1BV1A

Birch pollen allergen bet v 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
159
structure length
159
Chain Sequence
GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGLPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BET V 1
publication title X-ray and NMR structure of Bet v 1, the origin of birch pollen allergy.
pubmed doi rcsb
source organism Betula pendula
molecule tags Allergen
total genus 41
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1997-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1bv1A00
2D4RA 3RT2A 4A8UA 3KDJA 4Z3LA 1EM2A 2PCSA 4LA7A 1LN3A 1XDFA 4IGXA 1BV1A 3NMPA 4A8VA 5I8FA 4IH2A 2EJXA 3H3TA 3W9KA 5JO1A 3E85A 2FFSA 2LEQA 4A8GA 4C94A 3NJ1A 2RERA 1T27A 1XN6A 3TVQA 3NI8A 3GGNA 3JRSA 3PU2A 5JO2A 2LF2A 4XRWA 2RESA 3OJIA 4BKDA 2VQ5A 3K90A 4BKCA 4PSBA 2LCGA 4A84A 5C9YA 1H2OA 5BRLA 2E3OA 3JRQB 1ICXA 4BTZA 3CNWA 2LPXA 3NJOA 5E4DA 2L65A 2KEWA 3TFZA 2BK0A 3P51A 2GKDA 1X53A 4DS8A 4A86A 3KDIA 4N3EA 3UJLA 2WQLA 2E3QA 4C9IA 2VNEA 4M9BA 3ZVUA 1LLTA 4A87A 1XN5A 1XUVA 3NEGA 3NMVA 4DSBA 1UW5A 3NR4A 3ELIA 3NJ0A 3TVRA 4DSCA 2N4AA 4A80A 3H3QA 3Q64A 4A83A 3F08A 4JDLA 4JHGA 4M9WA 1FM4A 4BK7A 1LN2A 3H3RA 1IFVA 3NEFA 2A1LA 4Y31A 2E3PA 5E4BA 4Q0KA 2Z9ZA 5AMWA 4BK6A 2M47A 3UIDA 2PSOA 4IGVA 3NS2A 4IHRA 4A85A 4REIA 1TXCA 2NN5A 2K5GA 2LAKA 2LE1A 5I9JA 4REJA 2KF2A 3NMHA 2E3MA 4RYVA 4GY9A 2QPVA 1TW0A 2MOUA 1ZXFA 4IGWA 1FSKA 1T17A 3RT0C 2LIOA 3RD6A 1E09A 2I9YA 4A81A 4QIPA 2NS9A 4REHA 3Q63A 4R7KA 5JNNA 4B9RA 3OQUA 2FLHA 3NMNA 4XRTA 1QMRA 1KCMA 2LGHA 2M89A 3Q6AA 5E46A 2E3RA 2L8OA 2KCZA 2E3SA 3IE5A 3IJTA 1JSSA 3K3KA 4JHIA 4LGBA 1BTVA 2KTEA 2R55A 4OICA 3KL1A 3NMTA 3QN1A 3UQHA 4IH0A 4IGYA 4LG5A 2IL5A 3H3SA 3KB0A 2LUZA 3KLXA 4JHHA 3R6PA 2E3NA 1B6FA 3KDHA 3TL1A 3KB3A 1Z94A 1LN1A 3QSZA 3KAZA 2L9PA 2QIMA 1VJHA 5E4MA 2LDKA 3PUTA 1XFSA 2K7HA 3OTLA 3WG8A 4JDAA 3W9RA 2N4BA 2REZA 4FPWA 2Q3QA 3OH8A 3P0LA 3C0VA 4N0GC 3P9VA 4C9CA 4MAPA 3KAYA 4MA6A 3FO5A 4A88A 4WVOA 4LGAA 4MNSA 2Z9YA
chains in the Genus database with same CATH superfamily
