3KDIA

Structure of (+)-aba bound pyl2
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
181
structure length
181
Chain Sequence
VKGLTDEEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPASTSTERLEFVDDDHRVLSFRVVGGEHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPMH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein At2g26040
publication title Structural insights into the mechanism of abscisic acid signaling by PYL proteins
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 49
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3kdiA00
4PSBA 4WVOA 4GY9A 4IH0A 1XFSA 5E46A 3NJOA 4OICA 4XRTA 1IFVA 3QSZA 3NI8A 3RD6A 3NJ1A 3WG8A 3GGNA 3IJTA 3E85A 3OJIA 2NS9A 5E4BA 2E3RA 3NEGA 2L8OA 2LPXA 3Q6AA 5E4DA 4N3EA 3H3RA 4A8GA 2KCZA 3UQHA 2MOUA 4LG5A 2E3NA 3NMVA 3P9VA 4M9BA 4BK7A 3NMNA 1XDFA 2A1LA 4FPWA 4DSBA 4A81A 3P51A 2LE1A 2L9PA 2I9YA 3KAYA 3K90A 4JDAA 2LUZA 4IGYA 4A88A 1B6FA 2EJXA 4IHRA 5JNNA 3TFZA 3NS2A 4MNSA 4DS8A 3KB3A 3JRQB 4IH2A 4JHHA 2L65A 2QPVA 3PU2A 5JO1A 2K7HA 3NJ0A 2LGHA 4REJA 3QN1A 4REHA 4IGXA 2KF2A 2LCGA 4XRWA 4A84A 3PUTA 4Z3LA 3KAZA 2KTEA 4A83A 3W9RA 3UJLA 1T17A 2NN5A 3ZVUA 1JSSA 2K5GA 3UIDA 4RYVA 3NR4A 2Q3QA 5C9YA 2FFSA 4C94A 1UW5A 5I8FA 3C0VA 3ELIA 4BTZA 4Y31A 3KL1A 2REZA 3CNWA 4A85A 4QIPA 4A8UA 1LN1A 2PSOA 3H3SA 1FM4A 1X53A 4M9WA 2GKDA 1E09A 2D4RA 3NMPA 2N4BA 1LN2A 3R6PA 4DSCA 3NMHA 1FSKA 2LF2A 2M89A 3W9KA 1T27A 4BKCA 5JO2A 1QMRA 4MAPA 2RESA 2KEWA 2PCSA 2VNEA 4IGWA 2E3QA 3JRSA 2E3SA 1LN3A 1BV1A 2FLHA 1ICXA 3K3KA 4A80A 3TVRA 2QIMA 3KDJA 4A86A 3OH8A 3FO5A 2LAKA 1EM2A 4A87A 4IGVA 4Q0KA 3OQUA 1VJHA 3RT0C 2E3PA 3Q64A 3TVQA 2Z9YA 4C9CA 1XUVA 4JDLA 3TL1A 3RT2A 1TXCA 2LIOA 4JHIA 4LA7A 2LEQA 4REIA 1XN5A 1XN6A 2N4AA 1TW0A 2BK0A 2M47A 2Z9ZA 2RERA 2R55A 1Z94A 2VQ5A 3NMTA 3P0LA 3Q63A 4A8VA 2IL5A 2WQLA 4LGBA 4R7KA 4C9IA 1BTVA 4B9RA 1KCMA 5I9JA 4MA6A 5E4MA 3H3TA 3NEFA 1H2OA 2LDKA 4BKDA 1LLTA 5AMWA 2E3MA 5BRLA 3OTLA 3KDIA 3H3QA 1ZXFA 2E3OA 4BK6A 3F08A 3KDHA 4LGAA 3KLXA 3KB0A 4JHGA 4N0GC 3IE5A
chains in the Genus database with same CATH superfamily
