2KEWA

The solution structure of bacillus subtilis sr211 start domain by nmr spectroscopy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
152
structure length
152
Chain Sequence
MAQNNENALPDITKSITLEAPIQKVWETVSTSEGIAKWFMPNDFQLKEGQEFHLQSPFGPSPCKVLAVQAPTELSFEWDTEGWVVTFQLEDLGEKTGFTLIHSGWKEPNQVIGKANEKSSVVRGKMDGGWTGIVNERLRKAVEELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yndB
publication title (1)H, (13)C, and (15)N NMR assignments for the Bacillus subtilis yndB START domain.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
total genus 30
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2009-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2kewA00
3KB3A 2L9PA 1TXCA 3JRSA 2IL5A 3OH8A 4A88A 1Z94A 2LPXA 4A83A 2N4BA 3Q64A 2E3MA 3NMVA 1IFVA 4IGXA 3W9RA 4C9CA 2WQLA 5E4MA 1XFSA 2R55A 3NI8A 3PU2A 3KDJA 4A8UA 5JNNA 3NJ1A 3NMNA 3NR4A 4LGAA 4A8GA 2QIMA 3OTLA 3NS2A 1EM2A 3H3RA 3Q6AA 4DSCA 3P9VA 2M47A 4IGWA 4JHHA 4BK6A 4IGYA 3K90A 1H2OA 3C0VA 2EJXA 4XRTA 3W9KA 4QIPA 1XDFA 2RESA 1JSSA 1LN3A 3TVQA 3CNWA 3UIDA 4A80A 3JRQB 3UQHA 3NJ0A 2Z9ZA 4LG5A 3NEFA 4MNSA 1BV1A 2E3QA 2FLHA 2NN5A 3NMTA 1QMRA 4BKDA 4Q0KA 1LLTA 2KEWA 4BKCA 3TFZA 2KF2A 3RD6A 3KAYA 2PCSA 4R7KA 2K5GA 2I9YA 4A8VA 2GKDA 2KCZA 4MA6A 4OICA 5JO2A 3ZVUA 4WVOA 3RT0C 5BRLA 3H3QA 3E85A 3OQUA 3K3KA 4A85A 3NMHA 4N0GC 3H3TA 3PUTA 4REHA 2E3NA 4GY9A 1KCMA 4IH2A 1XN5A 3P0LA 1BTVA 4DS8A 3NMPA 4A84A 2M89A 1VJHA 3IE5A 5I9JA 4C94A 3TVRA 3R6PA 4REJA 4BK7A 2REZA 2Z9YA 3Q63A 2E3RA 2L65A 2LUZA 4JHGA 2LIOA 2E3PA 2VQ5A 3KL1A 1XN6A 4LA7A 2BK0A 1FM4A 3QSZA 5E4DA 1ICXA 3ELIA 3KDHA 4B9RA 2KTEA 4M9BA 2E3SA 1TW0A 4PSBA 2NS9A 4Y31A 4FPWA 2A1LA 2LGHA 4JDLA 4JHIA 4C9IA 2K7HA 4IGVA 5I8FA 5JO1A 3KDIA 4REIA 3P51A 1B6FA 4M9WA 2VNEA 3KB0A 2E3OA 4XRWA 4A81A 1LN2A 1E09A 2LE1A 1X53A 4Z3LA 1LN1A 3WG8A 2LEQA 4DSBA 2LF2A 3OJIA 2PSOA 2RERA 3NJOA 4N3EA 3RT2A 3H3SA 4MAPA 2LAKA 4A87A 2QPVA 1XUVA 3UJLA 1ZXFA 2N4AA 4IH0A 3GGNA 2D4RA 4JDAA 1FSKA 1T17A 2FFSA 4RYVA 4A86A 3NEGA 3TL1A 2LCGA 4IHRA 5AMWA 3QN1A 4LGBA 3FO5A 3F08A 2MOUA 3IJTA 1T27A 5E4BA 2L8OA 1UW5A 2Q3QA 4BTZA 3KAZA 2LDKA 5C9YA 3KLXA 5E46A
