1X53A

The solution structure of the c-terminal domain of human activator of 90 kda heat shock protein atpase homolog 1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
145
Chain Sequence
b'GSSGSSGIPTCKITLKETFLTSPEELYRVFTTQELVQAFTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQRYYFEGIKQTFGYGASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activator of 90 kDa heat shock protein ATPase homolog 1
publication title The solution structure of the C-terminal domain of human Activator of 90 kDa heat shock protein ATPase homolog 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08327 AHSA1 Activator of Hsp90 ATPase homolog 1-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 1x53A01
4LGBA 3W9KA 2NN5A 4BK7A 2E3NA 3UIDA 3UJLA 3QN1A 2LDKA 2KF2A 3KB0A 2Q3QA 2WQLA 3NJ1A 4IH2A 4M9BA 4BKDA 3Q64A 4IGWA 1LN3A 3KL1A 2E3RA 3H3SA 4JHHA 1LN1A 4REIA 3Q63A 2PSOA 3TVQA 4IGVA 2FFSA 4JDLA 5E4BA 4IGYA 4A8UA 1ZXFA 2NS9A 3NI8A 4BKCA 3H3QA 3NEGA 4IGXA 3OTLA 1KCMA 3P9VA 1T17A 1IFVA 2VQ5A 1Z94A 4N0GC 1LLTA 2R55A 2LGHA 1X53A 2E3QA 3FO5A 4LA7A 2E3OA 3NMVA 4DSCA 4BTZA 5I8FA 2LCGA 4M9WA 4A81A 1EM2A 1UW5A 2IL5A 3QSZA 5JNNA 4Y31A 1XUVA 1XN6A 2KEWA 4A80A 2GKDA 2LF2A 3H3RA 3NMHA 3OQUA 4A8VA 4PSBA 4RYVA 1BV1A 4A8GA 4DSBA 1BTVA 4BK6A 2L9PA 4JHGA 3KLXA 4IHRA 3GGNA 1FSKA 3R6PA 4WVOA 4JDAA 3TFZA 1XFSA 2KCZA 4R7KA 2D4RA 3H3TA 3TVRA 4C9IA 5I9JA 3W9RA 3F08A 4FPWA 2LIOA 4B9RA 3IJTA 3PUTA 3RT2A 4REJA 3RD6A 2LPXA 3NJOA 2QIMA 2E3SA 2Z9YA 3OJIA 2LEQA 3NEFA 4MNSA 2REZA 4LGAA 4A84A 5AMWA 5E4DA 3C0VA 2PCSA 4MAPA 4A87A 5E46A 3PU2A 2I9YA 4N3EA 1H2OA 3K3KA 3P51A 4A88A 5C9YA 2K5GA 2M89A 4XRTA 3ZVUA 1TXCA 2N4AA 3NJ0A 3KB3A 3K90A 3Q6AA 4OICA 3ELIA 1B6FA 2L8OA 5JO2A 1ICXA 2K7HA 2RESA 3UQHA 2VNEA 3TL1A 2MOUA 3NR4A 4A83A 4IH0A 2KTEA 4Q0KA 2E3PA 2BK0A 5JO1A 3KAYA 2EJXA 1LN2A 2QPVA 1QMRA 5E4MA 3CNWA 1JSSA 3IE5A 2LAKA 3P0LA 4XRWA 4REHA 3NS2A 3RT0C 4QIPA 3WG8A 4A85A 2LUZA 2N4BA 3NMPA 1TW0A 2M47A 4MA6A 4A86A 2L65A 4DS8A 3KAZA 4C9CA 3KDHA 4JHIA 2LE1A 3NMNA 5BRLA 1T27A 2FLHA 4GY9A 1E09A 2A1LA 1VJHA 3KDIA 3E85A 3NMTA 3KDJA 2Z9ZA 4Z3LA 1XN5A 3JRQB 2E3MA 3JRSA 3OH8A 1FM4A 2RERA 1XDFA 4LG5A 4C94A