2D4RA 3RT2A 4A8UA 2LAFA 3KDJA 4Z3LA 1EM2A 2PCSA 3HO1A 4LA7A 1LN3A 1XDFA 4IGXA 1BV1A 3NMPA 4A8VA 5I8FA 4IH2A 2EJXA 3H3TA 3W9KA 5JO1A 3E85A 2FFSA 3DLHA 2LEQA 4A8GA 4C94A 3NJ1A 2RERA 1T27A 1XN6A 3TVQA 3GTEA 3GKEA 3NI8A 3GGNA 3JRSA 3PU2A 4QDFB 5JO2A 2LF2A 4XRWA 2RESA 3OJIA 3GB4A 4BKDA 2VQ5A 3K90A 4BKCA 4PSBA 2LCGA 4A84A 5C9YA 1H2OA 5BRLA 2E3OA 3JRQB 4E6FA 1ICXA 4BTZA 3CNWA 2LPXA 3NJOA 5E4DA 2L65A 3HM9A 2KEWA 3TFZA 2BK0A 3P51A 2GKDA 1X53A 4DS8A 4A86A 3KDIA 4N3EA 3UJLA 2WQLA 2E3QA 4C9IA 2VNEA 4M9BA 3F73A 3ZVUA 1LLTA 4A87A 1XN5A 1XUVA 3NEGA 3NMVA 4DSBA 1UW5A 2ZYLA 3ELIA 3NJ0A 3NR4A 3TVRA 4NCBA 4DSCA 2N4AA 4A80A 3H3QA 3Q64A 4A83A 3F08A 3GL2A 4JDLA 4NCAA 4JHGA 4M9WA 1FM4A 4BK7A 1LN2A 3H3RA 1IFVA 3NEFA 2A1LA 4Y31A 2E3PA 5E4BA 4Q0KA 2Z9ZA 5AMWA 4BK6A 2M47A 3UIDA 4N76A 2PSOA 4IGVA 3NS2A 4IHRA 4A85A 4REIA 1TXCA 2NN5A 2K5GA 2LAKA 2LE1A 5I9JA 4REJA 2KF2A 3NMHA 4QDDA 2E3MA 4RYVA 4GY9A 2QPVA 1TW0A 3NQNA 3HK2A 2MOUA 1ZXFA 4IGWA 1FSKA 1T17A 3RT0C 3HVRA 2LIOA 3RD6A 1E09A 2I9YA 4A81A 4QIPA 2NS9A 4REHA 3Q63A 4R7KA 5JNNA 4B9RA 3OQUA 2FLHA 3NMNA 4KPYA 4XRTA 1QMRA 3GL0A 1KCMA 2LGHA 2M89A 3Q6AA 4QCKA 5E46A 2E3RA 2L8OA 3HJFA 2KCZA 2E3SA 3IE5A 3HXMA 3IJTA 1JSSA 3K3KA 4JHIA 5EKQC 4LGBA 1BTVA 2KTEA 2R55A 4OICA 3KL1A 3NMTA 3QN1A 3UQHA 4IH0A 4IGYA 4LG5A 4QDFA 2IL5A 4N47A 3H3SA 3KB0A 3GTSA 2LUZA 3GOBA 3KLXA 4JHHA 3R6PA 3TGOC 2E3NA 1B6FA 3KDHA 3TL1A 3KB3A 4QDCA 2YH6A 1Z94A 1LN1A 3QSZA 3KAZA 2L9PA 2QIMA 1VJHA 5E4MA 2LDKA 3PUTA 1XFSA 2K7HA 3OTLA 3WG8A 4JDAA 4N41A 3W9RA 2N4BA 2REZA 4FPWA 2Q3QA 3OH8A 3P0LA 4JHYA 3C0VA 4N0GC 3P9VA 4C9CA 4MAPA 3KAYA 4MA6A 3FO5A 4A88A 3DLBA 4WVOA 4LGAA 4MNSA 2Z9YA
chains in the Genus database with same CATH topology
2D4RA 3RT2A 4A8UA 2LAFA 3KDJA 4Z3LA 1EM2A 2PCSA 3HO1A 4LA7A 1LN3A 1XDFA 4IGXA 1BV1A 3NMPA 4A8VA 5I8FA 4IH2A 2EJXA 3H3TA 3W9KA 5JO1A 3E85A 2FFSA 3DLHA 2LEQA 4A8GA 4C94A 3NJ1A 2RERA 1T27A 1XN6A 3TVQA 3GTEA 3GKEA 3NI8A 3GGNA 3JRSA 3PU2A 4QDFB 5JO2A 2LF2A 4XRWA 2RESA 3OJIA 3GB4A 4BKDA 2VQ5A 3K90A 4BKCA 4PSBA 2LCGA 4A84A 5C9YA 1H2OA 5BRLA 2E3OA 3JRQB 4E6FA 1ICXA 4BTZA 3CNWA 2LPXA 3NJOA 5E4DA 2L65A 3HM9A 2KEWA 3TFZA 2BK0A 3P51A 2GKDA 1X53A 4DS8A 4A86A 3KDIA 4N3EA 