1XFSA

X-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
165
structure length
154
Chain Sequence
IDAELDLMLKRELAVPVNLVWRGLTEPELLKKWFVPKPWSISDCRVDLRPGGEFYTVMQDPEGNKFPNSGCFLEVTDEKRLIWTSALVKNYRPAVPVMTAVIELQPTSSGTRYTACAMHNTPGQRKLHEEMGFHEGWGTTITQLEELLKQEKAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of the hypothetical Protein from Nitrosomonas europaea, NESG Target NeR5
rcsb
source organism Nitrosomonas europaea
molecule tags Structural genomics, unknown function
total genus 38
structure length 154
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1xfsA00
3KDJA 2RESA 4BK7A 4B9RA 3Q6AA 1LN3A 1TW0A 1QMRA 3RT0C 5I8FA 3UQHA 4QIPA 4MAPA 3K90A 2LPXA 4DSCA 1X53A 2L8OA 3OH8A 3WG8A 4RYVA 3IJTA 1T27A 2LEQA 3P9VA 3PU2A 4R7KA 3W9KA 2N4AA 2FLHA 1XDFA 3NEGA 3W9RA 1BTVA 1LN1A 3NJ1A 2LAKA 1VJHA 2EJXA 4PSBA 2REZA 3KDHA 4BK6A 2KEWA 2E3OA 4OICA 5BRLA 2D4RA 3KB0A 3NMPA 3NJ0A 3TFZA 4A85A 1KCMA 1JSSA 4A88A 4A87A 3K3KA 3P51A 4BTZA 2KF2A 2QPVA 4JHHA 3KLXA 2E3RA 3H3SA 2E3NA 2LUZA 2Z9YA 4Z3LA 1TXCA 5JNNA 2PCSA 1ICXA 2WQLA 2M47A 4LGBA 4A84A 2PSOA 3Q63A 2N4BA 3KL1A 4REJA 2KCZA 2GKDA 2L9PA 2LIOA 2I9YA 2K5GA 4JDLA 3UIDA 3P0LA 2IL5A 3NEFA 4A80A 2R55A 3F08A 1BV1A 3NR4A 4IGWA 5E4DA 1ZXFA 4N3EA 5AMWA 1LLTA 3TVQA 5JO1A 3RT2A 1FSKA 4Q0KA 2LF2A 4BKDA 3H3QA 4JHIA 1E09A 2MOUA 1UW5A 5JO2A 2E3QA 3R6PA 1XN5A 4MNSA 4A8VA 1EM2A 4C9IA 3KDIA 4LGAA 3NI8A 3FO5A 4XRTA 2Q3QA 3E85A 5C9YA 3PUTA 4C94A 3KB3A 2BK0A 4IH0A 1H2OA 2E3MA 2LE1A 3CNWA 4IGYA 3H3RA 4DSBA 1XN6A 2FFSA 4FPWA 3OJIA 1XFSA 3NMHA 3JRQB 4GY9A 4IHRA 1T17A 3ZVUA 4A86A 3ELIA 1Z94A 5E4BA 4Y31A 5I9JA 3C0VA 4MA6A 3UJLA 5E46A 4IH2A 1B6FA 1LN2A 3NMTA 3OQUA 4XRWA 2L65A 1FM4A 3IE5A 3TVRA 2LGHA 2RERA 4WVOA 2KTEA 4BKCA 2Z9ZA 3NS2A 4M9WA 2E3PA 4JDAA 4REHA 4IGVA 4A81A 3NJOA 2A1LA 3QN1A 4A8UA 3RD6A 4JHGA 2VQ5A 4IGXA 3TL1A 2LDKA 2M89A 4DS8A 4REIA 3GGNA 3H3TA 2NN5A 2QIMA 4A83A 3JRSA 3NMVA 4LG5A 4C9CA 2LCGA 4A8GA 1IFVA 1XUVA 3KAZA 4M9BA 4N0GC 3KAYA 3NMNA 3QSZA 4LA7A 3OTLA 5E4MA 2K7HA 2E3SA 2NS9A 2VNEA 3Q64A
chains in the Genus database with same CATH superfamily