chains in the Genus database with same CATH superfamily
4LGBA 4N41A 3W9KA 2NN5A 4BK7A 4KPYA 2E3NA 3UIDA 3GKEA 3QN1A 2LDKA 3UJLA 4QDFA 2KF2A 3KB0A 2Q3QA 3TGOC 2WQLA 3NJ1A 4IH2A 4M9BA 4BKDA 3Q64A 4N76A 4IGWA 1LN3A 3KL1A 2E3RA 3H3SA 4JHHA 1LN1A 3GOBA 4REIA 3Q63A 2PSOA 3TVQA 4IGVA 2FFSA 4JDLA 5E4BA 4IGYA 4A8UA 1ZXFA 2NS9A 3NI8A 4BKCA 3H3QA 5EKQC 3NEGA 4IGXA 3OTLA 3NQNA 1KCMA 3P9VA 1T17A 2ZYLA 1IFVA 2VQ5A 1Z94A 4N0GC 3HVRA 1LLTA 2R55A 2LGHA 1X53A 2E3QA 3FO5A 4LA7A 2E3OA 3NMVA 4DSCA 4BTZA 5I8FA 2LCGA 4M9WA 4A81A 2LAFA 1EM2A 1UW5A 2IL5A 3QSZA 5JNNA 4Y31A 1XUVA 1XN6A 2KEWA 4A80A 3F73A 2GKDA 2LF2A 3H3RA 3NMHA 3OQUA 4A8VA 4PSBA 4RYVA 1BV1A 4A8GA 4DSBA 1BTVA 4BK6A 2L9PA 4JHGA 3KLXA 4IHRA 3GGNA 3GB4A 1FSKA 3R6PA 4WVOA 4JDAA 3TFZA 1XFSA 4NCAA 2KCZA 4R7KA 2D4RA 3H3TA 3TVRA 4C9IA 2YH6A 5I9JA 3F08A 4FPWA 3W9RA 2LIOA 4B9RA 3HJFA 3IJTA 3PUTA 3RT2A 4REJA 3RD6A 2LPXA 3NJOA 4NCBA 2QIMA 2E3SA 2Z9YA 3OJIA 2LEQA 3GTSA 3GL0A 3NEFA 2REZA 4LGAA 4MNSA 5AMWA 4A84A 5E4DA 3C0VA 2PCSA 4MAPA 3HXMA 4A87A 5E46A 3PU2A 2I9YA 4N3EA 1H2OA 3K3KA 3P51A 4A88A 5C9YA 2K5GA 2M89A 4XRTA 3ZVUA 3GTEA 4QDCA 1TXCA 2N4AA 3HM9A 3NJ0A 3KB3A 3K90A 3Q6AA 4OICA 3ELIA 3GL2A 1B6FA 4C94A 2L8OA 5JO2A 1ICXA 2K7HA 2RESA 3UQHA 2VNEA 3TL1A 3DLBA 2MOUA 3NR4A 4QDDA 4IH0A 2KTEA 4A83A 4Q0KA 2E3PA 2BK0A 5JO1A 3KAYA 2EJXA 1LN2A 2QPVA 4E6FA 1QMRA 5E4MA 3CNWA 1JSSA 3IE5A 4QDFB 2LAKA 3P0LA 4XRWA 4N47A 4REHA 3NS2A 3RT0C 4QIPA 3WG8A 3DLHA 4A85A 2LUZA 2N4BA 3NMPA 1TW0A 2M47A 4MA6A 4A86A 2L65A 4DS8A 3KAZA 4C9CA 3KDHA 4JHIA 2LE1A 3NMNA 5BRLA 1T27A 2FLHA 4GY9A 1E09A 2A1LA 1VJHA 3KDIA 3HK2A 3E85A 3NMTA 3KDJA 2Z9ZA 4Z3LA 1XN5A 3JRQB 2E3MA 3JRSA 3OH8A 1FM4A 2RERA 1XDFA 4JHYA 4LG5A 3HO1A 4QCKA
chains in the Genus database with same CATH topology
4LGBA 4N41A 3W9KA 2NN5A 4BK7A 4KPYA 2E3NA 3UIDA 3GKEA 3QN1A 2LDKA 3UJLA 4QDFA 2KF2A 3KB0A 2Q3QA 3TGOC 2WQLA 3NJ1A 4IH2A 4M9BA 4BKDA 3Q64A 4N76A 4IGWA 1LN3A 3KL1A 2E3RA 3H3SA 4JHHA 1LN1A 3GOBA 4REIA 3Q63A 2PSOA 3TVQA 4IGVA 2FFSA 4JDLA 5E4BA 4IGYA 4A8UA 1ZXFA 2NS9A 3NI8A 4BKCA 3H3QA 5EKQC 3NEGA 4IGXA 3OTLA 3NQNA 1KCMA 3P9VA 1T17A 2ZYLA 1IFVA 2VQ5A 1Z94A 