5AMWA

Crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 2 protein (a141f) processed with the crystaldirect automated mounting and cryo-cooling technology
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
162
structure length
162
Chain Sequence
AMAGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKENFVYSYSLIEGDALSDKIEKISYETKLVSSSDGGSIIKSTSNYHTKGDVEIKEEHVKAGKEKFSHLFKLVEGYLLANPNEYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fra a 2 allergen
publication title Automated Harvesting and Processing of Protein Crystals Through Laser Photoablation.
pubmed doi rcsb
source organism Fragaria ananassa
molecule tags Allergen
total genus 42
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 5amwA00
1TXCA 3KAYA 1B6FA 2NS9A 4BKCA 2I9YA 1UW5A 3R6PA 2L9PA 4M9WA 4IHRA 2M47A 4MA6A 2WQLA 3QSZA 3RT0C 4B9RA 2KTEA 3RD6A 4IGWA 2LPXA 5E4DA 3KLXA 4DSBA 2N4AA 4IH0A 2LE1A 4A80A 1H2OA 2PCSA 2Z9ZA 4REJA 1XUVA 4IGYA 4LGAA 5E4MA 3IJTA 3NMPA 4A83A 4BKDA 5E4BA 2LCGA 1E09A 3W9RA 2BK0A 4Q0KA 4WVOA 2E3SA 2FFSA 2L8OA 3KB0A 3UQHA 3F08A 1JSSA 4A86A 1XN6A 1BV1A 5JO2A 1QMRA 4A8UA 3NMHA 4A8VA 1IFVA 4JHGA 3H3SA 3K90A 5I8FA 3NMTA 4OICA 4A88A 4MNSA 2KEWA 4DS8A 4R7KA 3KDHA 3Q64A 3KB3A 4IH2A 1LN2A 3NEGA 3NEFA 2R55A 3OJIA 5C9YA 4JDAA 1XN5A 3OQUA 1ZXFA 2LUZA 4BK6A 1FSKA 2K5GA 2FLHA 2VQ5A 4BTZA 2N4BA 3FO5A 5AMWA 3H3QA 3W9KA 3NJ0A 1LN3A 1Z94A 2A1LA 2IL5A 3UJLA 4M9BA 3WG8A 2E3RA 3NJ1A 3TFZA 1EM2A 2K7HA 1XFSA 3ELIA 3P9VA 3K3KA 3NJOA 4GY9A 2D4RA 3Q6AA 3NMVA 4JDLA 1KCMA 2L65A 2LAKA 4REHA 4XRWA 5E46A 2EJXA 2E3OA 3NMNA 1X53A 4RYVA 2LDKA 1VJHA 2KCZA 3H3TA 3P51A 2E3PA 4A85A 5JO1A 3TVRA 4A84A 4LA7A 4IGXA 2QIMA 4N3EA 4BK7A 2GKDA 3JRQB 4XRTA 3OTLA 5JNNA 2RERA 3JRSA 4LGBA 3PU2A 3CNWA 1TW0A 2LGHA 4MAPA 5I9JA 4Z3LA 3C0VA 1LLTA 2MOUA 2E3NA 4C94A 4PSBA 3RT2A 3TVQA 3QN1A 5BRLA 4JHHA 3KDIA 3NI8A 3KAZA 3P0LA 4C9IA 2KF2A 3KDJA 3Q63A 3H3RA 4IGVA 3GGNA 2PSOA 3NR4A 2E3MA 3PUTA 2RESA 2REZA 1LN1A 1T17A 4C9CA 4N0GC 3KL1A 4REIA 2VNEA 3IE5A 1BTVA 3OH8A 1FM4A 4Y31A 2Q3QA 4QIPA 4FPWA 3UIDA 4A87A 3NS2A 4A81A 2E3QA 1T27A 3TL1A 2Z9YA 4JHIA 4LG5A 1XDFA 2LIOA 4DSCA 2LEQA 2NN5A 2QPVA 4A8GA 1ICXA 2M89A 3E85A 3ZVUA 2LF2A