3UJLA 2WQLA 2E3QA 4C9IA 2VNEA 4M9BA 3F73A 3ZVUA 1LLTA 4A87A 1XN5A 1XUVA 3NEGA 3NMVA 4DSBA 1UW5A 2ZYLA 3ELIA 3NJ0A 3NR4A 3TVRA 4NCBA 4DSCA 2N4AA 4A80A 3H3QA 3Q64A 4A83A 3F08A 3GL2A 4JDLA 4NCAA 4JHGA 4M9WA 1FM4A 4BK7A 1LN2A 3H3RA 1IFVA 3NEFA 2A1LA 4Y31A 2E3PA 5E4BA 4Q0KA 2Z9ZA 5AMWA 4BK6A 2M47A 3UIDA 4N76A 2PSOA 4IGVA 3NS2A 4IHRA 4A85A 4REIA 1TXCA 2NN5A 2K5GA 2LAKA 2LE1A 5I9JA 4REJA 2KF2A 3NMHA 4QDDA 2E3MA 4RYVA 4GY9A 2QPVA 1TW0A 3NQNA 3HK2A 2MOUA 1ZXFA 4IGWA 1FSKA 1T17A 3RT0C 3HVRA 2LIOA 3RD6A 1E09A 2I9YA 4A81A 4QIPA 2NS9A 4REHA 3Q63A 4R7KA 5JNNA 4B9RA 3OQUA 2FLHA 3NMNA 4KPYA 4XRTA 1QMRA 3GL0A 1KCMA 2LGHA 2M89A 3Q6AA 4QCKA 5E46A 2E3RA 2L8OA 3HJFA 2KCZA 2E3SA 3IE5A 3HXMA 3IJTA 1JSSA 3K3KA 4JHIA 5EKQC 4LGBA 1BTVA 2KTEA 2R55A 4OICA 3KL1A 3NMTA 3QN1A 3UQHA 4IH0A 4IGYA 4LG5A 4QDFA 2IL5A 4N47A 3H3SA 3KB0A 3GTSA 2LUZA 3GOBA 3KLXA 4JHHA 3R6PA 3TGOC 2E3NA 1B6FA 3KDHA 3TL1A 3KB3A 4QDCA 2YH6A 1Z94A 1LN1A 3QSZA 3KAZA 2L9PA 2QIMA 1VJHA 5E4MA 2LDKA 3PUTA 1XFSA 2K7HA 3OTLA 3WG8A 4JDAA 4N41A 3W9RA 2N4BA 2REZA 4FPWA 2Q3QA 3OH8A 3P0LA 4JHYA 3C0VA 4N0GC 3P9VA 4C9CA 4MAPA 3KAYA 4MA6A 3FO5A 4A88A 3DLBA 4WVOA 4LGAA 4MNSA 2Z9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4R A;  3RT2 A;  4A8U A;  3KDJ A;  4Z3L A;  1EM2 A;  2PCS A;  4LA7 A;  1LN3 A;  1XDF A;  4IGX A;  1BV1 A;  3NMP A;  4A8V A;  5I8F A;  4IH2 A;  2EJX A;  3H3T A;  3W9K A;  5JO1 A;  3E85 A;  2FFS A;  2LEQ A;  4A8G A;  4C94 A;  3NJ1 A;  2RER A;  1T27 A;  1XN6 A;  3TVQ A;  3NI8 A;  3GGN A;  3JRS A;  3PU2 A;  5JO2 A;  2LF2 A;  4XRW A;  2RES A;  3OJI A;  4BKD A;  2VQ5 A;  3K90 A;  4BKC A;  4PSB A;  2LCG A;  4A84 A;  5C9Y A;  1H2O A;  5BRL A;  2E3O A;  3JRQ B;  1ICX A;  4BTZ A;  3CNW A;  2LPX A;  3NJO A;  5E4D A;  2L65 A;  2KEW A;  3TFZ A;  2BK0 A;  3P51 A;  2GKD A;  1X53 A;  4DS8 A;  4A86 A;  3KDI A;  4N3E A;  3UJL A;  2WQL A;  2E3Q A;  4C9I A;  2VNE A;  4M9B A;  3ZVU A;  1LLT A;  4A87 A;  1XN5 A;  1XUV A;  3NEG A;  3NMV A;  4DSB A;  1UW5 A;  3NR4 A;  3ELI A;  3NJ0 A;  3TVR A;  4DSC A;  2N4A A;  4A80 A;  3H3Q A;  3Q64 A;  4A83 A;  3F08 A;  4JDL A;  4JHG A;  