4PSBA 4WVOA 4GY9A 4IH0A 1XFSA 5E46A 3HO1A 3NJOA 4OICA 4XRTA 1IFVA 3QSZA 3NI8A 3RD6A 3NJ1A 3WG8A 3DLBA 3GGNA 3IJTA 3E85A 3OJIA 2NS9A 5E4BA 2E3RA 3NEGA 2L8OA 2LPXA 3Q6AA 5E4DA 4N3EA 3H3RA 4QDCA 2KCZA 4A8GA 3UQHA 2MOUA 4LG5A 2E3NA 3NMVA 3P9VA 4M9BA 4BK7A 3NMNA 1XDFA 2A1LA 4FPWA 4DSBA 4QDDA 4A81A 3P51A 2LE1A 2L9PA 4N41A 2I9YA 3KAYA 5EKQC 3K90A 4JDAA 2LUZA 3HVRA 4IGYA 4A88A 1B6FA 2EJXA 4JHYA 4IHRA 3HM9A 5JNNA 3TFZA 3NS2A 4KPYA 4MNSA 4DS8A 3KB3A 3JRQB 4IH2A 4JHHA 2L65A 2QPVA 3PU2A 4E6FA 5JO1A 2K7HA 3NJ0A 2LGHA 4REJA 3QN1A 4REHA 4IGXA 4NCBA 2KF2A 2YH6A 3GTSA 4XRWA 3PUTA 2LCGA 4A84A 3KAZA 4Z3LA 2KTEA 4A83A 3W9RA 3UJLA 1T17A 2NN5A 3ZVUA 1JSSA 2K5GA 3UIDA 4RYVA 3NR4A 2Q3QA 3GL0A 5C9YA 2FFSA 4C94A 1UW5A 3GTEA 5I8FA 3C0VA 3ELIA 4BTZA 4N47A 4Y31A 3KL1A 2REZA 3CNWA 3GKEA 4A85A 4QIPA 4A8UA 3F73A 1LN1A 2PSOA 3H3SA 1FM4A 1X53A 4M9WA 2GKDA 1E09A 2D4RA 3NMPA 2N4BA 1LN2A 3R6PA 4DSCA 3HK2A 3NMHA 1FSKA 3GOBA 2LF2A 2M89A 3W9KA 1T27A 4BKCA 5JO2A 1QMRA 4MAPA 2RESA 2KEWA 2PCSA 2VNEA 4IGWA 2E3QA 3JRSA 2E3SA 1LN3A 1BV1A 2FLHA 1ICXA 3K3KA 4A80A 3TVRA 2QIMA 3KDJA 4A86A 2LAFA 3GB4A 3OH8A 3FO5A 2LAKA 1EM2A 4A87A 3GL2A 4IGVA 4Q0KA 3OQUA 1VJHA 3RT0C 2E3PA 3Q64A 3DLHA 3TVQA 2Z9YA 4C9CA 1XUVA 4JDLA 3TGOC 3TL1A 3RT2A 1TXCA 2LIOA 3NQNA 4JHIA 4LA7A 2LEQA 3HXMA 4QCKA 4REIA 1XN5A 1XN6A 2N4AA 1TW0A 2BK0A 2M47A 2Z9ZA 2RERA 2R55A 1Z94A 2VQ5A 3NMTA 3P0LA 3Q63A 4A8VA 2IL5A 2WQLA 4LGBA 4R7KA 4C9IA 4QDFA 1BTVA 4B9RA 1KCMA 5I9JA 4MA6A 3HJFA 2ZYLA 5E4MA 3H3TA 3NEFA 1H2OA 2LDKA 4BKDA 1LLTA 5AMWA 2E3MA 5BRLA 3OTLA 3KDIA 3H3QA 4QDFB 1ZXFA 2E3OA 4BK6A 4N76A 3F08A 3KDHA 4LGAA 3KLXA 3KB0A 4NCAA 4JHGA 4N0GC 3IE5A
chains in the Genus database with same CATH topology
4PSBA 4WVOA 4GY9A 4IH0A 1XFSA 5E46A 3HO1A 3NJOA 4OICA 4XRTA 1IFVA 3QSZA 3NI8A 3RD6A 3NJ1A 3WG8A 3DLBA 3GGNA 3IJTA 3E85A 3OJIA 2NS9A 5E4BA 2E3RA 3NEGA 2L8OA 2LPXA 3Q6AA 5E4DA 4N3EA 3H3RA 4QDCA 2KCZA 4A8GA 3UQHA 2MOUA 4LG5A 2E3NA 3NMVA 3P9VA 4M9BA 4BK7A 3NMNA 1XDFA 2A1LA 4FPWA 4DSBA 4QDDA 4A81A 3P51A 2LE1A 2L9PA 4N41A 2I9YA 3KAYA 5EKQC 3K90A 4JDAA 2LUZA 3HVRA 4IGYA 4A88A 1B6FA 2EJXA 4JHYA 4IHRA 3HM9A 5JNNA 3TFZA 3NS2A 4KPYA 4MNSA 4DS8A 3KB3A 3JRQB 