The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
18
|
sequence length |
59
|
structure length |
59
|
Chain Sequence |
MCPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDEL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb |
| molecule keywords |
MORAb-009 Fab light chain
|
| molecule tags |
Immune system
|
| source organism |
Mus musculus
|
| total genus |
18
|
| structure length |
59
|
| sequence length |
59
|
| ec nomenclature | |
| pdb deposition date | 2012-05-09 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 | Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 |
#chains in the Genus database with same CATH superfamily 4F3F C; #chains in the Genus database with same CATH topology 1GXB A; 4M0R A; 1RRZ A; 4ZOF A; 1KGZ A; 1UOU A; 2WK6 A; 5C1R A; 5BYT A; 4EAD A; 4N8Q A; 3QQS A; 4ZOJ A; 5BNE A; 1ZYK A; 4X59 A; 5EY3 A; 3QS8 A; 4X5A A; 3TWP A; 1AZY A; 5C7S A; 4X5E A; 4XR5 A; 4GA5 A; 4EAF A; 4GA6 A; 1VQU A; 4X5B A; 4YI7 A; 4X5C A; 4F3F C; 5EP8 A; 1BRW A; 1V8G A; 3QR9 A; 4IJ1 A; 4OWS A; 3H5Q A; 2ELC A; 2TPT A; 1O17 A; 4GIU A; 4ZOK A; 4YYY A; 4GKM A; 4OWM A; 2DSJ A; 4OWO A; 4X58 A; 4OWQ A; 3QSA A; 3R88 A; 3R6C A; 4OWV A; 1ZXY A; 4N5V A; 4X46 A; 2BPQ A; 4OWN A; 4MUO A; 4N93 A; 4GA4 A; 1KHD A; 3UU1 A; 1RF8 B; 5BO2 A; 1ZVW A; 4X5D A; 2WK5 A; 5C2L A; 4GTN A; 2GVQ A; 2J0F A; 1OTP A; 4ZTV A; 5BO3 A; 3GBR A; 4OWU A; 4YEK A; 4LHM A; 4HKM A; #chains in the Genus database with same CATH homology 4GA6 A; 1RF8 B; 4F3F C; 4GA5 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...