1X53A

The solution structure of the c-terminal domain of human activator of 90 kda heat shock protein atpase homolog 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
145
Chain Sequence
GSSGSSGIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator of 90 kDa heat shock protein ATPase homolog 1
publication title The solution structure of the C-terminal domain of human Activator of 90 kDa heat shock protein ATPase homolog 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1x53A01
2E3SA 4XRTA 2M89A 4A8UA 3CNWA 4GY9A 3K3KA 4B9RA 3NMHA 1BTVA 1TXCA 2KCZA 2LIOA 2NS9A 3NS2A 4A85A 1E09A 2FFSA 3FO5A 2K7HA 3QSZA 4JHIA 2N4BA 4Y31A 5I8FA 4JHHA 2LEQA 2LCGA 1XN5A 4XRWA 3KB3A 3NJOA 3Q6AA 2LE1A 3KDJA 3RT0C 4N3EA 4M9WA 1XUVA 4C9IA 2K5GA 2RESA 4IGYA 4A86A 2LGHA 1XFSA 2NN5A 3UJLA 2E3PA 4IGXA 3NMVA 2A1LA 1XN6A 2LF2A 3K90A 3NMTA 4MAPA 4Q0KA 3TFZA 3OTLA 4JHGA 3PU2A 4M9BA 1LN1A 2N4AA 2WQLA 4PSBA 3P51A 2KF2A 3KDIA 3NR4A 5BRLA 2PSOA 1T27A 4LA7A 4BKCA 4BK7A 1X53A 2L65A 2LUZA 1B6FA 3OQUA 5AMWA 1UW5A 5E4BA 2L9PA 3IJTA 3OJIA 1LN3A 1ICXA 2E3MA 5E4MA 3OH8A 1H2OA 3KAYA 2E3OA 2Z9ZA 2I9YA 4A84A 2RERA 3H3RA 3KDHA 3KLXA 3NMPA 4LGBA 3NEFA 4DSCA 5JO1A 2L8OA 2KTEA 1LLTA 2MOUA 4JDAA 2BK0A 3H3SA 4MNSA 1KCMA 5C9YA 2M47A 2PCSA 4A88A 4IH2A 3TVQA 3W9RA 4LGAA 1IFVA 2KEWA 4A83A 3IE5A 2GKDA 3QN1A 4DS8A 3C0VA 1FSKA 2R55A 4FPWA 1TW0A 2LDKA 3R6PA 4N0GC 1T17A 3P9VA 2LPXA 4R7KA 1Z94A 4C94A 4MA6A 4REIA 4A87A 2QIMA 1JSSA 4IH0A 5E46A 3E85A 4RYVA 1FM4A 2VNEA 4REJA 3JRQB 3RT2A 2VQ5A 2Z9YA 3NJ0A 4REHA 4JDLA 2E3QA 5JNNA 3JRSA 2IL5A 3NMNA 3WG8A 5JO2A 3NJ1A 1XDFA 4A80A 3NEGA 4IGWA 4IHRA 3NI8A 4BKDA 3ELIA 3W9KA 3H3TA 4A81A 4OICA 1QMRA 1VJHA 2FLHA 3Q64A 3ZVUA 2LAKA 1LN2A 3RD6A 4A8VA 3UQHA 3H3QA 2EJXA 4A8GA 4Z3LA 2QPVA 5E4DA 1BV1A 4DSBA 3PUTA 4LG5A 3TVRA 3KB0A 3KAZA 2REZA 5I9JA 4IGVA 3KL1A 3Q63A 1ZXFA 3TL1A 3UIDA 4C9CA 2E3NA 2E3RA 3GGNA 1EM2A 4BTZA 4QIPA 4BK6A 3P0LA 4WVOA 2D4RA 2Q3QA 3F08A
chains in the Genus database with same CATH superfamily