3KDJA 2RESA 4BK7A 4B9RA 3Q6AA 4KPYA 1LN3A 1TW0A 1QMRA 3RT0C 5I8FA 3UQHA 4QIPA 4MAPA 3K90A 2LPXA 4DSCA 3GOBA 1X53A 4QCKA 4JHYA 3GL2A 2L8OA 3OH8A 3WG8A 4RYVA 3IJTA 1T27A 2LEQA 3GTEA 3P9VA 3PU2A 4R7KA 3W9KA 2N4AA 2FLHA 1XDFA 3NEGA 3W9RA 1BTVA 1LN1A 3NJ1A 2LAKA 1VJHA 2EJXA 3GL0A 4PSBA 2REZA 3KDHA 4BK6A 2YH6A 2KEWA 2E3OA 4OICA 5BRLA 2D4RA 3KB0A 3NMPA 3NJ0A 3TFZA 4A85A 1KCMA 1JSSA 3GKEA 3GTSA 4A88A 4N76A 4A87A 3K3KA 3P51A 4BTZA 2KF2A 2QPVA 4JHHA 3KLXA 4NCAA 2E3RA 3H3SA 4QDCA 2E3NA 2LUZA 2Z9YA 4Z3LA 1TXCA 5JNNA 3HJFA 4QDDA 2PCSA 1ICXA 2WQLA 2M47A 4LGBA 4A84A 2PSOA 3Q63A 3TGOC 2N4BA 3KL1A 4REJA 2KCZA 2GKDA 2L9PA 2LIOA 2I9YA 2K5GA 4JDLA 3UIDA 3P0LA 2IL5A 3NEFA 4A80A 2R55A 3F08A 1BV1A 3NR4A 4IGWA 5E4DA 1ZXFA 4N3EA 5AMWA 1LLTA 3TVQA 4N47A 5EKQC 5JO1A 3RT2A 1FSKA 4Q0KA 2LF2A 4BKDA 3H3QA 4JHIA 1E09A 3DLBA 2MOUA 1UW5A 5JO2A 2E3QA 3R6PA 1XN5A 4MNSA 3NQNA 4A8VA 1EM2A 4C9IA 3KDIA 4LGAA 3NI8A 3FO5A 4XRTA 2Q3QA 3E85A 5C9YA 3PUTA 4C94A 3KB3A 2BK0A 3GB4A 3HVRA 4IH0A 1H2OA 2E3MA 2LE1A 3CNWA 4IGYA 3H3RA 4DSBA 3F73A 4N41A 1XN6A 2FFSA 4FPWA 3OJIA 1XFSA 3NMHA 3JRQB 4GY9A 4IHRA 1T17A 4QDFA 3ZVUA 4A86A 3HK2A 3ELIA 1Z94A 5E4BA 4Y31A 5I9JA 3C0VA 4MA6A 3UJLA 5E46A 4IH2A 1B6FA 1LN2A 3NMTA 3OQUA 4XRWA 2L65A 1FM4A 3IE5A 4QDFB 3TVRA 2LGHA 2RERA 4WVOA 2KTEA 4BKCA 2Z9ZA 3NS2A 4M9WA 2E3PA 3HXMA 2ZYLA 3DLHA 4JDAA 4REHA 4IGVA 4A81A 3NJOA 2A1LA 3QN1A 4A8UA 3RD6A 4JHGA 4NCBA 3HO1A 2VQ5A 4IGXA 3TL1A 2LDKA 2M89A 4DS8A 4E6FA 4REIA 3GGNA 3H3TA 2NN5A 2QIMA 4A83A 3HM9A 3JRSA 3NMVA 4LG5A 4C9CA 2LCGA 4A8GA 1IFVA 1XUVA 3KAZA 4M9BA 4N0GC 3KAYA 3NMNA 3QSZA 4LA7A 3OTLA 5E4MA 2LAFA 2K7HA 2E3SA 2NS9A 2VNEA 3Q64A
chains in the Genus database with same CATH topology
3KDJA 2RESA 4BK7A 4B9RA 3Q6AA 4KPYA 1LN3A 1TW0A 1QMRA 3RT0C 5I8FA 3UQHA 4QIPA 4MAPA 3K90A 2LPXA 4DSCA 3GOBA 1X53A 4QCKA 4JHYA 3GL2A 2L8OA 3OH8A 3WG8A 4RYVA 3IJTA 1T27A 2LEQA 3GTEA 3P9VA 3PU2A 4R7KA 3W9KA 2N4AA 2FLHA 1XDFA 3NEGA 3W9RA 1BTVA 1LN1A 3NJ1A 2LAKA 1VJHA 2EJXA 3GL0A 4PSBA 2REZA 3KDHA 4BK6A 2YH6A 2KEWA 2E3OA 4OICA 5BRLA 2D4RA 3KB0A 3NMPA 3NJ0A 3TFZA 4A85A 1KCMA 1JSSA 3GKEA 3GTSA 4A88A 4N76A 4A87A 3K3KA 3P51A 4BTZA 2KF2A 2QPVA 4JHHA 