4IH2A 4JHHA 2L65A 2QPVA 3PU2A 4E6FA 5JO1A 2K7HA 3NJ0A 2LGHA 4REJA 3QN1A 4REHA 4IGXA 4NCBA 2KF2A 2YH6A 3GTSA 4XRWA 3PUTA 2LCGA 4A84A 3KAZA 4Z3LA 2KTEA 4A83A 3W9RA 3UJLA 1T17A 2NN5A 3ZVUA 1JSSA 2K5GA 3UIDA 4RYVA 3NR4A 2Q3QA 3GL0A 5C9YA 2FFSA 4C94A 1UW5A 3GTEA 5I8FA 3C0VA 3ELIA 4BTZA 4N47A 4Y31A 3KL1A 2REZA 3CNWA 3GKEA 4A85A 4QIPA 4A8UA 3F73A 1LN1A 2PSOA 3H3SA 1FM4A 1X53A 4M9WA 2GKDA 1E09A 2D4RA 3NMPA 2N4BA 1LN2A 3R6PA 4DSCA 3HK2A 3NMHA 1FSKA 3GOBA 2LF2A 2M89A 3W9KA 1T27A 4BKCA 5JO2A 1QMRA 4MAPA 2RESA 2KEWA 2PCSA 2VNEA 4IGWA 2E3QA 3JRSA 2E3SA 1LN3A 1BV1A 2FLHA 1ICXA 3K3KA 4A80A 3TVRA 2QIMA 3KDJA 4A86A 2LAFA 3GB4A 3OH8A 3FO5A 2LAKA 1EM2A 4A87A 3GL2A 4IGVA 4Q0KA 3OQUA 1VJHA 3RT0C 2E3PA 3Q64A 3DLHA 3TVQA 2Z9YA 4C9CA 1XUVA 4JDLA 3TGOC 3TL1A 3RT2A 1TXCA 2LIOA 3NQNA 4JHIA 4LA7A 2LEQA 3HXMA 4QCKA 4REIA 1XN5A 1XN6A 2N4AA 1TW0A 2BK0A 2M47A 2Z9ZA 2RERA 2R55A 1Z94A 2VQ5A 3NMTA 3P0LA 3Q63A 4A8VA 2IL5A 2WQLA 4LGBA 4R7KA 4C9IA 4QDFA 1BTVA 4B9RA 1KCMA 5I9JA 4MA6A 3HJFA 2ZYLA 5E4MA 3H3TA 3NEFA 1H2OA 2LDKA 4BKDA 1LLTA 5AMWA 2E3MA 5BRLA 3OTLA 3KDIA 3H3QA 4QDFB 1ZXFA 2E3OA 4BK6A 4N76A 3F08A 3KDHA 4LGAA 3KLXA 3KB0A 4NCAA 4JHGA 4N0GC 3IE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSB A;  4WVO A;  4GY9 A;  4IH0 A;  1XFS A;  5E46 A;  3NJO A;  4OIC A;  4XRT A;  1IFV A;  3QSZ A;  3NI8 A;  3RD6 A;  3NJ1 A;  3WG8 A;  3GGN A;  3IJT A;  3E85 A;  3OJI A;  2NS9 A;  5E4B A;  2E3R A;  3NEG A;  2L8O A;  2LPX A;  3Q6A A;  5E4D A;  4N3E A;  3H3R A;  4A8G A;  2KCZ A;  3UQH A;  2MOU A;  4LG5 A;  2E3N A;  3NMV A;  3P9V A;  4M9B A;  4BK7 A;  3NMN A;  1XDF A;  2A1L A;  4FPW A;  4DSB A;  4A81 A;  3P51 A;  2LE1 A;  2L9P A;  2I9Y A;  3KAY A;  3K90 A;  4JDA A;  2LUZ A;  4IGY A;  4A88 A;  1B6F A;  2EJX A;  4IHR A;  5JNN A;  3TFZ A;  3NS2 A;  4MNS A;  4DS8 A;  3KB3 A;  3JRQ B;  4IH2 A;  4JHH A;  2L65 A;  2QPV A;  3PU2 A;  5JO1 A;  2K7H A;  3NJ0 A;  2LGH A;  4REJ A;  3QN1 A;  4REH A;  4IGX A;  2KF2 A;  2LCG A;  4XRW A;  4A84 A;  3PUT A;  4Z3L A;  3KAZ A;  2KTE A;  4A83 A;  3W9R A;  3UJL A;  1T17 A;  2NN5 A;  3ZVU A;  1JSS A;  2K5G A;  3UID A;  