The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
66
|
structure length |
66
|
Chain Sequence |
MDHSLNSLNNFDFLARSFARMHAEGRPVDILAVTGNMDEEHRTWFCARYAWYCQQMMQARELELEH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of GlgS from Escherichia coli suggests a role in protein-protein interactions.
pubmed doi rcsb |
| molecule tags |
Structural genomics,biosynthetic protein
|
| source organism |
Escherichia coli
|
| molecule keywords |
Glycogen synthesis protein glgS
|
| total genus |
14
|
| structure length |
66
|
| sequence length |
66
|
| ec nomenclature | |
| pdb deposition date | 2003-12-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08971 | GlgS | Glycogen synthesis protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 | Glycogen synthesis protein GlgS |
#chains in the Genus database with same CATH superfamily 1RRZ A; #chains in the Genus database with same CATH topology 4OWO A; 4F3F C; 1ZYK A; 4MUO A; 4XR5 A; 4OWV A; 4GTN A; 5C7S A; 4X5B A; 4YI7 A; 4GIU A; 2J0F A; 1KHD A; 2GVQ A; 1ZVW A; 2BPQ A; 1RRZ A; 2TPT A; 5C2L A; 3QQS A; 4EAF A; 4GA4 A; 3UU1 A; 4GA6 A; 3TWP A; 4GKM A; 1BRW A; 1VQU A; 4OWS A; 5BO3 A; 4X5C A; 2WK5 A; 1RF8 B; 3R88 A; 4N8Q A; 5C1R A; 3QSA A; 4ZOJ A; 4M0R A; 5BYT A; 4HKM A; 4YYY A; 4X5E A; 4GA5 A; 3GBR A; 4ZTV A; 4N5V A; 4X5A A; 4LHM A; 5BNE A; 1V8G A; 4IJ1 A; 1UOU A; 4X58 A; 4ZOF A; 3QR9 A; 1AZY A; 4X59 A; 1O17 A; 4OWQ A; 4N93 A; 4OWM A; 1OTP A; 4OWN A; 3H5Q A; 2WK6 A; 4EAD A; 4YEK A; 5EY3 A; 4X5D A; 1GXB A; 1KGZ A; 5BO2 A; 5EP8 A; 3R6C A; 2DSJ A; 3QS8 A; 1ZXY A; 4X46 A; 4ZOK A; 4OWU A; 2ELC A; #chains in the Genus database with same CATH homology 1RRZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
