88 A;  4HKM A;  3UU1 A;  4ZOF A;  1V8G A;  5BYT A;  1UOU A;  5BO2 A;  3QSA A;  4IJ1 A;  4X5C A;  4OWM A;  5C7S A;  3QS8 A;  4LHM A;  2DSJ A;  4GA6 A;  5C2L A;  5BO3 A;  4X5D A;  5BNE A;  4GIU A;  4X59 A;  1O17 A;  3TWP A;  1KHD A;  4X46 A;  4OWU A;  4ZTV A;  1ZVW A;  4GTN A;  1VQU A;  3H5Q A;  4X5E A;  2ELC A;  4X58 A;  3R6C A;  1ZYK A;  1OTP A;  4MUO A;  4OWN A;  4YI7 A;  4GA5 A;  4OWV A;  1ZXY A;  4EAD A;  5C1R A;  1GXB A;  3QQS A;  2WK5 A;  2J0F A;  4OWS A;  4GKM A;  4EAF A;  4X5B A;  4ZOK A;  4N93 A;  2BPQ A;  3GBR A;  1KGZ A;  4N5V A;  4ZOJ A;  2TPT A;  4M0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...