4N0GC 3HVRA 1LLTA 2R55A 2LGHA 1X53A 2E3QA 3FO5A 4LA7A 2E3OA 3NMVA 4DSCA 4BTZA 5I8FA 2LCGA 4M9WA 4A81A 2LAFA 1EM2A 1UW5A 2IL5A 3QSZA 5JNNA 4Y31A 1XUVA 1XN6A 2KEWA 4A80A 3F73A 2GKDA 2LF2A 3H3RA 3NMHA 3OQUA 4A8VA 4PSBA 4RYVA 1BV1A 4A8GA 4DSBA 1BTVA 4BK6A 2L9PA 4JHGA 3KLXA 4IHRA 3GGNA 3GB4A 1FSKA 3R6PA 4WVOA 4JDAA 3TFZA 1XFSA 4NCAA 2KCZA 4R7KA 2D4RA 3H3TA 3TVRA 4C9IA 2YH6A 5I9JA 3F08A 4FPWA 3W9RA 2LIOA 4B9RA 3HJFA 3IJTA 3PUTA 3RT2A 4REJA 3RD6A 2LPXA 3NJOA 4NCBA 2QIMA 2E3SA 2Z9YA 3OJIA 2LEQA 3GTSA 3GL0A 3NEFA 2REZA 4LGAA 4MNSA 5AMWA 4A84A 5E4DA 3C0VA 2PCSA 4MAPA 3HXMA 4A87A 5E46A 3PU2A 2I9YA 4N3EA 1H2OA 3K3KA 3P51A 4A88A 5C9YA 2K5GA 2M89A 4XRTA 3ZVUA 3GTEA 4QDCA 1TXCA 2N4AA 3HM9A 3NJ0A 3KB3A 3K90A 3Q6AA 4OICA 3ELIA 3GL2A 1B6FA 4C94A 2L8OA 5JO2A 1ICXA 2K7HA 2RESA 3UQHA 2VNEA 3TL1A 3DLBA 2MOUA 3NR4A 4QDDA 4IH0A 2KTEA 4A83A 4Q0KA 2E3PA 2BK0A 5JO1A 3KAYA 2EJXA 1LN2A 2QPVA 4E6FA 1QMRA 5E4MA 3CNWA 1JSSA 3IE5A 4QDFB 2LAKA 3P0LA 4XRWA 4N47A 4REHA 3NS2A 3RT0C 4QIPA 3WG8A 3DLHA 4A85A 2LUZA 2N4BA 3NMPA 1TW0A 2M47A 4MA6A 4A86A 2L65A 4DS8A 3KAZA 4C9CA 3KDHA 4JHIA 2LE1A 3NMNA 5BRLA 1T27A 2FLHA 4GY9A 1E09A 2A1LA 1VJHA 3KDIA 3HK2A 3E85A 3NMTA 3KDJA 2Z9ZA 4Z3LA 1XN5A 3JRQB 2E3MA 3JRSA 3OH8A 1FM4A 2RERA 1XDFA 4JHYA 4LG5A 3HO1A 4QCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LGB A;  3W9K A;  2NN5 A;  4BK7 A;  2E3N A;  3UID A;  3UJL A;  3QN1 A;  2LDK A;  2KF2 A;  3KB0 A;  2Q3Q A;  2WQL A;  3NJ1 A;  4IH2 A;  4M9B A;  4BKD A;  3Q64 A;  4IGW A;  1LN3 A;  3KL1 A;  2E3R A;  3H3S A;  4JHH A;  1LN1 A;  4REI A;  3Q63 A;  2PSO A;  3TVQ A;  4IGV A;  2FFS A;  4JDL A;  5E4B A;  4IGY A;  4A8U A;  1ZXF A;  2NS9 A;  3NI8 A;  4BKC A;  3H3Q A;  3NEG A;  4IGX A;  3OTL A;  1KCM A;  3P9V A;  1T17 A;  1IFV A;  2VQ5 A;  1Z94 A;  4N0G C;  1LLT A;  2R55 A;  2LGH A;  1X53 A;  2E3Q A;  3FO5 A;  4LA7 A;  2E3O A;  3NMV A;  4DSC A;  4BTZ A;  5I8F A;  2LCG A;  4M9W A;  4A81 A;  1EM2 A;  1UW5 A;  2IL5 A;  3QSZ A;  5JNN A;  4Y31 A;  1XUV A;  1XN6 A;  2KEW A;  4A80 A;  2GKD A;  2LF2 A;  3H3R A;  3NMH A;  3OQU A;  4A8V A;  4PSB A;  4RYV A;  1BV1 A;  4A8G A;  4DSB A;  1BTV A;  