4RYV A;  3NR4 A;  2Q3Q A;  5C9Y A;  2FFS A;  4C94 A;  1UW5 A;  5I8F A;  3C0V A;  3ELI A;  4BTZ A;  4Y31 A;  3KL1 A;  2REZ A;  3CNW A;  4A85 A;  4QIP A;  4A8U A;  1LN1 A;  2PSO A;  3H3S A;  1FM4 A;  1X53 A;  4M9W A;  2GKD A;  1E09 A;  2D4R A;  3NMP A;  2N4B A;  1LN2 A;  3R6P A;  4DSC A;  3NMH A;  1FSK A;  2LF2 A;  2M89 A;  3W9K A;  1T27 A;  4BKC A;  5JO2 A;  1QMR A;  4MAP A;  2RES A;  2KEW A;  2PCS A;  2VNE A;  4IGW A;  2E3Q A;  3JRS A;  2E3S A;  1LN3 A;  1BV1 A;  2FLH A;  1ICX A;  3K3K A;  4A80 A;  3TVR A;  2QIM A;  3KDJ A;  4A86 A;  3OH8 A;  3FO5 A;  2LAK A;  1EM2 A;  4A87 A;  4IGV A;  4Q0K A;  3OQU A;  1VJH A;  3RT0 C;  2E3P A;  3Q64 A;  3TVQ A;  2Z9Y A;  4C9C A;  1XUV A;  4JDL A;  3TL1 A;  3RT2 A;  1TXC A;  2LIO A;  4JHI A;  4LA7 A;  2LEQ A;  4REI A;  1XN5 A;  1XN6 A;  2N4A A;  1TW0 A;  2BK0 A;  2M47 A;  2Z9Z A;  2RER A;  2R55 A;  1Z94 A;  2VQ5 A;  3NMT A;  3P0L A;  3Q63 A;  4A8V A;  2IL5 A;  2WQL A;  4LGB A;  4R7K A;  4C9I A;  1BTV A;  4B9R A;  1KCM A;  5I9J A;  4MA6 A;  5E4M A;  3H3T A;  3NEF A;  1H2O A;  2LDK A;  4BKD A;  1LLT A;  5AMW A;  2E3M A;  5BRL A;  3OTL A;  3KDI A;  3H3Q A;  1ZXF A;  2E3O A;  4BK6 A;  3F08 A;  3KDH A;  4LGA A;  3KLX A;  3KB0 A;  4JHG A;  4N0G C;  3IE5 A; 
#chains in the Genus database with same CATH topology
 4PSB A;  4WVO A;  4GY9 A;  4IH0 A;  1XFS A;  5E46 A;  3HO1 A;  3NJO A;  4OIC A;  4XRT A;  1IFV A;  3QSZ A;  3NI8 A;  3RD6 A;  3NJ1 A;  3WG8 A;  3DLB A;  3GGN A;  3IJT A;  3E85 A;  3OJI A;  2NS9 A;  5E4B A;  2E3R A;  3NEG A;  2L8O A;  2LPX A;  3Q6A A;  5E4D A;  4N3E A;  3H3R A;  4QDC A;  2KCZ A;  4A8G A;  3UQH A;  2MOU A;  4LG5 A;  2E3N A;  3NMV A;  3P9V A;  4M9B A;  4BK7 A;  3NMN A;  1XDF A;  2A1L A;  4FPW A;  4DSB A;  4QDD A;  4A81 A;  3P51 A;  2LE1 A;  2L9P A;  4N41 A;  2I9Y A;  3KAY A;  5EKQ C;  3K90 A;  4JDA A;  2LUZ A;  3HVR A;  4IGY A;  4A88 A;  1B6F A;  2EJX A;  4JHY A;  4IHR A;  3HM9 A;  5JNN A;  3TFZ A;  3NS2 A;  4KPY A;  4MNS A;  4DS8 A;  3KB3 A;  3JRQ B;  4IH2 A;  4JHH A;  2L65 A;  2QPV A;  3PU2 A;  4E6F A;  5JO1 A;  2K7H A;  3NJ0 A;  2LGH A;  4REJ A;  3QN1 