2E3SA 4XRTA 2M89A 4A8UA 3CNWA 4GY9A 3K3KA 4B9RA 4QDFA 3NMHA 1BTVA 1TXCA 2KCZA 2LIOA 2NS9A 3NS2A 4A85A 2D4RA 1E09A 2FFSA 3FO5A 2K7HA 3QSZA 4JHIA 2N4BA 2YH6A 4N47A 4Y31A 4KPYA 5I8FA 4JHHA 2LEQA 2LCGA 1XN5A 4XRWA 3KB3A 3NJOA 3Q6AA 2LE1A 3KDJA 3GL2A 4N3EA 4M9WA 1XUVA 3RT0C 4C9IA 4N76A 2K5GA 2RESA 4IGYA 4A86A 2LGHA 1XFSA 2NN5A 3UJLA 3DLHA 2E3PA 4IGXA 5EKQC 3NMVA 2A1LA 1XN6A 2LF2A 3K90A 3NMTA 4MAPA 4Q0KA 3TFZA 3OTLA 3HK2A 4JHGA 3PU2A 4M9BA 1LN1A 2N4AA 2WQLA 4PSBA 3P51A 2KF2A 3KDIA 3NR4A 5BRLA 2PSOA 1T27A 4LA7A 4BKCA 4NCAA 4BK7A 1X53A 2L65A 2LUZA 1B6FA 3OQUA 5AMWA 1UW5A 5E4BA 2L9PA 3IJTA 3OJIA 1LN3A 1ICXA 2E3MA 5E4MA 3OH8A 1H2OA 3KAYA 2E3OA 2Z9ZA 2I9YA 4A84A 2RERA 3H3RA 3KDHA 3KLXA 3NMPA 4LGBA 3NEFA 4QDFB 4DSCA 5JO1A 2L8OA 2KTEA 1LLTA 2MOUA 4JDAA 2BK0A 3H3SA 3GOBA 4MNSA 1KCMA 5C9YA 3DLBA 2M47A 3GTEA 2PCSA 4A88A 4IH2A 3TVQA 3W9RA 4LGAA 1IFVA 2KEWA 4A83A 3IE5A 4JHYA 2GKDA 3QN1A 4DS8A 3C0VA 1FSKA 2R55A 4FPWA 1TW0A 2LDKA 3R6PA 4N0GC 3F73A 3GTSA 1T17A 3P9VA 2LPXA 3HJFA 4QCKA 1Z94A 4R7KA 4C94A 4MA6A 4REIA 4A87A 2QIMA 1JSSA 3GL0A 4IH0A 3E85A 5E46A 4RYVA 1FM4A 2VNEA 4REJA 3JRQB 3GB4A 3RT2A 3HXMA 2VQ5A 2Z9YA 3NJ0A 4REHA 4JDLA 2E3QA 5JNNA 3JRSA 2IL5A 3NMNA 3WG8A 4N41A 5JO2A 3NJ1A 1XDFA 4A80A 3NEGA 4IGWA 4IHRA 3NI8A 4BKDA 3ELIA 3W9KA 3H3TA 4A81A 4OICA 1QMRA 1VJHA 2FLHA 3TGOC 3NQNA 4NCBA 3Q64A 3ZVUA 2LAKA 1LN2A 3RD6A 4A8VA 3UQHA 3H3QA 2EJXA 4A8GA 4Z3LA 2QPVA 3GKEA 4E6FA 3HM9A 3HO1A 5E4DA 1BV1A 4DSBA 4QDDA 3PUTA 4LG5A 3HVRA 3TVRA 3KB0A 3KAZA 2REZA 5I9JA 4IGVA 3KL1A 3Q63A 1ZXFA 2ZYLA 4QDCA 3TL1A 3UIDA 4C9CA 2E3NA 2E3RA 3GGNA 1EM2A 4BTZA 4QIPA 4BK6A 3P0LA 4WVOA 2LAFA 2Q3QA 3F08A
chains in the Genus database with same CATH topology
2E3SA 4XRTA 2M89A 4A8UA 3CNWA 4GY9A 3K3KA 4B9RA 4QDFA 3NMHA 1BTVA 1TXCA 2KCZA 2LIOA 2NS9A 3NS2A 4A85A 2D4RA 1E09A 2FFSA 3FO5A 2K7HA 3QSZA 4JHIA 2N4BA 2YH6A 4N47A 4Y31A 4KPYA 5I8FA 4JHHA 2LEQA 2LCGA 1XN5A 4XRWA 3KB3A 3NJOA 3Q6AA 2LE1A 3KDJA 3GL2A 4N3EA 4M9WA 1XUVA 3RT0C 4C9IA 4N76A 2K5GA 2RESA 4IGYA 4A86A 2LGHA 1XFSA 2NN5A 3UJLA 3DLHA 2E3PA 4IGXA 5EKQC 3NMVA 2A1LA 1XN6A 2LF2A 3K90A 3NMTA 4MAPA 4Q0KA 3TFZA 3OTLA 3HK2A 4JHGA 3PU2A 4M9BA 1LN1A 2N4AA 2WQLA 4PSBA 3P51A 2KF2A 3KDIA 3NR4A 5BRLA 2PSOA 