chains in the Genus database with same CATH superfamily
1TXCA 3KAYA 1B6FA 2NS9A 4BKCA 2I9YA 4JHYA 1UW5A 3R6PA 2L9PA 4M9WA 4IHRA 2M47A 4MA6A 2WQLA 3QSZA 3RT0C 4B9RA 2KTEA 3GTSA 3RD6A 4IGWA 2LPXA 5E4DA 3KLXA 4DSBA 2N4AA 4IH0A 2LE1A 4A80A 1H2OA 2PCSA 2Z9ZA 4REJA 1XUVA 4IGYA 4LGAA 5E4MA 3IJTA 3NMPA 4A83A 4BKDA 5E4BA 2LCGA 1E09A 3W9RA 2BK0A 4Q0KA 3GL2A 4WVOA 2E3SA 2FFSA 2L8OA 3KB0A 3UQHA 3F08A 1JSSA 4QCKA 4A86A 1XN6A 1BV1A 5JO2A 1QMRA 4QDCA 4A8UA 3NMHA 4A8VA 1IFVA 4N76A 3HVRA 2ZYLA 4JHGA 3H3SA 3K90A 5I8FA 3NMTA 4OICA 4A88A 4MNSA 2KEWA 4DS8A 4R7KA 3F73A 3KDHA 3Q64A 3KB3A 3GTEA 4IH2A 1LN2A 3NEGA 3NEFA 2R55A 4QDFB 3OJIA 5C9YA 4JDAA 5EKQC 1XN5A 3OQUA 1ZXFA 2LUZA 4BK6A 3HXMA 1FSKA 2K5GA 2FLHA 2VQ5A 4BTZA 4NCAA 2N4BA 3FO5A 5AMWA 3H3QA 3W9KA 3NJ0A 1LN3A 1Z94A 2A1LA 2IL5A 3UJLA 4M9BA 3HO1A 3WG8A 2E3RA 3NJ1A 3TFZA 1EM2A 2K7HA 1XFSA 3ELIA 3P9VA 3K3KA 3NJOA 4GY9A 2D4RA 3Q6AA 3NMVA 4JDLA 1KCMA 2L65A 2LAKA 4REHA 4XRWA 4KPYA 4N41A 5E46A 2EJXA 2E3OA 3NMNA 1X53A 4RYVA 2LDKA 3HK2A 1VJHA 2KCZA 3GOBA 3H3TA 2E3PA 3P51A 4A85A 5JO1A 3TVRA 4A84A 4LA7A 4IGXA 2QIMA 4N3EA 4BK7A 2GKDA 3JRQB 4XRTA 3OTLA 5JNNA 2RERA 3JRSA 4LGBA 3PU2A 3CNWA 1TW0A 2LGHA 4MAPA 5I9JA 4E6FA 3C0VA 4Z3LA 1LLTA 2MOUA 2E3NA 4C94A 4QDDA 4N47A 4PSBA 4QDFA 3RT2A 3QN1A 3TVQA 2YH6A 5BRLA 4JHHA 3KDIA 3NI8A 3DLHA 3KAZA 3P0LA 4C9IA 2KF2A 3KDJA 4NCBA 3HJFA 3Q63A 3H3RA 4IGVA 3NQNA 3GGNA 2PSOA 3NR4A 2E3MA 3PUTA 2RESA 2REZA 3GB4A 2LAFA 3HM9A 1LN1A 1T17A 4C9CA 4N0GC 3KL1A 4REIA 2VNEA 3IE5A 1BTVA 3DLBA 3OH8A 1FM4A 3GL0A 4Y31A 3TGOC 2Q3QA 4QIPA 4FPWA 3UIDA 3GKEA 4A87A 3NS2A 4A81A 2E3QA 1T27A 3TL1A 2Z9YA 4JHIA 4LG5A 1XDFA 2LIOA 4DSCA 2LEQA 2NN5A 2QPVA 4A8GA 1ICXA 2M89A 3E85A 3ZVUA 2LF2A
chains in the Genus database with same CATH topology