4M9W A;  1FM4 A;  4BK7 A;  1LN2 A;  3H3R A;  1IFV A;  3NEF A;  2A1L A;  4Y31 A;  2E3P A;  5E4B A;  4Q0K A;  2Z9Z A;  5AMW A;  4BK6 A;  2M47 A;  3UID A;  2PSO A;  4IGV A;  3NS2 A;  4IHR A;  4A85 A;  4REI A;  1TXC A;  2NN5 A;  2K5G A;  2LAK A;  2LE1 A;  5I9J A;  4REJ A;  2KF2 A;  3NMH A;  2E3M A;  4RYV A;  4GY9 A;  2QPV A;  1TW0 A;  2MOU A;  1ZXF A;  4IGW A;  1FSK A;  1T17 A;  3RT0 C;  2LIO A;  3RD6 A;  1E09 A;  2I9Y A;  4A81 A;  4QIP A;  2NS9 A;  4REH A;  3Q63 A;  4R7K A;  5JNN A;  4B9R A;  3OQU A;  2FLH A;  3NMN A;  4XRT A;  1QMR A;  1KCM A;  2LGH A;  2M89 A;  3Q6A A;  5E46 A;  2E3R A;  2L8O A;  2KCZ A;  2E3S A;  3IE5 A;  3IJT A;  1JSS A;  3K3K A;  4JHI A;  4LGB A;  1BTV A;  2KTE A;  2R55 A;  4OIC A;  3KL1 A;  3NMT A;  3QN1 A;  3UQH A;  4IH0 A;  4IGY A;  4LG5 A;  2IL5 A;  3H3S A;  3KB0 A;  2LUZ A;  3KLX A;  4JHH A;  3R6P A;  2E3N A;  1B6F A;  3KDH A;  3TL1 A;  3KB3 A;  1Z94 A;  1LN1 A;  3QSZ A;  3KAZ A;  2L9P A;  2QIM A;  1VJH A;  5E4M A;  2LDK A;  3PUT A;  1XFS A;  2K7H A;  3OTL A;  3WG8 A;  4JDA A;  3W9R A;  2N4B A;  2REZ A;  4FPW A;  2Q3Q A;  3OH8 A;  3P0L A;  3C0V A;  4N0G C;  3P9V A;  4C9C A;  4MAP A;  3KAY A;  4MA6 A;  3FO5 A;  4A88 A;  4WVO A;  4LGA A;  4MNS A;  2Z9Y A; 
#chains in the Genus database with same CATH topology
 2D4R A;  3RT2 A;  4A8U A;  2LAF A;  3KDJ A;  4Z3L A;  1EM2 A;  2PCS A;  3HO1 A;  4LA7 A;  1LN3 A;  1XDF A;  4IGX A;  1BV1 A;  3NMP A;  4A8V A;  5I8F A;  4IH2 A;  2EJX A;  3H3T A;  3W9K A;  5JO1 A;  3E85 A;  2FFS A;  3DLH A;  2LEQ A;  4A8G A;  4C94 A;  3NJ1 A;  2RER A;  1T27 A;  1XN6 A;  3TVQ A;  3GTE A;  3GKE A;  3NI8 A;  3GGN A;  3JRS A;  3PU2 A;  4QDF B;  5JO2 A;  2LF2 A;  4XRW A;  2RES A;  3OJI A;  3GB4 A;  4BKD A;  2VQ5 A;  3K90 A;  4BKC A;  4PSB A;  2LCG A;  4A84 A;  5C9Y A;  1H2O A;  5BRL A;  2E3O A;  3JRQ B;  4E6F A;  1ICX A;  4BTZ A;  3CNW A;  2LPX A;  3NJO A;  5E4D A;  2L65 A;  3HM9 A;  2KEW A;  3TFZ A;  2BK0 A;  3P51 A;  2GKD A;  1X53 A;  4DS8 A;  4A86 A;  3KDI A;  4N3E A;  3UJL A;  2WQL A;  2E3Q A;  4C9I A;  2VNE A;  4M9B A;  3F73 A;  3ZVU A;  1LLT A;  4A87 A;  1XN5 