4F3FC

Crystal structure of msln7-64 morab-009 fab complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
59
structure length
59
Chain Sequence
b'MCPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MORAb-009 Fab light chain
publication title Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 18
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2012-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.40 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 4f3fC00
4F3FC
chains in the Genus database with same CATH superfamily
4X5DA 4M0RA 4HKMA 4ZOJA 3UU1A 4X5EA 4GKMA 5BO2A 5BYTA 2GVQA 4X58A 1KHDA 5BNEA 2ELCA 1V8GA 4OWMA 4LHMA 4GA6A 1VQUA 5EY3A 4EAFA 4X46A 1ZVWA 1UOUA 5C7SA 3QS8A 1KGZA 1OTPA 4X5BA 1RRZA 2WK5A 4GA5A 4OWVA 3TWPA 4X5AA 4XR5A 2WK6A 4OWOA 4N93A 1RF8B 4MUOA 4OWUA 4ZTVA 4YYYA 3QR9A 3R6CA 5C1RA 2J0FA 2BPQA 4OWQA 3QSAA 4N5VA 3GBRA 4F3FC 2DSJA 1AZYA 3H5QA 1ZXYA 5C2LA 1GXBA 5BO3A 4EADA 4GIUA 4GA4A 4IJ1A 4OWNA 4ZOKA 3R88A 4YEKA 4GTNA 4N8QA 4X59A 4ZOFA 1BRWA 3QQSA 4YI7A 1ZYKA 4OWSA 4X5CA 1O17A 5EP8A 2TPTA
chains in the Genus database with same CATH topology
4F3FC 4GA5A 4GA6A 1RF8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3F C; 
#chains in the Genus database with same CATH topology
 4X5D A;  4M0R A;  4HKM A;  4ZOJ A;  3UU1 A;  4X5E A;  4GKM A;  5BO2 A;  5BYT A;  2GVQ A;  4X58 A;  1KHD A;  5BNE A;  2ELC A;  1V8G A;  4OWM A;  4LHM A;  4GA6 A;  1VQU A;  5EY3 A;  4EAF A;  4X46 A;  1ZVW A;  1UOU A;  5C7S A;  3QS8 A;  1KGZ A;  1OTP A;  4X5B A;  1RRZ A;  2WK5 A;  4GA5 A;  4OWV A;  3TWP A;  4X5A A;  4XR5 A;  2WK6 A;  4OWO A;  4N93 A;  1RF8 B;  4MUO A;  4OWU A;  4ZTV A;  4YYY A;  3QR9 A;  3R6C A;  5C1R A;  2J0F A;  2BPQ A;  4OWQ A;  3QSA A;  4N5V A;  3GBR A;  4F3F C;  2DSJ A;  1AZY A;  3H5Q A;  1ZXY A;  5C2L A;  1GXB A;  5BO3 A;  4EAD A;  4GIU A;  4GA4 A;  4IJ1 A;  4OWN A;  4ZOK A;  3R88 A;  4YEK A;  4GTN A;  4N8Q A;  4X59 A;  4ZOF A;  1BRW A;  3QQS A;  4YI7 A;  1ZYK A;  4OWS A;  4X5C A;  1O17 A;  5EP8 A;  2TPT A; 
#chains in the Genus database with same CATH homology
 4F3F C;  4GA5 A;  4GA6 A;  1RF8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...