4BK6 A;  2L9P A;  4JHG A;  3KLX A;  4IHR A;  3GGN A;  1FSK A;  3R6P A;  4WVO A;  4JDA A;  3TFZ A;  1XFS A;  2KCZ A;  4R7K A;  2D4R A;  3H3T A;  3TVR A;  4C9I A;  5I9J A;  3W9R A;  3F08 A;  4FPW A;  2LIO A;  4B9R A;  3IJT A;  3PUT A;  3RT2 A;  4REJ A;  3RD6 A;  2LPX A;  3NJO A;  2QIM A;  2E3S A;  2Z9Y A;  3OJI A;  2LEQ A;  3NEF A;  4MNS A;  2REZ A;  4LGA A;  4A84 A;  5AMW A;  5E4D A;  3C0V A;  2PCS A;  4MAP A;  4A87 A;  5E46 A;  3PU2 A;  2I9Y A;  4N3E A;  1H2O A;  3K3K A;  3P51 A;  4A88 A;  5C9Y A;  2K5G A;  2M89 A;  4XRT A;  3ZVU A;  1TXC A;  2N4A A;  3NJ0 A;  3KB3 A;  3K90 A;  3Q6A A;  4OIC A;  3ELI A;  1B6F A;  2L8O A;  5JO2 A;  1ICX A;  2K7H A;  2RES A;  3UQH A;  2VNE A;  3TL1 A;  2MOU A;  3NR4 A;  4A83 A;  4IH0 A;  2KTE A;  4Q0K A;  2E3P A;  2BK0 A;  5JO1 A;  3KAY A;  2EJX A;  1LN2 A;  2QPV A;  1QMR A;  5E4M A;  3CNW A;  1JSS A;  3IE5 A;  2LAK A;  3P0L A;  4XRW A;  4REH A;  3NS2 A;  3RT0 C;  4QIP A;  3WG8 A;  4A85 A;  2LUZ A;  2N4B A;  3NMP A;  1TW0 A;  2M47 A;  4MA6 A;  4A86 A;  2L65 A;  4DS8 A;  3KAZ A;  4C9C A;  3KDH A;  4JHI A;  2LE1 A;  3NMN A;  5BRL A;  1T27 A;  2FLH A;  4GY9 A;  1E09 A;  2A1L A;  1VJH A;  3KDI A;  3E85 A;  3NMT A;  3KDJ A;  2Z9Z A;  4Z3L A;  1XN5 A;  3JRQ B;  2E3M A;  3JRS A;  3OH8 A;  1FM4 A;  2RER A;  1XDF A;  4LG5 A;  4C94 A; 
#chains in the Genus database with same CATH topology
 4LGB A;  4N41 A;  3W9K A;  2NN5 A;  4BK7 A;  4KPY A;  2E3N A;  3UID A;  3GKE A;  3QN1 A;  2LDK A;  3UJL A;  4QDF A;  2KF2 A;  3KB0 A;  2Q3Q A;  3TGO C;  2WQL A;  3NJ1 A;  4IH2 A;  4M9B A;  4BKD A;  3Q64 A;  4N76 A;  4IGW A;  1LN3 A;  3KL1 A;  2E3R A;  3H3S A;  4JHH A;  1LN1 A;  3GOB A;  4REI A;  3Q63 A;  2PSO A;  3TVQ A;  4IGV A;  2FFS A;  4JDL A;  5E4B A;  4IGY A;  4A8U A;  1ZXF A;  2NS9 A;  3NI8 A;  4BKC A;  3H3Q A;  5EKQ C;  3NEG A;  4IGX A;  3OTL A;  3NQN A;  1KCM A;  3P9V A;  1T17 A;  2ZYL A;  1IFV A;  2VQ5 A;  1Z94 A;  4N0G C;  3HVR A;  1LLT A;  2R55 A;  2LGH A;  1X53 A;  2E3Q A;  3FO5 A;  4LA7 A;  2E3O A;  3NMV A;  4DSC A;  4BTZ A;  5I8F A;  2LCG A;  4M9W A;  4A81 A;  2LAF A;  1EM2 A;  1UW5 A;  2IL5 A;  3QSZ A;  