1T27A 4LA7A 4BKCA 4NCAA 4BK7A 1X53A 2L65A 2LUZA 1B6FA 3OQUA 5AMWA 1UW5A 5E4BA 2L9PA 3IJTA 3OJIA 1LN3A 1ICXA 2E3MA 5E4MA 3OH8A 1H2OA 3KAYA 2E3OA 2Z9ZA 2I9YA 4A84A 2RERA 3H3RA 3KDHA 3KLXA 3NMPA 4LGBA 3NEFA 4QDFB 4DSCA 5JO1A 2L8OA 2KTEA 1LLTA 2MOUA 4JDAA 2BK0A 3H3SA 3GOBA 4MNSA 1KCMA 5C9YA 3DLBA 2M47A 3GTEA 2PCSA 4A88A 4IH2A 3TVQA 3W9RA 4LGAA 1IFVA 2KEWA 4A83A 3IE5A 4JHYA 2GKDA 3QN1A 4DS8A 3C0VA 1FSKA 2R55A 4FPWA 1TW0A 2LDKA 3R6PA 4N0GC 3F73A 3GTSA 1T17A 3P9VA 2LPXA 3HJFA 4QCKA 1Z94A 4R7KA 4C94A 4MA6A 4REIA 4A87A 2QIMA 1JSSA 3GL0A 4IH0A 3E85A 5E46A 4RYVA 1FM4A 2VNEA 4REJA 3JRQB 3GB4A 3RT2A 3HXMA 2VQ5A 2Z9YA 3NJ0A 4REHA 4JDLA 2E3QA 5JNNA 3JRSA 2IL5A 3NMNA 3WG8A 4N41A 5JO2A 3NJ1A 1XDFA 4A80A 3NEGA 4IGWA 4IHRA 3NI8A 4BKDA 3ELIA 3W9KA 3H3TA 4A81A 4OICA 1QMRA 1VJHA 2FLHA 3TGOC 3NQNA 4NCBA 3Q64A 3ZVUA 2LAKA 1LN2A 3RD6A 4A8VA 3UQHA 3H3QA 2EJXA 4A8GA 4Z3LA 2QPVA 3GKEA 4E6FA 3HM9A 3HO1A 5E4DA 1BV1A 4DSBA 4QDDA 3PUTA 4LG5A 3HVRA 3TVRA 3KB0A 3KAZA 2REZA 5I9JA 4IGVA 3KL1A 3Q63A 1ZXFA 2ZYLA 4QDCA 3TL1A 3UIDA 4C9CA 2E3NA 2E3RA 3GGNA 1EM2A 4BTZA 4QIPA 4BK6A 3P0LA 4WVOA 2LAFA 2Q3QA 3F08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3S A;  4XRT A;  2M89 A;  4A8U A;  3CNW A;  4GY9 A;  3K3K A;  4B9R A;  3NMH A;  1BTV A;  1TXC A;  2KCZ A;  2LIO A;  2NS9 A;  3NS2 A;  4A85 A;  1E09 A;  2FFS A;  3FO5 A;  2K7H A;  3QSZ A;  4JHI A;  2N4B A;  4Y31 A;  5I8F A;  4JHH A;  2LEQ A;  2LCG A;  1XN5 A;  4XRW A;  3KB3 A;  3NJO A;  3Q6A A;  2LE1 A;  3KDJ A;  3RT0 C;  4N3E A;  4M9W A;  1XUV A;  4C9I A;  2K5G A;  2RES A;  4IGY A;  4A86 A;  2LGH A;  1XFS A;  2NN5 A;  3UJL A;  2E3P A;  4IGX A;  3NMV A;  2A1L A;  1XN6 A;  2LF2 A;  3K90 A;  3NMT A;  4MAP A;  4Q0K A;  3TFZ A;  3OTL A;  4JHG A;  3PU2 A;  4M9B A;  1LN1 A;  2N4A A;  2WQL A;  4PSB A;  3P51 A;  2KF2 A;  3KDI A;  3NR4 A;  5BRL A;  2PSO A;  1T27 A;  4LA7 A;  4BKC A;  4BK7 A;  1X53 A;  2L65 A;  2LUZ A;  1B6F A;  3OQU A;  5AMW A;  1UW5 A;  5E4B A;  2L9P A;  3IJT A;  3OJI A;  1LN3 A;  1ICX A;  2E3M A;  5E4M A;  3OH8 A;  1H2O A;  3KAY A;  2E3O A;  2Z9Z A;  2I9Y A;  4A84 A;  