3KLXA 4NCAA 2E3RA 3H3SA 4QDCA 2E3NA 2LUZA 2Z9YA 4Z3LA 1TXCA 5JNNA 3HJFA 4QDDA 2PCSA 1ICXA 2WQLA 2M47A 4LGBA 4A84A 2PSOA 3Q63A 3TGOC 2N4BA 3KL1A 4REJA 2KCZA 2GKDA 2L9PA 2LIOA 2I9YA 2K5GA 4JDLA 3UIDA 3P0LA 2IL5A 3NEFA 4A80A 2R55A 3F08A 1BV1A 3NR4A 4IGWA 5E4DA 1ZXFA 4N3EA 5AMWA 1LLTA 3TVQA 4N47A 5EKQC 5JO1A 3RT2A 1FSKA 4Q0KA 2LF2A 4BKDA 3H3QA 4JHIA 1E09A 3DLBA 2MOUA 1UW5A 5JO2A 2E3QA 3R6PA 1XN5A 4MNSA 3NQNA 4A8VA 1EM2A 4C9IA 3KDIA 4LGAA 3NI8A 3FO5A 4XRTA 2Q3QA 3E85A 5C9YA 3PUTA 4C94A 3KB3A 2BK0A 3GB4A 3HVRA 4IH0A 1H2OA 2E3MA 2LE1A 3CNWA 4IGYA 3H3RA 4DSBA 3F73A 4N41A 1XN6A 2FFSA 4FPWA 3OJIA 1XFSA 3NMHA 3JRQB 4GY9A 4IHRA 1T17A 4QDFA 3ZVUA 4A86A 3HK2A 3ELIA 1Z94A 5E4BA 4Y31A 5I9JA 3C0VA 4MA6A 3UJLA 5E46A 4IH2A 1B6FA 1LN2A 3NMTA 3OQUA 4XRWA 2L65A 1FM4A 3IE5A 4QDFB 3TVRA 2LGHA 2RERA 4WVOA 2KTEA 4BKCA 2Z9ZA 3NS2A 4M9WA 2E3PA 3HXMA 2ZYLA 3DLHA 4JDAA 4REHA 4IGVA 4A81A 3NJOA 2A1LA 3QN1A 4A8UA 3RD6A 4JHGA 4NCBA 3HO1A 2VQ5A 4IGXA 3TL1A 2LDKA 2M89A 4DS8A 4E6FA 4REIA 3GGNA 3H3TA 2NN5A 2QIMA 4A83A 3HM9A 3JRSA 3NMVA 4LG5A 4C9CA 2LCGA 4A8GA 1IFVA 1XUVA 3KAZA 4M9BA 4N0GC 3KAYA 3NMNA 3QSZA 4LA7A 3OTLA 5E4MA 2LAFA 2K7HA 2E3SA 2NS9A 2VNEA 3Q64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDJ A;  2RES A;  4BK7 A;  4B9R A;  3Q6A A;  1LN3 A;  1TW0 A;  1QMR A;  3RT0 C;  5I8F A;  3UQH A;  4QIP A;  4MAP A;  3K90 A;  2LPX A;  4DSC A;  1X53 A;  2L8O A;  3OH8 A;  3WG8 A;  4RYV A;  3IJT A;  1T27 A;  2LEQ A;  3P9V A;  3PU2 A;  4R7K A;  3W9K A;  2N4A A;  2FLH A;  1XDF A;  3NEG A;  3W9R A;  1BTV A;  1LN1 A;  3NJ1 A;  2LAK A;  1VJH A;  2EJX A;  4PSB A;  2REZ A;  3KDH A;  4BK6 A;  2KEW A;  2E3O A;  4OIC A;  5BRL A;  2D4R A;  3KB0 A;  3NMP A;  3NJ0 A;  3TFZ A;  4A85 A;  1KCM A;  1JSS A;  4A88 A;  4A87 A;  3K3K A;  3P51 A;  4BTZ A;  2KF2 A;  2QPV A;  4JHH A;  3KLX A;  2E3R A;  3H3S A;  2E3N A;  2LUZ A;  2Z9Y A;  4Z3L A;  1TXC A;  5JNN A;  2PCS A;  1ICX A;  2WQL A;  2M47 A;  4LGB A;  4A84 A;  2PSO A;  3Q63 A;  2N4B A;  3KL1 A;  4REJ A;  2KCZ A;  2GKD A;  2L9P A;  2LIO A;  2I9Y A;  2K5G A;  4JDL A;  3UID A;  3P0L A;  2IL5 A;  3NEF A;  4A80 