5JNN A;  4Y31 A;  1XUV A;  1XN6 A;  2KEW A;  4A80 A;  3F73 A;  2GKD A;  2LF2 A;  3H3R A;  3NMH A;  3OQU A;  4A8V A;  4PSB A;  4RYV A;  1BV1 A;  4A8G A;  4DSB A;  1BTV A;  4BK6 A;  2L9P A;  4JHG A;  3KLX A;  4IHR A;  3GGN A;  3GB4 A;  1FSK A;  3R6P A;  4WVO A;  4JDA A;  3TFZ A;  1XFS A;  4NCA A;  2KCZ A;  4R7K A;  2D4R A;  3H3T A;  3TVR A;  4C9I A;  2YH6 A;  5I9J A;  3F08 A;  4FPW A;  3W9R A;  2LIO A;  4B9R A;  3HJF A;  3IJT A;  3PUT A;  3RT2 A;  4REJ A;  3RD6 A;  2LPX A;  3NJO A;  4NCB A;  2QIM A;  2E3S A;  2Z9Y A;  3OJI A;  2LEQ A;  3GTS A;  3GL0 A;  3NEF A;  2REZ A;  4LGA A;  4MNS A;  5AMW A;  4A84 A;  5E4D A;  3C0V A;  2PCS A;  4MAP A;  3HXM A;  4A87 A;  5E46 A;  3PU2 A;  2I9Y A;  4N3E A;  1H2O A;  3K3K A;  3P51 A;  4A88 A;  5C9Y A;  2K5G A;  2M89 A;  4XRT A;  3ZVU A;  3GTE A;  4QDC A;  1TXC A;  2N4A A;  3HM9 A;  3NJ0 A;  3KB3 A;  3K90 A;  3Q6A A;  4OIC A;  3ELI A;  3GL2 A;  1B6F A;  4C94 A;  2L8O A;  5JO2 A;  1ICX A;  2K7H A;  2RES A;  3UQH A;  2VNE A;  3TL1 A;  3DLB A;  2MOU A;  3NR4 A;  4QDD A;  4IH0 A;  2KTE A;  4A83 A;  4Q0K A;  2E3P A;  2BK0 A;  5JO1 A;  3KAY A;  2EJX A;  1LN2 A;  2QPV A;  4E6F A;  1QMR A;  5E4M A;  3CNW A;  1JSS A;  3IE5 A;  4QDF B;  2LAK A;  3P0L A;  4XRW A;  4N47 A;  4REH A;  3NS2 A;  3RT0 C;  4QIP A;  3WG8 A;  3DLH A;  4A85 A;  2LUZ A;  2N4B A;  3NMP A;  1TW0 A;  2M47 A;  4MA6 A;  4A86 A;  2L65 A;  4DS8 A;  3KAZ A;  4C9C A;  3KDH A;  4JHI A;  2LE1 A;  3NMN A;  5BRL A;  1T27 A;  2FLH A;  4GY9 A;  1E09 A;  2A1L A;  1VJH A;  3KDI A;  3HK2 A;  3E85 A;  3NMT A;  3KDJ A;  2Z9Z A;  4Z3L A;  1XN5 A;  3JRQ B;  2E3M A;  3JRS A;  3OH8 A;  1FM4 A;  2RER A;  1XDF A;  4JHY A;  4LG5 A;  3HO1 A;  4QCK A; 
#chains in the Genus database with same CATH homology
 4LGB A;  4N41 A;  3W9K A;  2NN5 A;  4BK7 A;  4KPY A;  2E3N A;  3UID A;  3GKE A;  3QN1 A;  2LDK A;  3UJL A;  4QDF A;  2KF2 A;  3KB0 A;  2Q3Q A;  3TGO C;  2WQL A;  3NJ1 A;  4IH2 A;  4M9B A;  4BKD A;  3Q64 A;  4N76 A;  4IGW A;  1LN3 A;  3KL1 A;  2E3R A;  3H3S A;  4JHH A;  1LN1 A;  3GOB A;  4REI A;  3Q63 A;  2PSO A;  3TVQ A;  4IGV A;  2FFS A;  4JDL A;  5E4B A;  4IGY