2RER A;  3H3R A;  3KDH A;  3KLX A;  3NMP A;  4LGB A;  3NEF A;  4DSC A;  5JO1 A;  2L8O A;  2KTE A;  1LLT A;  2MOU A;  4JDA A;  2BK0 A;  3H3S A;  4MNS A;  1KCM A;  5C9Y A;  2M47 A;  2PCS A;  4A88 A;  4IH2 A;  3TVQ A;  3W9R A;  4LGA A;  1IFV A;  2KEW A;  4A83 A;  3IE5 A;  2GKD A;  3QN1 A;  4DS8 A;  3C0V A;  1FSK A;  2R55 A;  4FPW A;  1TW0 A;  2LDK A;  3R6P A;  4N0G C;  1T17 A;  3P9V A;  2LPX A;  4R7K A;  1Z94 A;  4C94 A;  4MA6 A;  4REI A;  4A87 A;  2QIM A;  1JSS A;  4IH0 A;  5E46 A;  3E85 A;  4RYV A;  1FM4 A;  2VNE A;  4REJ A;  3JRQ B;  3RT2 A;  2VQ5 A;  2Z9Y A;  3NJ0 A;  4REH A;  4JDL A;  2E3Q A;  5JNN A;  3JRS A;  2IL5 A;  3NMN A;  3WG8 A;  5JO2 A;  3NJ1 A;  1XDF A;  4A80 A;  3NEG A;  4IGW A;  4IHR A;  3NI8 A;  4BKD A;  3ELI A;  3W9K A;  3H3T A;  4A81 A;  4OIC A;  1QMR A;  1VJH A;  2FLH A;  3Q64 A;  3ZVU A;  2LAK A;  1LN2 A;  3RD6 A;  4A8V A;  3UQH A;  3H3Q A;  2EJX A;  4A8G A;  4Z3L A;  2QPV A;  5E4D A;  1BV1 A;  4DSB A;  3PUT A;  4LG5 A;  3TVR A;  3KB0 A;  3KAZ A;  2REZ A;  5I9J A;  4IGV A;  3KL1 A;  3Q63 A;  1ZXF A;  3TL1 A;  3UID A;  4C9C A;  2E3N A;  2E3R A;  3GGN A;  1EM2 A;  4BTZ A;  4QIP A;  4BK6 A;  3P0L A;  4WVO A;  2D4R A;  2Q3Q A;  3F08 A; 
#chains in the Genus database with same CATH topology
 2E3S A;  4XRT A;  2M89 A;  4A8U A;  3CNW A;  4GY9 A;  3K3K A;  4B9R A;  4QDF A;  3NMH A;  1BTV A;  1TXC A;  2KCZ A;  2LIO A;  2NS9 A;  3NS2 A;  4A85 A;  2D4R A;  1E09 A;  2FFS A;  3FO5 A;  2K7H A;  3QSZ A;  4JHI A;  2N4B A;  2YH6 A;  4N47 A;  4Y31 A;  4KPY A;  5I8F A;  4JHH A;  2LEQ A;  2LCG A;  1XN5 A;  4XRW A;  3KB3 A;  3NJO A;  3Q6A A;  2LE1 A;  3KDJ A;  3GL2 A;  4N3E A;  4M9W A;  1XUV A;  3RT0 C;  4C9I A;  4N76 A;  2K5G A;  2RES A;  4IGY A;  4A86 A;  2LGH A;  1XFS A;  2NN5 A;  3UJL A;  3DLH A;  2E3P A;  4IGX A;  5EKQ C;  3NMV A;  2A1L A;  1XN6 A;  2LF2 A;  3K90 A;  3NMT A;  4MAP A;  4Q0K A;  3TFZ A;  3OTL A;  3HK2 A;  4JHG A;  3PU2 A;  4M9B A;  1LN1 A;  2N4A A;  2WQL A;  4PSB A;  3P51 A;  2KF2 A;  3KDI A;  3NR4 A;  5BRL A;  2PSO A;  1T27 A;  4LA7 A;  4BKC A;  4NCA A;  4BK7 A;  1X53 A;  