A;  2R55 A;  3F08 A;  1BV1 A;  3NR4 A;  4IGW A;  5E4D A;  1ZXF A;  4N3E A;  5AMW A;  1LLT A;  3TVQ A;  5JO1 A;  3RT2 A;  1FSK A;  4Q0K A;  2LF2 A;  4BKD A;  3H3Q A;  4JHI A;  1E09 A;  2MOU A;  1UW5 A;  5JO2 A;  2E3Q A;  3R6P A;  1XN5 A;  4MNS A;  4A8V A;  1EM2 A;  4C9I A;  3KDI A;  4LGA A;  3NI8 A;  3FO5 A;  4XRT A;  2Q3Q A;  3E85 A;  5C9Y A;  3PUT A;  4C94 A;  3KB3 A;  2BK0 A;  4IH0 A;  1H2O A;  2E3M A;  2LE1 A;  3CNW A;  4IGY A;  3H3R A;  4DSB A;  1XN6 A;  2FFS A;  4FPW A;  3OJI A;  1XFS A;  3NMH A;  3JRQ B;  4GY9 A;  4IHR A;  1T17 A;  3ZVU A;  4A86 A;  3ELI A;  1Z94 A;  5E4B A;  4Y31 A;  5I9J A;  3C0V A;  4MA6 A;  3UJL A;  5E46 A;  4IH2 A;  1B6F A;  1LN2 A;  3NMT A;  3OQU A;  4XRW A;  2L65 A;  1FM4 A;  3IE5 A;  3TVR A;  2LGH A;  2RER A;  4WVO A;  2KTE A;  4BKC A;  2Z9Z A;  3NS2 A;  4M9W A;  2E3P A;  4JDA A;  4REH A;  4IGV A;  4A81 A;  3NJO A;  2A1L A;  3QN1 A;  4A8U A;  3RD6 A;  4JHG A;  2VQ5 A;  4IGX A;  3TL1 A;  2LDK A;  2M89 A;  4DS8 A;  4REI A;  3GGN A;  3H3T A;  2NN5 A;  2QIM A;  4A83 A;  3JRS A;  3NMV A;  4LG5 A;  4C9C A;  2LCG A;  4A8G A;  1IFV A;  1XUV A;  3KAZ A;  4M9B A;  4N0G C;  3KAY A;  3NMN A;  3QSZ A;  4LA7 A;  3OTL A;  5E4M A;  2K7H A;  2E3S A;  2NS9 A;  2VNE A;  3Q64 A; 
#chains in the Genus database with same CATH topology
 3KDJ A;  2RES A;  4BK7 A;  4B9R A;  3Q6A A;  4KPY A;  1LN3 A;  1TW0 A;  1QMR A;  3RT0 C;  5I8F A;  3UQH A;  4QIP A;  4MAP A;  3K90 A;  2LPX A;  4DSC A;  3GOB A;  1X53 A;  4QCK A;  4JHY A;  3GL2 A;  2L8O A;  3OH8 A;  3WG8 A;  4RYV A;  3IJT A;  1T27 A;  2LEQ A;  3GTE A;  3P9V A;  3PU2 A;  4R7K A;  3W9K A;  2N4A A;  2FLH A;  1XDF A;  3NEG A;  3W9R A;  1BTV A;  1LN1 A;  3NJ1 A;  2LAK A;  1VJH A;  2EJX A;  3GL0 A;  4PSB A;  2REZ A;  3KDH A;  4BK6 A;  2YH6 A;  2KEW A;  2E3O A;  4OIC A;  5BRL A;  2D4R A;  3KB0 A;  3NMP A;  3NJ0 A;  3TFZ A;  4A85 A;  1KCM A;  1JSS A;  3GKE A;  3GTS A;  4A88 A;  4N76 A;  4A87 A;  3K3K A;  3P51 A;  4BTZ A;  2KF2 A;  2QPV A;  4JHH A;  3KLX A;  4NCA A;  2E3R A;  3H3S A;  4QDC A;  2E3N A;  2LUZ A;  2Z9Y A;  4Z3L A;  1TXC A;  5JNN A;  3HJF A;  