A;  4A8U A;  1ZXF A;  2NS9 A;  3NI8 A;  4BKC A;  3H3Q A;  5EKQ C;  3NEG A;  4IGX A;  3OTL A;  3NQN A;  1KCM A;  3P9V A;  1T17 A;  2ZYL A;  1IFV A;  2VQ5 A;  1Z94 A;  4N0G C;  3HVR A;  1LLT A;  2R55 A;  2LGH A;  1X53 A;  2E3Q A;  3FO5 A;  4LA7 A;  2E3O A;  3NMV A;  4DSC A;  4BTZ A;  5I8F A;  2LCG A;  4M9W A;  4A81 A;  2LAF A;  1EM2 A;  1UW5 A;  2IL5 A;  3QSZ A;  5JNN A;  4Y31 A;  1XUV A;  1XN6 A;  2KEW A;  4A80 A;  3F73 A;  2GKD A;  2LF2 A;  3H3R A;  3NMH A;  3OQU A;  4A8V A;  4PSB A;  4RYV A;  1BV1 A;  4A8G A;  4DSB A;  1BTV A;  4BK6 A;  2L9P A;  4JHG A;  3KLX A;  4IHR A;  3GGN A;  3GB4 A;  1FSK A;  3R6P A;  4WVO A;  4JDA A;  3TFZ A;  1XFS A;  4NCA A;  2KCZ A;  4R7K A;  2D4R A;  3H3T A;  3TVR A;  4C9I A;  2YH6 A;  5I9J A;  3F08 A;  4FPW A;  3W9R A;  2LIO A;  4B9R A;  3HJF A;  3IJT A;  3PUT A;  3RT2 A;  4REJ A;  3RD6 A;  2LPX A;  3NJO A;  4NCB A;  2QIM A;  2E3S A;  2Z9Y A;  3OJI A;  2LEQ A;  3GTS A;  3GL0 A;  3NEF A;  2REZ A;  4LGA A;  4MNS A;  5AMW A;  4A84 A;  5E4D A;  3C0V A;  2PCS A;  4MAP A;  3HXM A;  4A87 A;  5E46 A;  3PU2 A;  2I9Y A;  4N3E A;  1H2O A;  3K3K A;  3P51 A;  4A88 A;  5C9Y A;  2K5G A;  2M89 A;  4XRT A;  3ZVU A;  3GTE A;  4QDC A;  1TXC A;  2N4A A;  3HM9 A;  3NJ0 A;  3KB3 A;  3K90 A;  3Q6A A;  4OIC A;  3ELI A;  3GL2 A;  1B6F A;  4C94 A;  2L8O A;  5JO2 A;  1ICX A;  2K7H A;  2RES A;  3UQH A;  2VNE A;  3TL1 A;  3DLB A;  2MOU A;  3NR4 A;  4QDD A;  4IH0 A;  2KTE A;  4A83 A;  4Q0K A;  2E3P A;  2BK0 A;  5JO1 A;  3KAY A;  2EJX A;  1LN2 A;  2QPV A;  4E6F A;  1QMR A;  5E4M A;  3CNW A;  1JSS A;  3IE5 A;  4QDF B;  2LAK A;  3P0L A;  4XRW A;  4N47 A;  4REH A;  3NS2 A;  3RT0 C;  4QIP A;  3WG8 A;  3DLH A;  4A85 A;  2LUZ A;  2N4B A;  3NMP A;  1TW0 A;  2M47 A;  4MA6 A;  4A86 A;  2L65 A;  4DS8 A;  3KAZ A;  4C9C A;  3KDH A;  4JHI A;  2LE1 A;  3NMN A;  5BRL A;  1T27 A;  2FLH A;  4GY9 A;  1E09 A;  2A1L A;  1VJH A;  3KDI A;  3HK2 A;  3E85 A;  3NMT A;  3KDJ A;  2Z9Z A;  4Z3L A;  1XN5 A;  3JRQ B;  2E3M A;  3JRS A;  3OH8 A;  1FM4 A;  2RER A;  1XDF A;  4JHY A;  4LG5 A;  3HO1 A;  4QCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...