1TXCA 3KAYA 1B6FA 2NS9A 4BKCA 2I9YA 4JHYA 1UW5A 3R6PA 2L9PA 4M9WA 4IHRA 2M47A 4MA6A 2WQLA 3QSZA 3RT0C 4B9RA 2KTEA 3GTSA 3RD6A 4IGWA 2LPXA 5E4DA 3KLXA 4DSBA 2N4AA 4IH0A 2LE1A 4A80A 1H2OA 2PCSA 2Z9ZA 4REJA 1XUVA 4IGYA 4LGAA 5E4MA 3IJTA 3NMPA 4A83A 4BKDA 5E4BA 2LCGA 1E09A 3W9RA 2BK0A 4Q0KA 3GL2A 4WVOA 2E3SA 2FFSA 2L8OA 3KB0A 3UQHA 3F08A 1JSSA 4QCKA 4A86A 1XN6A 1BV1A 5JO2A 1QMRA 4QDCA 4A8UA 3NMHA 4A8VA 1IFVA 4N76A 3HVRA 2ZYLA 4JHGA 3H3SA 3K90A 5I8FA 3NMTA 4OICA 4A88A 4MNSA 2KEWA 4DS8A 4R7KA 3F73A 3KDHA 3Q64A 3KB3A 3GTEA 4IH2A 1LN2A 3NEGA 3NEFA 2R55A 4QDFB 3OJIA 5C9YA 4JDAA 5EKQC 1XN5A 3OQUA 1ZXFA 2LUZA 4BK6A 3HXMA 1FSKA 2K5GA 2FLHA 2VQ5A 4BTZA 4NCAA 2N4BA 3FO5A 5AMWA 3H3QA 3W9KA 3NJ0A 1LN3A 1Z94A 2A1LA 2IL5A 3UJLA 4M9BA 3HO1A 3WG8A 2E3RA 3NJ1A 3TFZA 1EM2A 2K7HA 1XFSA 3ELIA 3P9VA 3K3KA 3NJOA 4GY9A 2D4RA 3Q6AA 3NMVA 4JDLA 1KCMA 2L65A 2LAKA 4REHA 4XRWA 4KPYA 4N41A 5E46A 2EJXA 2E3OA 3NMNA 1X53A 4RYVA 2LDKA 3HK2A 1VJHA 2KCZA 3GOBA 3H3TA 2E3PA 3P51A 4A85A 5JO1A 3TVRA 4A84A 4LA7A 4IGXA 2QIMA 4N3EA 4BK7A 2GKDA 3JRQB 4XRTA 3OTLA 5JNNA 2RERA 3JRSA 4LGBA 3PU2A 3CNWA 1TW0A 2LGHA 4MAPA 5I9JA 4E6FA 3C0VA 4Z3LA 1LLTA 2MOUA 2E3NA 4C94A 4QDDA 4N47A 4PSBA 4QDFA 3RT2A 3QN1A 3TVQA 2YH6A 5BRLA 4JHHA 3KDIA 3NI8A 3DLHA 3KAZA 3P0LA 4C9IA 2KF2A 3KDJA 4NCBA 3HJFA 3Q63A 3H3RA 4IGVA 3NQNA 3GGNA 2PSOA 3NR4A 2E3MA 3PUTA 2RESA 2REZA 3GB4A 2LAFA 3HM9A 1LN1A 1T17A 4C9CA 4N0GC 3KL1A 4REIA 2VNEA 3IE5A 1BTVA 3DLBA 3OH8A 1FM4A 3GL0A 4Y31A 3TGOC 2Q3QA 4QIPA 4FPWA 3UIDA 3GKEA 4A87A 3NS2A 4A81A 2E3QA 1T27A 3TL1A 2Z9YA 4JHIA 4LG5A 1XDFA 2LIOA 4DSCA 2LEQA 2NN5A 2QPVA 4A8GA 1ICXA 2M89A 3E85A 3ZVUA 2LF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXC A;  3KAY A;  1B6F A;  2NS9 A;  4BKC A;  2I9Y A;  1UW5 A;  3R6P A;  2L9P A;  4M9W A;  4IHR A;  2M47 A;  4MA6 A;  2WQL A;  3QSZ A;  3RT0 C;  4B9R A;  2KTE A;  3RD6 A;  4IGW A;  2LPX A;  5E4D A;  3KLX A;  4DSB A;  2N4A A;  4IH0 A;  2LE1 A;  4A80 A;  1H2O A;  2PCS A;  2Z9Z A;  4REJ A;  1XUV A;  4IGY A;  4LGA