A;  1XUV A;  3NEG A;  3NMV A;  4DSB A;  1UW5 A;  2ZYL A;  3ELI A;  3NJ0 A;  3NR4 A;  3TVR A;  4NCB A;  4DSC A;  2N4A A;  4A80 A;  3H3Q A;  3Q64 A;  4A83 A;  3F08 A;  3GL2 A;  4JDL A;  4NCA A;  4JHG A;  4M9W A;  1FM4 A;  4BK7 A;  1LN2 A;  3H3R A;  1IFV A;  3NEF A;  2A1L A;  4Y31 A;  2E3P A;  5E4B A;  4Q0K A;  2Z9Z A;  5AMW A;  4BK6 A;  2M47 A;  3UID A;  4N76 A;  2PSO A;  4IGV A;  3NS2 A;  4IHR A;  4A85 A;  4REI A;  1TXC A;  2NN5 A;  2K5G A;  2LAK A;  2LE1 A;  5I9J A;  4REJ A;  2KF2 A;  3NMH A;  4QDD A;  2E3M A;  4RYV A;  4GY9 A;  2QPV A;  1TW0 A;  3NQN A;  3HK2 A;  2MOU A;  1ZXF A;  4IGW A;  1FSK A;  1T17 A;  3RT0 C;  3HVR A;  2LIO A;  3RD6 A;  1E09 A;  2I9Y A;  4A81 A;  4QIP A;  2NS9 A;  4REH A;  3Q63 A;  4R7K A;  5JNN A;  4B9R A;  3OQU A;  2FLH A;  3NMN A;  4KPY A;  4XRT A;  1QMR A;  3GL0 A;  1KCM A;  2LGH A;  2M89 A;  3Q6A A;  4QCK A;  5E46 A;  2E3R A;  2L8O A;  3HJF A;  2KCZ A;  2E3S A;  3IE5 A;  3HXM A;  3IJT A;  1JSS A;  3K3K A;  4JHI A;  5EKQ C;  4LGB A;  1BTV A;  2KTE A;  2R55 A;  4OIC A;  3KL1 A;  3NMT A;  3QN1 A;  3UQH A;  4IH0 A;  4IGY A;  4LG5 A;  4QDF A;  2IL5 A;  4N47 A;  3H3S A;  3KB0 A;  3GTS A;  2LUZ A;  3GOB A;  3KLX A;  4JHH A;  3R6P A;  3TGO C;  2E3N A;  1B6F A;  3KDH A;  3TL1 A;  3KB3 A;  4QDC A;  2YH6 A;  1Z94 A;  1LN1 A;  3QSZ A;  3KAZ A;  2L9P A;  2QIM A;  1VJH A;  5E4M A;  2LDK A;  3PUT A;  1XFS A;  2K7H A;  3OTL A;  3WG8 A;  4JDA A;  4N41 A;  3W9R A;  2N4B A;  2REZ A;  4FPW A;  2Q3Q A;  3OH8 A;  3P0L A;  4JHY A;  3C0V A;  4N0G C;  3P9V A;  4C9C A;  4MAP A;  3KAY A;  4MA6 A;  3FO5 A;  4A88 A;  3DLB A;  4WVO A;  4LGA A;  4MNS A;  2Z9Y A; 
#chains in the Genus database with same CATH homology
 2D4R A;  3RT2 A;  4A8U A;  2LAF A;  3KDJ A;  4Z3L A;  1EM2 A;  2PCS A;  3HO1 A;  4LA7 A;  1LN3 A;  1XDF A;  4IGX A;  1BV1 A;  3NMP A;  4A8V A;  5I8F A;  4IH2 A;  2EJX A;  3H3T A;  3W9K A;  5JO1 A;  3E85 A;  2FFS A;  3DLH A;  2LEQ A;  4A8G A;  4C94 A;  3NJ1 A;  2RER A;  1T27 A;  1XN6 A;  3TVQ A;  3GTE A;  3GKE A;  3NI8 A;  3GGN A;  3JRS A;  3PU2 A;  4QDF B;  5JO2 A;  2LF2 A;  4XRW A;  2RES