2L65 A;  2LUZ A;  1B6F A;  3OQU A;  5AMW A;  1UW5 A;  5E4B A;  2L9P A;  3IJT A;  3OJI A;  1LN3 A;  1ICX A;  2E3M A;  5E4M A;  3OH8 A;  1H2O A;  3KAY A;  2E3O A;  2Z9Z A;  2I9Y A;  4A84 A;  2RER A;  3H3R A;  3KDH A;  3KLX A;  3NMP A;  4LGB A;  3NEF A;  4QDF B;  4DSC A;  5JO1 A;  2L8O A;  2KTE A;  1LLT A;  2MOU A;  4JDA A;  2BK0 A;  3H3S A;  3GOB A;  4MNS A;  1KCM A;  5C9Y A;  3DLB A;  2M47 A;  3GTE A;  2PCS A;  4A88 A;  4IH2 A;  3TVQ A;  3W9R A;  4LGA A;  1IFV A;  2KEW A;  4A83 A;  3IE5 A;  4JHY A;  2GKD A;  3QN1 A;  4DS8 A;  3C0V A;  1FSK A;  2R55 A;  4FPW A;  1TW0 A;  2LDK A;  3R6P A;  4N0G C;  3F73 A;  3GTS A;  1T17 A;  3P9V A;  2LPX A;  3HJF A;  4QCK A;  1Z94 A;  4R7K A;  4C94 A;  4MA6 A;  4REI A;  4A87 A;  2QIM A;  1JSS A;  3GL0 A;  4IH0 A;  3E85 A;  5E46 A;  4RYV A;  1FM4 A;  2VNE A;  4REJ A;  3JRQ B;  3GB4 A;  3RT2 A;  3HXM A;  2VQ5 A;  2Z9Y A;  3NJ0 A;  4REH A;  4JDL A;  2E3Q A;  5JNN A;  3JRS A;  2IL5 A;  3NMN A;  3WG8 A;  4N41 A;  5JO2 A;  3NJ1 A;  1XDF A;  4A80 A;  3NEG A;  4IGW A;  4IHR A;  3NI8 A;  4BKD A;  3ELI A;  3W9K A;  3H3T A;  4A81 A;  4OIC A;  1QMR A;  1VJH A;  2FLH A;  3TGO C;  3NQN A;  4NCB A;  3Q64 A;  3ZVU A;  2LAK A;  1LN2 A;  3RD6 A;  4A8V A;  3UQH A;  3H3Q A;  2EJX A;  4A8G A;  4Z3L A;  2QPV A;  3GKE A;  4E6F A;  3HM9 A;  3HO1 A;  5E4D A;  1BV1 A;  4DSB A;  4QDD A;  3PUT A;  4LG5 A;  3HVR A;  3TVR A;  3KB0 A;  3KAZ A;  2REZ A;  5I9J A;  4IGV A;  3KL1 A;  3Q63 A;  1ZXF A;  2ZYL A;  4QDC A;  3TL1 A;  3UID A;  4C9C A;  2E3N A;  2E3R A;  3GGN A;  1EM2 A;  4BTZ A;  4QIP A;  4BK6 A;  3P0L A;  4WVO A;  2LAF A;  2Q3Q A;  3F08 A; 
#chains in the Genus database with same CATH homology
 2E3S A;  4XRT A;  2M89 A;  4A8U A;  3CNW A;  4GY9 A;  3K3K A;  4B9R A;  4QDF A;  3NMH A;  1BTV A;  1TXC A;  2KCZ A;  2LIO A;  2NS9 A;  3NS2 A;  4A85 A;  2D4R A;  1E09 A;  2FFS A;  3FO5 A;  2K7H A;  3QSZ A;  4JHI A;  2N4B A;  2YH6 A;  4N47 A;  4Y31 A;  4KPY A;  5I8F A;  4JHH A;  2LEQ A;  2LCG A;  1XN5 A;  4XRW A;  3KB3 A;  3NJO A;  3Q6A A;  2LE1 A;  3KDJ A;  3GL2 A;  4N3E A;  4M9W A;  1XUV A;  3RT0 