A;  5E4M A;  3IJT A;  3NMP A;  4A83 A;  4BKD A;  5E4B A;  2LCG A;  1E09 A;  3W9R A;  2BK0 A;  4Q0K A;  4WVO A;  2E3S A;  2FFS A;  2L8O A;  3KB0 A;  3UQH A;  3F08 A;  1JSS A;  4A86 A;  1XN6 A;  1BV1 A;  5JO2 A;  1QMR A;  4A8U A;  3NMH A;  4A8V A;  1IFV A;  4JHG A;  3H3S A;  3K90 A;  5I8F A;  3NMT A;  4OIC A;  4A88 A;  4MNS A;  2KEW A;  4DS8 A;  4R7K A;  3KDH A;  3Q64 A;  3KB3 A;  4IH2 A;  1LN2 A;  3NEG A;  3NEF A;  2R55 A;  3OJI A;  5C9Y A;  4JDA A;  1XN5 A;  3OQU A;  1ZXF A;  2LUZ A;  4BK6 A;  1FSK A;  2K5G A;  2FLH A;  2VQ5 A;  4BTZ A;  2N4B A;  3FO5 A;  5AMW A;  3H3Q A;  3W9K A;  3NJ0 A;  1LN3 A;  1Z94 A;  2A1L A;  2IL5 A;  3UJL A;  4M9B A;  3WG8 A;  2E3R A;  3NJ1 A;  3TFZ A;  1EM2 A;  2K7H A;  1XFS A;  3ELI A;  3P9V A;  3K3K A;  3NJO A;  4GY9 A;  2D4R A;  3Q6A A;  3NMV A;  4JDL A;  1KCM A;  2L65 A;  2LAK A;  4REH A;  4XRW A;  5E46 A;  2EJX A;  2E3O A;  3NMN A;  1X53 A;  4RYV A;  2LDK A;  1VJH A;  2KCZ A;  3H3T A;  3P51 A;  2E3P A;  4A85 A;  5JO1 A;  3TVR A;  4A84 A;  4LA7 A;  4IGX A;  2QIM A;  4N3E A;  4BK7 A;  2GKD A;  3JRQ B;  4XRT A;  3OTL A;  5JNN A;  2RER A;  3JRS A;  4LGB A;  3PU2 A;  3CNW A;  1TW0 A;  2LGH A;  4MAP A;  5I9J A;  4Z3L A;  3C0V A;  1LLT A;  2MOU A;  2E3N A;  4C94 A;  4PSB A;  3RT2 A;  3TVQ A;  3QN1 A;  5BRL A;  4JHH A;  3KDI A;  3NI8 A;  3KAZ A;  3P0L A;  4C9I A;  2KF2 A;  3KDJ A;  3Q63 A;  3H3R A;  4IGV A;  3GGN A;  2PSO A;  3NR4 A;  2E3M A;  3PUT A;  2RES A;  2REZ A;  1LN1 A;  1T17 A;  4C9C A;  4N0G C;  3KL1 A;  4REI A;  2VNE A;  3IE5 A;  1BTV A;  3OH8 A;  1FM4 A;  4Y31 A;  2Q3Q A;  4QIP A;  4FPW A;  3UID A;  4A87 A;  3NS2 A;  4A81 A;  2E3Q A;  1T27 A;  3TL1 A;  2Z9Y A;  4JHI A;  4LG5 A;  1XDF A;  2LIO A;  4DSC A;  2LEQ A;  2NN5 A;  2QPV A;  4A8G A;  1ICX A;  2M89 A;  3E85 A;  3ZVU A;  2LF2 A; 
#chains in the Genus database with same CATH topology
 1TXC A;  3KAY A;  1B6F A;  2NS9 A;  4BKC A;  2I9Y A;  4JHY A;  1UW5 A;  3R6P A;  2L9P A;  4M9W A;  4IHR A;  2M47 A;  4MA6 A;  2WQL A;  3QSZ A;  3RT0 C;  4B9R A;  2KTE A;  3GTS A;  3RD6 A;  4IGW A;  2LPX A;  5E4D A;  3KLX A;  4DSB A;  2N4A A;  4IH0 A;  2LE1 A;  4A80 A;  1H2O A;  2PCS A;  2Z9Z A;  4REJ A;  1XUV A;  4IGY A;  4LGA A;  5E4M A;  3IJT A;  3NMP A;  4A83 A;  4BKD A;  5E4B A;  2LCG A;  1E09 A;  3W9R A;  2BK0 A;  4Q0K A;  3GL2 A;  4WVO A;  2E3S A;  2FFS A;  2L8O A;  3KB0 A;  3UQH A;  3F08 A;  1JSS A;  4QCK A;  4A86 A;  1XN6 A;  1BV1 A;  5JO2 A;  1QMR A;  4QDC A;  4A8U A;  3NMH A;  4A8V A;  1IFV A;  4N76 A;  3HVR A;  2ZYL A;  4JHG A;  3H3S A;  3K90 A;  5I8F A;  3NMT A;  4OIC A;  4A88 A;  4MNS A;  2KEW A;  4DS8 A;  4R7K A;  3F73 A;  3KDH A;  3Q64 A;  3KB3 A;  3GTE A;  4IH2 A;  1LN2 A;  3NEG A;  3NEF A;  2R55 A;  4QDF B;  3OJI A;  5C9Y A;  4JDA A;  5EKQ C;  1XN5 A;  3OQU A;  1ZXF A;  2LUZ A;  4BK6 A;  3HXM A;  1FSK A;  2K5G A;  2FLH A;  2VQ5 A;  4BTZ A;  4NCA A;  2N4B A;  3FO5 A;  5AMW A;  3H3Q A;  3W9K A;  3NJ0 A;  1LN3 A;  1Z94 A;  2A1L A;  2IL5 A;  3UJL A;  4M9B A;  3HO1 A;  3WG8 A;  2E3R A;  3NJ1 A;  3TFZ A;  1EM2 A;  2K7H A;  1XFS A;  3ELI A;  3P9V A;  3K3K A;  3NJO A;  4GY9 A;  2D4R A;  3Q6A A;  3NMV A;  4JDL A;  1KCM A;  2L65 A;  2LAK A;  4REH A;  4XRW A;  4KPY A;  4N41 A;  5E46 A;  2EJX A;  2E3O A;  3NMN A;  1X53 A;  4RYV A;  2LDK A;  3HK2 A;  1VJH A;  2KCZ A;  3GOB A;  3H3T A;  2E3P A;  3P51 A;  4A85 A;  5JO1 A;  3TVR A;  4A84 A;  4LA7 A;  4IGX A;  2QIM A;  4N3E A;  4BK7 A;  2GKD A;  3JRQ B;  4XRT A;  3OTL A;  5JNN A;  2RER A;  3JRS A;  4LGB A;  3PU2 A;  3CNW A;  1TW0 A;  2LGH A;  4MAP A;  5I9J A;  4E6F A;  3C0V A;  4Z3L A;  1LLT A;  2MOU A;  2E3N A;  4C94 A;  4QDD A;  4N47 A;  4PSB A;  4QDF A;  3RT2 A;  3QN1 A;  3TVQ A;  2YH6 A;  5BRL A;  4JHH A;  3KDI A;  3NI8 A;  3DLH A;  3KAZ A;  3P0L A;  4C9I A;  2KF2 A;  3KDJ A;  4NCB A;  3HJF A;  3Q63 A;  3H3R A;  4IGV A;  3NQN A;  3GGN A;  2PSO A;  3NR4 A;  2E3M A;  3PUT A;  2RES A;  2REZ A;  3GB4 A;  2LAF A;  3HM9 A;  1LN1 