A;  4REH A;  4IGX A;  4NCB A;  2KF2 A;  2YH6 A;  3GTS A;  4XRW A;  3PUT A;  2LCG A;  4A84 A;  3KAZ A;  4Z3L A;  2KTE A;  4A83 A;  3W9R A;  3UJL A;  1T17 A;  2NN5 A;  3ZVU A;  1JSS A;  2K5G A;  3UID A;  4RYV A;  3NR4 A;  2Q3Q A;  3GL0 A;  5C9Y A;  2FFS A;  4C94 A;  1UW5 A;  3GTE A;  5I8F A;  3C0V A;  3ELI A;  4BTZ A;  4N47 A;  4Y31 A;  3KL1 A;  2REZ A;  3CNW A;  3GKE A;  4A85 A;  4QIP A;  4A8U A;  3F73 A;  1LN1 A;  2PSO A;  3H3S A;  1FM4 A;  1X53 A;  4M9W A;  2GKD A;  1E09 A;  2D4R A;  3NMP A;  2N4B A;  1LN2 A;  3R6P A;  4DSC A;  3HK2 A;  3NMH A;  1FSK A;  3GOB A;  2LF2 A;  2M89 A;  3W9K A;  1T27 A;  4BKC A;  5JO2 A;  1QMR A;  4MAP A;  2RES A;  2KEW A;  2PCS A;  2VNE A;  4IGW A;  2E3Q A;  3JRS A;  2E3S A;  1LN3 A;  1BV1 A;  2FLH A;  1ICX A;  3K3K A;  4A80 A;  3TVR A;  2QIM A;  3KDJ A;  4A86 A;  2LAF A;  3GB4 A;  3OH8 A;  3FO5 A;  2LAK A;  1EM2 A;  4A87 A;  3GL2 A;  4IGV A;  4Q0K A;  3OQU A;  1VJH A;  3RT0 C;  2E3P A;  3Q64 A;  3DLH A;  3TVQ A;  2Z9Y A;  4C9C A;  1XUV A;  4JDL A;  3TGO C;  3TL1 A;  3RT2 A;  1TXC A;  2LIO A;  3NQN A;  4JHI A;  4LA7 A;  2LEQ A;  3HXM A;  4QCK A;  4REI A;  1XN5 A;  1XN6 A;  2N4A A;  1TW0 A;  2BK0 A;  2M47 A;  2Z9Z A;  2RER A;  2R55 A;  1Z94 A;  2VQ5 A;  3NMT A;  3P0L A;  3Q63 A;  4A8V A;  2IL5 A;  2WQL A;  4LGB A;  4R7K A;  4C9I A;  4QDF A;  1BTV A;  4B9R A;  1KCM A;  5I9J A;  4MA6 A;  3HJF A;  2ZYL A;  5E4M A;  3H3T A;  3NEF A;  1H2O A;  2LDK A;  4BKD A;  1LLT A;  5AMW A;  2E3M A;  5BRL A;  3OTL A;  3KDI A;  3H3Q A;  4QDF B;  1ZXF A;  2E3O A;  4BK6 A;  4N76 A;  3F08 A;  3KDH A;  4LGA A;  3KLX A;  3KB0 A;  4NCA A;  4JHG A;  4N0G C;  3IE5 A; 
#chains in the Genus database with same CATH homology
 4PSB A;  4WVO A;  4GY9 A;  4IH0 A;  1XFS A;  5E46 A;  3HO1 A;  3NJO A;  4OIC A;  4XRT A;  1IFV A;  3QSZ A;  3NI8 A;  3RD6 A;  3NJ1 A;  3WG8 A;  3DLB A;  3GGN A;  3IJT A;  3E85 A;  3OJI A;  2NS9 A;  5E4B A;  2E3R A;  3NEG A;  2L8O A;  2LPX A;  3Q6A A;  5E4D A;  4N3E A;  3H3R A;  4QDC A;  2KCZ A;  4A8G A;  3UQH A;  2MOU A;  4LG5 A;  2E3N A;  3NMV A;  3P9V A;  4M9B A;  4BK7 A;  3NMN A;  