chains in the Genus database with same CATH superfamily
4KPYA 3KB3A 2L9PA 1TXCA 3JRSA 2IL5A 3OH8A 4A88A 1Z94A 2LPXA 4A83A 2N4BA 3Q64A 2E3MA 3NMVA 1IFVA 4IGXA 3W9RA 4C9CA 3GOBA 4E6FA 2WQLA 5E4MA 1XFSA 2R55A 3NI8A 3PU2A 3NQNA 3KDJA 3GTSA 4A8UA 5JNNA 3NJ1A 3NMNA 3NR4A 4LGAA 3GL0A 3GL2A 4A8GA 2QIMA 3OTLA 3NS2A 1EM2A 3H3RA 3Q6AA 4DSCA 3P9VA 2M47A 4IGWA 4JHHA 4BK6A 4IGYA 3K90A 1H2OA 3C0VA 2EJXA 4QDCA 4XRTA 3W9KA 4NCBA 4QIPA 1XDFA 2RESA 1JSSA 1LN3A 3TVQA 3CNWA 3UIDA 4A80A 3F73A 3JRQB 3UQHA 3NJ0A 2Z9ZA 4LG5A 3NEFA 4MNSA 3GTEA 1BV1A 2E3QA 2FLHA 2NN5A 3NMTA 4NCAA 1QMRA 4BKDA 4Q0KA 1LLTA 2KEWA 4BKCA 3TFZA 2KF2A 3RD6A 3KAYA 2PCSA 4R7KA 2K5GA 2I9YA 4A8VA 2GKDA 2KCZA 4MA6A 2LAFA 4OICA 5JO2A 3ZVUA 4WVOA 3RT0C 5BRLA 3H3QA 3E85A 3OQUA 3K3KA 4A85A 3NMHA 4N0GC 3H3TA 3PUTA 4JHYA 4REHA 2E3NA 4GY9A 1KCMA 4IH2A 1XN5A 3P0LA 1BTVA 4DS8A 3NMPA 4A84A 2M89A 1VJHA 3IE5A 5I9JA 4C94A 3HVRA 3TGOC 3TVRA 3R6PA 4REJA 4BK7A 3HK2A 2REZA 2Z9YA 3Q63A 2E3RA 2L65A 2LUZA 4JHGA 2LIOA 2E3PA 2VQ5A 3KL1A 1XN6A 4LA7A 2BK0A 1FM4A 3QSZA 5E4DA 1ICXA 3ELIA 3GB4A 4N47A 3KDHA 4B9RA 2KTEA 4M9BA 2E3SA 1TW0A 4PSBA 2NS9A 4Y31A 3DLHA 4FPWA 2A1LA 2LGHA 4JDLA 2ZYLA 4JHIA 2K7HA 4IGVA 4C9IA 5I8FA 5JO1A 3KDIA 4REIA 3P51A 4QDFA 4M9WA 1B6FA 2VNEA 3KB0A 2E3OA 4XRWA 4A81A 1LN2A 1E09A 2LE1A 1X53A 4QDFB 4Z3LA 1LN1A 4QDDA 3WG8A 2LEQA 4DSBA 2LF2A 4QCKA 3OJIA 2PSOA 2RERA 3NJOA 4N3EA 3RT2A 3H3SA 3HXMA 4MAPA 2LAKA 4A87A 2QPVA 4N76A 4N41A 1XUVA 2YH6A 3UJLA 1ZXFA 2N4AA 4IH0A 3HJFA 3GGNA 2D4RA 4JDAA 1FSKA 1T17A 2FFSA 4RYVA 4A86A 3NEGA 3DLBA 5EKQC 3TL1A 2LCGA 4IHRA 3GKEA 5AMWA 3QN1A 4LGBA 3FO5A 3F08A 3HM9A 2MOUA 3IJTA 1T27A 5E4BA 3HO1A 2L8OA 1UW5A 2Q3QA 4BTZA 3KAZA 2LDKA 5C9YA 3KLXA 5E46A
chains in the Genus database with same CATH topology
4KPYA 3KB3A 2L9PA 1TXCA 3JRSA 2IL5A 3OH8A 4A88A 1Z94A 2LPXA 4A83A 2N4BA 3Q64A 2E3MA 3NMVA 1IFVA 4IGXA 3W9RA 4C9CA 3GOBA 4E6FA 2WQLA 5E4MA 1XFSA 2R55A 3NI8A 3PU2A 3NQNA 3KDJA 3GTSA 4A8UA 5JNNA 3NJ1A 3NMNA 3NR4A 4LGAA 3GL0A 3GL2A 4A8GA 2QIMA 3OTLA 3NS2A 1EM2A 3H3RA 3Q6AA 4DSCA 3P9VA 2M47A 4IGWA 4JHHA 4BK6A 4IGYA 3K90A 1H2OA 3C0VA 2EJXA 4QDCA 4XRTA 3W9KA 4NCBA 4QIPA 1XDFA 