4QDD A;  2PCS A;  1ICX A;  2WQL A;  2M47 A;  4LGB A;  4A84 A;  2PSO A;  3Q63 A;  3TGO C;  2N4B A;  3KL1 A;  4REJ A;  2KCZ A;  2GKD A;  2L9P A;  2LIO A;  2I9Y A;  2K5G A;  4JDL A;  3UID A;  3P0L A;  2IL5 A;  3NEF A;  4A80 A;  2R55 A;  3F08 A;  1BV1 A;  3NR4 A;  4IGW A;  5E4D A;  1ZXF A;  4N3E A;  5AMW A;  1LLT A;  3TVQ A;  4N47 A;  5EKQ C;  5JO1 A;  3RT2 A;  1FSK A;  4Q0K A;  2LF2 A;  4BKD A;  3H3Q A;  4JHI A;  1E09 A;  3DLB A;  2MOU A;  1UW5 A;  5JO2 A;  2E3Q A;  3R6P A;  1XN5 A;  4MNS A;  3NQN A;  4A8V A;  1EM2 A;  4C9I A;  3KDI A;  4LGA A;  3NI8 A;  3FO5 A;  4XRT A;  2Q3Q A;  3E85 A;  5C9Y A;  3PUT A;  4C94 A;  3KB3 A;  2BK0 A;  3GB4 A;  3HVR A;  4IH0 A;  1H2O A;  2E3M A;  2LE1 A;  3CNW A;  4IGY A;  3H3R A;  4DSB A;  3F73 A;  4N41 A;  1XN6 A;  2FFS A;  4FPW A;  3OJI A;  1XFS A;  3NMH A;  3JRQ B;  4GY9 A;  4IHR A;  1T17 A;  4QDF A;  3ZVU A;  4A86 A;  3HK2 A;  3ELI A;  1Z94 A;  5E4B A;  4Y31 A;  5I9J A;  3C0V A;  4MA6 A;  3UJL A;  5E46 A;  4IH2 A;  1B6F A;  1LN2 A;  3NMT A;  3OQU A;  4XRW A;  2L65 A;  1FM4 A;  3IE5 A;  4QDF B;  3TVR A;  2LGH A;  2RER A;  4WVO A;  2KTE A;  4BKC A;  2Z9Z A;  3NS2 A;  4M9W A;  2E3P A;  3HXM A;  2ZYL A;  3DLH A;  4JDA A;  4REH A;  4IGV A;  4A81 A;  3NJO A;  2A1L A;  3QN1 A;  4A8U A;  3RD6 A;  4JHG A;  4NCB A;  3HO1 A;  2VQ5 A;  4IGX A;  3TL1 A;  2LDK A;  2M89 A;  4DS8 A;  4E6F A;  4REI A;  3GGN A;  3H3T A;  2NN5 A;  2QIM A;  4A83 A;  3HM9 A;  3JRS A;  3NMV A;  4LG5 A;  4C9C A;  2LCG A;  4A8G A;  1IFV A;  1XUV A;  3KAZ A;  4M9B A;  4N0G C;  3KAY A;  3NMN A;  3QSZ A;  4LA7 A;  3OTL A;  5E4M A;  2LAF A;  2K7H A;  2E3S A;  2NS9 A;  2VNE A;  3Q64 A; 
#chains in the Genus database with same CATH homology
 3KDJ A;  2RES A;  4BK7 A;  4B9R A;  3Q6A A;  4KPY A;  1LN3 A;  1TW0 A;  1QMR A;  3RT0 C;  5I8F A;  3UQH A;  4QIP A;  4MAP A;  3K90 A;  2LPX A;  4DSC A;  3GOB A;  1X53 A;  4QCK A;  4JHY A;  3GL2 A;  2L8O A;  3OH8 A;  3WG8 A;  4RYV A;  3IJT A;  1T27 A;  2LEQ A;  3GTE A;  3P9V A;  3PU2 A;  4R7K A;  3W9K A;  2N4A A;  2FLH A;  1XDF A;  3NEG A;  3W9R A;  1BTV A;  1LN1 A;  3NJ1 A;  2LAK A;  