1XDF A;  2A1L A;  4FPW A;  4DSB A;  4QDD A;  4A81 A;  3P51 A;  2LE1 A;  2L9P A;  4N41 A;  2I9Y A;  3KAY A;  5EKQ C;  3K90 A;  4JDA A;  2LUZ A;  3HVR A;  4IGY A;  4A88 A;  1B6F A;  2EJX A;  4JHY A;  4IHR A;  3HM9 A;  5JNN A;  3TFZ A;  3NS2 A;  4KPY A;  4MNS A;  4DS8 A;  3KB3 A;  3JRQ B;  4IH2 A;  4JHH A;  2L65 A;  2QPV A;  3PU2 A;  4E6F A;  5JO1 A;  2K7H A;  3NJ0 A;  2LGH A;  4REJ A;  3QN1 A;  4REH A;  4IGX A;  4NCB A;  2KF2 A;  2YH6 A;  3GTS A;  4XRW A;  3PUT A;  2LCG A;  4A84 A;  3KAZ A;  4Z3L A;  2KTE A;  4A83 A;  3W9R A;  3UJL A;  1T17 A;  2NN5 A;  3ZVU A;  1JSS A;  2K5G A;  3UID A;  4RYV A;  3NR4 A;  2Q3Q A;  3GL0 A;  5C9Y A;  2FFS A;  4C94 A;  1UW5 A;  3GTE A;  5I8F A;  3C0V A;  3ELI A;  4BTZ A;  4N47 A;  4Y31 A;  3KL1 A;  2REZ A;  3CNW A;  3GKE A;  4A85 A;  4QIP A;  4A8U A;  3F73 A;  1LN1 A;  2PSO A;  3H3S A;  1FM4 A;  1X53 A;  4M9W A;  2GKD A;  1E09 A;  2D4R A;  3NMP A;  2N4B A;  1LN2 A;  3R6P A;  4DSC A;  3HK2 A;  3NMH A;  1FSK A;  3GOB A;  2LF2 A;  2M89 A;  3W9K A;  1T27 A;  4BKC A;  5JO2 A;  1QMR A;  4MAP A;  2RES A;  2KEW A;  2PCS A;  2VNE A;  4IGW A;  2E3Q A;  3JRS A;  2E3S A;  1LN3 A;  1BV1 A;  2FLH A;  1ICX A;  3K3K A;  4A80 A;  3TVR A;  2QIM A;  3KDJ A;  4A86 A;  2LAF A;  3GB4 A;  3OH8 A;  3FO5 A;  2LAK A;  1EM2 A;  4A87 A;  3GL2 A;  4IGV A;  4Q0K A;  3OQU A;  1VJH A;  3RT0 C;  2E3P A;  3Q64 A;  3DLH A;  3TVQ A;  2Z9Y A;  4C9C A;  1XUV A;  4JDL A;  3TGO C;  3TL1 A;  3RT2 A;  1TXC A;  2LIO A;  3NQN A;  4JHI A;  4LA7 A;  2LEQ A;  3HXM A;  4QCK A;  4REI A;  1XN5 A;  1XN6 A;  2N4A A;  1TW0 A;  2BK0 A;  2M47 A;  2Z9Z A;  2RER A;  2R55 A;  1Z94 A;  2VQ5 A;  3NMT A;  3P0L A;  3Q63 A;  4A8V A;  2IL5 A;  2WQL A;  4LGB A;  4R7K A;  4C9I A;  4QDF A;  1BTV A;  4B9R A;  1KCM A;  5I9J A;  4MA6 A;  3HJF A;  2ZYL A;  5E4M A;  3H3T A;  3NEF A;  1H2O A;  2LDK A;  4BKD A;  1LLT A;  5AMW A;  2E3M A;  5BRL A;  3OTL A;  3KDI A;  3H3Q A;  4QDF B;  1ZXF A;  2E3O A;  4BK6 A;  4N76 A;  3F08 A;  3KDH A;  4LGA A;  3KLX A;  3KB0 A;  4NCA A;  4JHG A;  4N0G C;  3IE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...