A;  3OJI A;  3GB4 A;  4BKD A;  2VQ5 A;  3K90 A;  4BKC A;  4PSB A;  2LCG A;  4A84 A;  5C9Y A;  1H2O A;  5BRL A;  2E3O A;  3JRQ B;  4E6F A;  1ICX A;  4BTZ A;  3CNW A;  2LPX A;  3NJO A;  5E4D A;  2L65 A;  3HM9 A;  2KEW A;  3TFZ A;  2BK0 A;  3P51 A;  2GKD A;  1X53 A;  4DS8 A;  4A86 A;  3KDI A;  4N3E A;  3UJL A;  2WQL A;  2E3Q A;  4C9I A;  2VNE A;  4M9B A;  3F73 A;  3ZVU A;  1LLT A;  4A87 A;  1XN5 A;  1XUV A;  3NEG A;  3NMV A;  4DSB A;  1UW5 A;  2ZYL A;  3ELI A;  3NJ0 A;  3NR4 A;  3TVR A;  4NCB A;  4DSC A;  2N4A A;  4A80 A;  3H3Q A;  3Q64 A;  4A83 A;  3F08 A;  3GL2 A;  4JDL A;  4NCA A;  4JHG A;  4M9W A;  1FM4 A;  4BK7 A;  1LN2 A;  3H3R A;  1IFV A;  3NEF A;  2A1L A;  4Y31 A;  2E3P A;  5E4B A;  4Q0K A;  2Z9Z A;  5AMW A;  4BK6 A;  2M47 A;  3UID A;  4N76 A;  2PSO A;  4IGV A;  3NS2 A;  4IHR A;  4A85 A;  4REI A;  1TXC A;  2NN5 A;  2K5G A;  2LAK A;  2LE1 A;  5I9J A;  4REJ A;  2KF2 A;  3NMH A;  4QDD A;  2E3M A;  4RYV A;  4GY9 A;  2QPV A;  1TW0 A;  3NQN A;  3HK2 A;  2MOU A;  1ZXF A;  4IGW A;  1FSK A;  1T17 A;  3RT0 C;  3HVR A;  2LIO A;  3RD6 A;  1E09 A;  2I9Y A;  4A81 A;  4QIP A;  2NS9 A;  4REH A;  3Q63 A;  4R7K A;  5JNN A;  4B9R A;  3OQU A;  2FLH A;  3NMN A;  4KPY A;  4XRT A;  1QMR A;  3GL0 A;  1KCM A;  2LGH A;  2M89 A;  3Q6A A;  4QCK A;  5E46 A;  2E3R A;  2L8O A;  3HJF A;  2KCZ A;  2E3S A;  3IE5 A;  3HXM A;  3IJT A;  1JSS A;  3K3K A;  4JHI A;  5EKQ C;  4LGB A;  1BTV A;  2KTE A;  2R55 A;  4OIC A;  3KL1 A;  3NMT A;  3QN1 A;  3UQH A;  4IH0 A;  4IGY A;  4LG5 A;  4QDF A;  2IL5 A;  4N47 A;  3H3S A;  3KB0 A;  3GTS A;  2LUZ A;  3GOB A;  3KLX A;  4JHH A;  3R6P A;  3TGO C;  2E3N A;  1B6F A;  3KDH A;  3TL1 A;  3KB3 A;  4QDC A;  2YH6 A;  1Z94 A;  1LN1 A;  3QSZ A;  3KAZ A;  2L9P A;  2QIM A;  1VJH A;  5E4M A;  2LDK A;  3PUT A;  1XFS A;  2K7H A;  3OTL A;  3WG8 A;  4JDA A;  4N41 A;  3W9R A;  2N4B A;  2REZ A;  4FPW A;  2Q3Q A;  3OH8 A;  3P0L A;  4JHY A;  3C0V A;  4N0G C;  3P9V A;  4C9C A;  4MAP A;  3KAY A;  4MA6 A;  3FO5 A;  4A88 A;  3DLB A;  4WVO A;  4LGA A;  4MNS A;  2Z9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...