1VJH A;  2EJX A;  3GL0 A;  4PSB A;  2REZ A;  3KDH A;  4BK6 A;  2YH6 A;  2KEW A;  2E3O A;  4OIC A;  5BRL A;  2D4R A;  3KB0 A;  3NMP A;  3NJ0 A;  3TFZ A;  4A85 A;  1KCM A;  1JSS A;  3GKE A;  3GTS A;  4A88 A;  4N76 A;  4A87 A;  3K3K A;  3P51 A;  4BTZ A;  2KF2 A;  2QPV A;  4JHH A;  3KLX A;  4NCA A;  2E3R A;  3H3S A;  4QDC A;  2E3N A;  2LUZ A;  2Z9Y A;  4Z3L A;  1TXC A;  5JNN A;  3HJF A;  4QDD A;  2PCS A;  1ICX A;  2WQL A;  2M47 A;  4LGB A;  4A84 A;  2PSO A;  3Q63 A;  3TGO C;  2N4B A;  3KL1 A;  4REJ A;  2KCZ A;  2GKD A;  2L9P A;  2LIO A;  2I9Y A;  2K5G A;  4JDL A;  3UID A;  3P0L A;  2IL5 A;  3NEF A;  4A80 A;  2R55 A;  3F08 A;  1BV1 A;  3NR4 A;  4IGW A;  5E4D A;  1ZXF A;  4N3E A;  5AMW A;  1LLT A;  3TVQ A;  4N47 A;  5EKQ C;  5JO1 A;  3RT2 A;  1FSK A;  4Q0K A;  2LF2 A;  4BKD A;  3H3Q A;  4JHI A;  1E09 A;  3DLB A;  2MOU A;  1UW5 A;  5JO2 A;  2E3Q A;  3R6P A;  1XN5 A;  4MNS A;  3NQN A;  4A8V A;  1EM2 A;  4C9I A;  3KDI A;  4LGA A;  3NI8 A;  3FO5 A;  4XRT A;  2Q3Q A;  3E85 A;  5C9Y A;  3PUT A;  4C94 A;  3KB3 A;  2BK0 A;  3GB4 A;  3HVR A;  4IH0 A;  1H2O A;  2E3M A;  2LE1 A;  3CNW A;  4IGY A;  3H3R A;  4DSB A;  3F73 A;  4N41 A;  1XN6 A;  2FFS A;  4FPW A;  3OJI A;  1XFS A;  3NMH A;  3JRQ B;  4GY9 A;  4IHR A;  1T17 A;  4QDF A;  3ZVU A;  4A86 A;  3HK2 A;  3ELI A;  1Z94 A;  5E4B A;  4Y31 A;  5I9J A;  3C0V A;  4MA6 A;  3UJL A;  5E46 A;  4IH2 A;  1B6F A;  1LN2 A;  3NMT A;  3OQU A;  4XRW A;  2L65 A;  1FM4 A;  3IE5 A;  4QDF B;  3TVR A;  2LGH A;  2RER A;  4WVO A;  2KTE A;  4BKC A;  2Z9Z A;  3NS2 A;  4M9W A;  2E3P A;  3HXM A;  2ZYL A;  3DLH A;  4JDA A;  4REH A;  4IGV A;  4A81 A;  3NJO A;  2A1L A;  3QN1 A;  4A8U A;  3RD6 A;  4JHG A;  4NCB A;  3HO1 A;  2VQ5 A;  4IGX A;  3TL1 A;  2LDK A;  2M89 A;  4DS8 A;  4E6F A;  4REI A;  3GGN A;  3H3T A;  2NN5 A;  2QIM A;  4A83 A;  3HM9 A;  3JRS A;  3NMV A;  4LG5 A;  4C9C A;  2LCG A;  4A8G A;  1IFV A;  1XUV A;  3KAZ A;  4M9B A;  4N0G C;  3KAY A;  3NMN A;  3QSZ A;  4LA7 A;  3OTL A;  5E4M A;  2LAF A;  2K7H A;  2E3S A;  2NS9 A;  2VNE A;  3Q64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...