C;  4C9I A;  4N76 A;  2K5G A;  2RES A;  4IGY A;  4A86 A;  2LGH A;  1XFS A;  2NN5 A;  3UJL A;  3DLH A;  2E3P A;  4IGX A;  5EKQ C;  3NMV A;  2A1L A;  1XN6 A;  2LF2 A;  3K90 A;  3NMT A;  4MAP A;  4Q0K A;  3TFZ A;  3OTL A;  3HK2 A;  4JHG A;  3PU2 A;  4M9B A;  1LN1 A;  2N4A A;  2WQL A;  4PSB A;  3P51 A;  2KF2 A;  3KDI A;  3NR4 A;  5BRL A;  2PSO A;  1T27 A;  4LA7 A;  4BKC A;  4NCA A;  4BK7 A;  1X53 A;  2L65 A;  2LUZ A;  1B6F A;  3OQU A;  5AMW A;  1UW5 A;  5E4B A;  2L9P A;  3IJT A;  3OJI A;  1LN3 A;  1ICX A;  2E3M A;  5E4M A;  3OH8 A;  1H2O A;  3KAY A;  2E3O A;  2Z9Z A;  2I9Y A;  4A84 A;  2RER A;  3H3R A;  3KDH A;  3KLX A;  3NMP A;  4LGB A;  3NEF A;  4QDF B;  4DSC A;  5JO1 A;  2L8O A;  2KTE A;  1LLT A;  2MOU A;  4JDA A;  2BK0 A;  3H3S A;  3GOB A;  4MNS A;  1KCM A;  5C9Y A;  3DLB A;  2M47 A;  3GTE A;  2PCS A;  4A88 A;  4IH2 A;  3TVQ A;  3W9R A;  4LGA A;  1IFV A;  2KEW A;  4A83 A;  3IE5 A;  4JHY A;  2GKD A;  3QN1 A;  4DS8 A;  3C0V A;  1FSK A;  2R55 A;  4FPW A;  1TW0 A;  2LDK A;  3R6P A;  4N0G C;  3F73 A;  3GTS A;  1T17 A;  3P9V A;  2LPX A;  3HJF A;  4QCK A;  1Z94 A;  4R7K A;  4C94 A;  4MA6 A;  4REI A;  4A87 A;  2QIM A;  1JSS A;  3GL0 A;  4IH0 A;  3E85 A;  5E46 A;  4RYV A;  1FM4 A;  2VNE A;  4REJ A;  3JRQ B;  3GB4 A;  3RT2 A;  3HXM A;  2VQ5 A;  2Z9Y A;  3NJ0 A;  4REH A;  4JDL A;  2E3Q A;  5JNN A;  3JRS A;  2IL5 A;  3NMN A;  3WG8 A;  4N41 A;  5JO2 A;  3NJ1 A;  1XDF A;  4A80 A;  3NEG A;  4IGW A;  4IHR A;  3NI8 A;  4BKD A;  3ELI A;  3W9K A;  3H3T A;  4A81 A;  4OIC A;  1QMR A;  1VJH A;  2FLH A;  3TGO C;  3NQN A;  4NCB A;  3Q64 A;  3ZVU A;  2LAK A;  1LN2 A;  3RD6 A;  4A8V A;  3UQH A;  3H3Q A;  2EJX A;  4A8G A;  4Z3L A;  2QPV A;  3GKE A;  4E6F A;  3HM9 A;  3HO1 A;  5E4D A;  1BV1 A;  4DSB A;  4QDD A;  3PUT A;  4LG5 A;  3HVR A;  3TVR A;  3KB0 A;  3KAZ A;  2REZ A;  5I9J A;  4IGV A;  3KL1 A;  3Q63 A;  1ZXF A;  2ZYL A;  4QDC A;  3TL1 A;  3UID A;  4C9C A;  2E3N A;  2E3R A;  3GGN A;  1EM2 A;  4BTZ A;  4QIP A;  4BK6 A;  3P0L A;  4WVO A;  2LAF A;  2Q3Q A;  3F08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...