2RESA 1JSSA 1LN3A 3TVQA 3CNWA 3UIDA 4A80A 3F73A 3JRQB 3UQHA 3NJ0A 2Z9ZA 4LG5A 3NEFA 4MNSA 3GTEA 1BV1A 2E3QA 2FLHA 2NN5A 3NMTA 4NCAA 1QMRA 4BKDA 4Q0KA 1LLTA 2KEWA 4BKCA 3TFZA 2KF2A 3RD6A 3KAYA 2PCSA 4R7KA 2K5GA 2I9YA 4A8VA 2GKDA 2KCZA 4MA6A 2LAFA 4OICA 5JO2A 3ZVUA 4WVOA 3RT0C 5BRLA 3H3QA 3E85A 3OQUA 3K3KA 4A85A 3NMHA 4N0GC 3H3TA 3PUTA 4JHYA 4REHA 2E3NA 4GY9A 1KCMA 4IH2A 1XN5A 3P0LA 1BTVA 4DS8A 3NMPA 4A84A 2M89A 1VJHA 3IE5A 5I9JA 4C94A 3HVRA 3TGOC 3TVRA 3R6PA 4REJA 4BK7A 3HK2A 2REZA 2Z9YA 3Q63A 2E3RA 2L65A 2LUZA 4JHGA 2LIOA 2E3PA 2VQ5A 3KL1A 1XN6A 4LA7A 2BK0A 1FM4A 3QSZA 5E4DA 1ICXA 3ELIA 3GB4A 4N47A 3KDHA 4B9RA 2KTEA 4M9BA 2E3SA 1TW0A 4PSBA 2NS9A 4Y31A 3DLHA 4FPWA 2A1LA 2LGHA 4JDLA 2ZYLA 4JHIA 2K7HA 4IGVA 4C9IA 5I8FA 5JO1A 3KDIA 4REIA 3P51A 4QDFA 4M9WA 1B6FA 2VNEA 3KB0A 2E3OA 4XRWA 4A81A 1LN2A 1E09A 2LE1A 1X53A 4QDFB 4Z3LA 1LN1A 4QDDA 3WG8A 2LEQA 4DSBA 2LF2A 4QCKA 3OJIA 2PSOA 2RERA 3NJOA 4N3EA 3RT2A 3H3SA 3HXMA 4MAPA 2LAKA 4A87A 2QPVA 4N76A 4N41A 1XUVA 2YH6A 3UJLA 1ZXFA 2N4AA 4IH0A 3HJFA 3GGNA 2D4RA 4JDAA 1FSKA 1T17A 2FFSA 4RYVA 4A86A 3NEGA 3DLBA 5EKQC 3TL1A 2LCGA 4IHRA 3GKEA 5AMWA 3QN1A 4LGBA 3FO5A 3F08A 3HM9A 2MOUA 3IJTA 1T27A 5E4BA 3HO1A 2L8OA 1UW5A 2Q3QA 4BTZA 3KAZA 2LDKA 5C9YA 3KLXA 5E46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KB3 A;  2L9P A;  1TXC A;  3JRS A;  2IL5 A;  3OH8 A;  4A88 A;  1Z94 A;  2LPX A;  4A83 A;  2N4B A;  3Q64 A;  2E3M A;  3NMV A;  1IFV A;  4IGX A;  3W9R A;  4C9C A;  2WQL A;  5E4M A;  1XFS A;  2R55 A;  3NI8 A;  3PU2 A;  3KDJ A;  4A8U A;  5JNN A;  3NJ1 A;  3NMN A;  3NR4 A;  4LGA A;  4A8G A;  2QIM A;  3OTL A;  3NS2 A;  1EM2 A;  3H3R A;  3Q6A A;  4DSC A;  3P9V A;  2M47 A;  4IGW A;  4JHH A;  4BK6 A;  4IGY A;  3K90 A;  1H2O A;  3C0V A;  2EJX A;  4XRT A;  3W9K A;  4QIP A;  1XDF A;  2RES A;  1JSS A;  1LN3 A;  3TVQ A;  3CNW A;  3UID A;  4A80 A;  3JRQ B;  3UQH A;  3NJ0 A;  2Z9Z A;  4LG5 A;  3NEF A;  4MNS A;  1BV1 A;  2E3Q A;  2FLH A;  2NN5 A;  3NMT A;  1QMR A;  4BKD A;  4Q0K A;  1LLT A;  2KEW A;  4BKC A;  3TFZ A;  2KF2 A;  3RD6 A;  3KAY A;  2PCS A;  4R7K A;  2K5G A;  2I9Y A;  4A8V A;  2GKD A;  2KCZ A;  4MA6 A;  4OIC A;  5JO2 A;  3ZVU A;  4WVO A;  3RT0 C;  5BRL A;  3H3Q A;  3E85 A;  3OQU A;  3K3K A;  4A85 A;  3NMH A;  4N0G C;  3H3T A;  3PUT A;  4REH A;  2E3N A;  4GY9 A;  1KCM A;  4IH2 A;  1XN5 A;  3P0L A;  1BTV A;  4DS8 A;  3NMP A;  4A84 A;  2M89 A;  1VJH A;  3IE5 A;  5I9J A;  4C94 A;  3TVR A;  3R6P A;  4REJ A;  4BK7 A;  2REZ A;  2Z9Y A;  3Q63 A;  2E3R A;  2L65 A;  2LUZ A;  4JHG A;  2LIO A;  2E3P A;  2VQ5 A;  3KL1 A;  1XN6 A;  4LA7 A;  2BK0 A;  1FM4 A;  3QSZ A;  5E4D A;  1ICX A;  3ELI A;  3KDH A;  4B9R A;  2KTE A;  4M9B A;  2E3S A;  1TW0 A;  4PSB A;  2NS9 A;  4Y31 A;  4FPW A;  2A1L A;  2LGH A;  4JDL A;  4JHI A;  4C9I A;  2K7H A;  4IGV A;  5I8F A;  5JO1 A;  3KDI A;  4REI A;  3P51 A;  1B6F A;  4M9W A;  2VNE A;  3KB0 A;  2E3O A;  4XRW A;  4A81 A;  1LN2 A;  1E09 A;  2LE1 A;  1X53 A;  4Z3L A;  1LN1 A;  3WG8 A;  2LEQ A;  4DSB A;  2LF2 A;  3OJI A;  2PSO A;  2RER A;  3NJO A;  4N3E A;  3RT2 A;  3H3S A;  4MAP A;  2LAK A;  4A87 A;  2QPV A;  1XUV A;  3UJL A;  1ZXF A;  2N4A A;  4IH0 A;  3GGN A;  2D4R A;  4JDA A;  1FSK A;  1T17 A;  2FFS A;  4RYV A;  4A86 A;  3NEG A;  3TL1 A;  2LCG A;  4IHR A;  5AMW A;  3QN1 A;  4LGB A;  3FO5 A;  3F08 A;  2MOU A;  3IJT A;  1T27 A;  5E4B A;  2L8O A;  1UW5 A;  2Q3Q A;  4BTZ A;  3KAZ A;  2LDK A;  5C9Y A;  3KLX A;  5E46 A; 
#chains in the Genus database with same CATH topology
 4KPY A;  3KB3 A;  2L9P A;  1TXC A;  3JRS A;  2IL5 A;  3OH8 A;  4A88 A;  1Z94 A;  2LPX A;  4A83 A;  2N4B A;  3Q64 A;  2E3M A;  3NMV A;  1IFV A;  4IGX A;  3W9R A;  4C9C A;  3GOB A;  4E6F A;  2WQL A;  5E4M A;  1XFS A;  2R55 A;  3NI8 A;  3PU2 A;  3NQN A;  3KDJ A;  3GTS A;  4A8U A;  5JNN A;  3NJ1 A;  3NMN A;  3NR4 A;  4LGA A;  3GL0 A;  3GL2 A;  4A8G A;  2QIM A;  3OTL A;  3NS2 A;  1EM2 A;  3H3R A;  3Q6A A;  4DSC A;  3P9V A;  2M47 A;  4IGW A;  4JHH A;  4BK6 A;  4IGY A;  3K90 A;  1H2O A;  3C0V A;  2EJX A;  4QDC A;  4XRT A;  3W9K A;  4NCB A;  4QIP A;  1XDF A;  2RES A;  1JSS A;  1LN3 A;  3TVQ A;  3CNW A;  3UID A;  4A80 A;  3F73 A;  3JRQ B;  3UQH A;  3NJ0 A;  2Z9Z A;  4LG5 A;  3NEF A;  4MNS A;  3GTE A;  1BV1 A;  2E3Q A;  2FLH A;  2NN5 A;  3NMT A;  4NCA A;  1QMR A;  4BKD A;  4Q0K A;  1LLT A;  2KEW A;  4BKC A;  3TFZ A;  2KF2 A;  3RD6 A;  3KAY A;  2PCS A;  4R7K A;  2K5G A;  2I9Y A;  4A8V A;  2GKD A;  2KCZ A;  4MA6 A;  2LAF A;  4OIC A;  5JO2 A;  3ZVU A;  4WVO A;  3RT0 C;  5BRL A;  3H3Q A;  3E85 A;  3OQU A;  3K3K A;  4A85 A;  3NMH A;  4N0G C;  3H3T A;  3PUT A;  4JHY A;  4REH A;  2E3N A;  4GY9 A;  1KCM A;  4IH2 A;  1XN5 A;  3P0L A;  1BTV A;  4DS8 A;  3NMP A;  4A84 A;  2M89 A;  1VJH A;  3IE5 A;  5I9J A;  4C94 A;  3HVR A;  3TGO C;  3TVR A;  3R6P A;  4REJ A;  4BK7 A;  3HK2 A;  2REZ A;  2Z9Y A;  3Q63 A;  2E3R A;  2L65 A;  2LUZ A;  4JHG A;  2LIO A;  2E3P A;  2VQ5 A;  3KL1 A;  1XN6 A;  4LA7 A;  2BK0 A;  1FM4 A;  3QSZ A;  5E4D A;  1ICX A;  3ELI A;  3GB4 A;  4N47 A;  3KDH A;  4B9R A;  2KTE A;  4M9B A;  2E3S A;  1TW0 A;  4PSB A;  2NS9 A;  4Y31 A;  3DLH A;  4FPW A;  2A1L A;  2LGH A;  4JDL A;  2ZYL A;  4JHI A;  2K7H A;  4IGV A;  4C9I A;  5I8F A;  5JO1 A;  3KDI A;  4REI A;  3P51 A;  4QDF A;  4M9W A;  1B6F A;  2VNE A;  3KB0 A;  2E3O A;  4XRW A;  4A81 A;  1LN2 A;  1E09 A;  2LE1 A;  1X53 A;  4QDF B;  4Z3L A;  1LN1 A;  4QDD A;  3WG8 A;  2LEQ A;  4DSB A;  2LF2 A;  4QCK A;  3OJI A;  2PSO A;  2RER A;  3NJO A;  4N3E A;  3RT2 A;  3H3S A;  3HXM A;  4MAP A;  2LAK A;  4A87 A;  2QPV A;  4N76 A;  4N41 A;  1XUV A;  2YH6 A;  3UJL A;  1ZXF A;  2N4A A;  4IH0 A;  3HJF A;  3GGN A;  2D4R A;  4JDA A;  1FSK A;  1T17 A;  2FFS A;  4RYV A;  4A86 A;  3NEG A;  3DLB A;  5EKQ C;  3TL1 A;  2LCG A;  4IHR A;  3GKE A;  5AMW A;  3QN1 A;  4LGB A;  3FO5 A;  3F08 A;  3HM9 A;  2MOU A;  3IJT A;  1T27 A;  5E4B A;  3HO1 A;  2L8O A;  1UW5 A;  2Q3Q A;  4BTZ A;  3KAZ A;  2LDK A;  5C9Y A;  3KLX A;  5E46 A; 
#chains in the Genus database with same CATH homology
 4KPY A;  3KB3 A;  2L9P A;  1TXC A;  3JRS A;  2IL5 A;  3OH8 A;  4A88 A;  1Z94 A;  2LPX A;  4A83 A;  2N4B A;  3Q64 A;  2E3M A;  3NMV A;  1IFV A;  4IGX A;  3W9R A;  4C9C A;  3GOB A;  4E6F A;  2WQL A;  5E4M A;  1XFS A;  2R55 A;  3NI8 A;  3PU2 A;  3NQN A;  3KDJ A;  3GTS A;  4A8U A;  5JNN A;  3NJ1 A;  3NMN A;  3NR4 A;  4LGA A;  3GL0 A;  3GL2 A;  4A8G A;  2QIM A;  3OTL A;  3NS2 A;  1EM2 A;  3H3R A;  3Q6A A;  4DSC A;  3P9V A;  2M47 A;  4IGW A;  4JHH A;  4BK6 A;  4IGY A;  3K90 A;  1H2O A;  3C0V A;  2EJX A;  4QDC A;  4XRT A;  3W9K A;  4NCB A;  4QIP A;  1XDF A;  2RES A;  1JSS A;  1LN3 A;  3TVQ A;  3CNW A;  3UID A;  4A80 A;  3F73 A;  3JRQ B;  3UQH A;  3NJ0 A;  2Z9Z A;  4LG5 A;  3NEF A;  4MNS A;  3GTE A;  1BV1 A;  2E3Q A;  2FLH A;  2NN5 A;  3NMT A;  4NCA A;  1QMR A;  4BKD A;  4Q0K A;  1LLT A;  2KEW A;  4BKC A;  3TFZ A;  2KF2 A;  3RD6 A;  3KAY A;  2PCS A;  4R7K A;  2K5G A;  2I9Y A;  4A8V A;  2GKD A;  2KCZ A;  4MA6 A;  2LAF A;  4OIC A;  5JO2 A;  3ZVU A;  4WVO A;  3RT0 C;  5BRL A;  3H3Q A;  3E85 A;  3OQU A;  3K3K A;  4A85 A;  3NMH A;  4N0G C;  3H3T A;  3PUT A;  4JHY A;  4REH A;  2E3N A;  4GY9 A;  1KCM A;  4IH2 A;  1XN5 A;  3P0L A;  1BTV A;  4DS8 A;  3NMP A;  4A84 A;  2M89 A;  1VJH A;  3IE5 A;  5I9J A;  4C94 A;  3HVR A;  3TGO C;  3TVR A;  3R6P A;  4REJ A;  4BK7 A;  3HK2 A;  2REZ A;  2Z9Y A;  3Q63 A;  2E3R A;  2L65 A;  2LUZ A;  4JHG A;  2LIO A;  2E3P A;  2VQ5 A;  3KL1 A;  1XN6 A;  4LA7 A;  2BK0 A;  1FM4 A;  3QSZ A;  5E4D A;  1ICX A;  3ELI A;  3GB4 A;  4N47 A;  3KDH A;  4B9R A;  2KTE A;  4M9B A;  2E3S A;  1TW0 A;  4PSB A;  2NS9 A;  4Y31 A;  3DLH A;  4FPW A;  2A1L A;  2LGH A;  4JDL A;  2ZYL A;  4JHI A;  2K7H A;  4IGV A;  4C9I A;  5I8F A;  5JO1 A;  3KDI A;  4REI A;  3P51 A;  4QDF A;  4M9W A;  1B6F A;  2VNE A;  3KB0 A;  2E3O A;  4XRW A;  4A81 A;  1LN2 A;  1E09 A;  2LE1 A;  1X53 A;  4QDF B;  4Z3L A;  1LN1 A;  4QDD A;  3WG8 A;  2LEQ A;  4DSB A;  2LF2 A;  4QCK A;  3OJI A;  2PSO A;  2RER A;  3NJO A;  4N3E A;  3RT2 A;  3H3S A;  3HXM A;  4MAP A;  2LAK A;  4A87 A;  2QPV A;  4N76 A;  4N41 A;  1XUV A;  2YH6 A;  3UJL A;  1ZXF A;  2N4A A;  4IH0 A;  3HJF A;  3GGN A;  2D4R A;  4JDA A;  1FSK A;  1T17 A;  2FFS A;  4RYV A;  4A86 A;  3NEG A;  3DLB A;  5EKQ C;  3TL1 A;  2LCG A;  4IHR A;  3GKE A;  5AMW A;  3QN1 A;  4LGB A;  3FO5 A;  3F08 A;  3HM9 A;  2MOU A;  3IJT A;  1T27 A;  5E4B A;  3HO1 A;  2L8O A;  1UW5 A;  2Q3Q A;  4BTZ A;  3KAZ A;  2LDK A;  5C9Y A;  3KLX A;  5E46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...