A;  1T17 A;  4C9C A;  4N0G C;  3KL1 A;  4REI A;  2VNE A;  3IE5 A;  1BTV A;  3DLB A;  3OH8 A;  1FM4 A;  3GL0 A;  4Y31 A;  3TGO C;  2Q3Q A;  4QIP A;  4FPW A;  3UID A;  3GKE A;  4A87 A;  3NS2 A;  4A81 A;  2E3Q A;  1T27 A;  3TL1 A;  2Z9Y A;  4JHI A;  4LG5 A;  1XDF A;  2LIO A;  4DSC A;  2LEQ A;  2NN5 A;  2QPV A;  4A8G A;  1ICX A;  2M89 A;  3E85 A;  3ZVU A;  2LF2 A; 
#chains in the Genus database with same CATH homology
 1TXC A;  3KAY A;  1B6F A;  2NS9 A;  4BKC A;  2I9Y A;  4JHY A;  1UW5 A;  3R6P A;  2L9P A;  4M9W A;  4IHR A;  2M47 A;  4MA6 A;  2WQL A;  3QSZ A;  3RT0 C;  4B9R A;  2KTE A;  3GTS A;  3RD6 A;  4IGW A;  2LPX A;  5E4D A;  3KLX A;  4DSB A;  2N4A A;  4IH0 A;  2LE1 A;  4A80 A;  1H2O A;  2PCS A;  2Z9Z A;  4REJ A;  1XUV A;  4IGY A;  4LGA A;  5E4M A;  3IJT A;  3NMP A;  4A83 A;  4BKD A;  5E4B A;  2LCG A;  1E09 A;  3W9R A;  2BK0 A;  4Q0K A;  3GL2 A;  4WVO A;  2E3S A;  2FFS A;  2L8O A;  3KB0 A;  3UQH A;  3F08 A;  1JSS A;  4QCK A;  4A86 A;  1XN6 A;  1BV1 A;  5JO2 A;  1QMR A;  4QDC A;  4A8U A;  3NMH A;  4A8V A;  1IFV A;  4N76 A;  3HVR A;  2ZYL A;  4JHG A;  3H3S A;  3K90 A;  5I8F A;  3NMT A;  4OIC A;  4A88 A;  4MNS A;  2KEW A;  4DS8 A;  4R7K A;  3F73 A;  3KDH A;  3Q64 A;  3KB3 A;  3GTE A;  4IH2 A;  1LN2 A;  3NEG A;  3NEF A;  2R55 A;  4QDF B;  3OJI A;  5C9Y A;  4JDA A;  5EKQ C;  1XN5 A;  3OQU A;  1ZXF A;  2LUZ A;  4BK6 A;  3HXM A;  1FSK A;  2K5G A;  2FLH A;  2VQ5 A;  4BTZ A;  4NCA A;  2N4B A;  3FO5 A;  5AMW A;  3H3Q A;  3W9K A;  3NJ0 A;  1LN3 A;  1Z94 A;  2A1L A;  2IL5 A;  3UJL A;  4M9B A;  3HO1 A;  3WG8 A;  2E3R A;  3NJ1 A;  3TFZ A;  1EM2 A;  2K7H A;  1XFS A;  3ELI A;  3P9V A;  3K3K A;  3NJO A;  4GY9 A;  2D4R A;  3Q6A A;  3NMV A;  4JDL A;  1KCM A;  2L65 A;  2LAK A;  4REH A;  4XRW A;  4KPY A;  4N41 A;  5E46 A;  2EJX A;  2E3O A;  3NMN A;  1X53 A;  4RYV A;  2LDK A;  3HK2 A;  1VJH A;  2KCZ A;  3GOB A;  3H3T A;  2E3P A;  3P51 A;  4A85 A;  5JO1 A;  3TVR A;  4A84 A;  4LA7 A;  4IGX A;  2QIM A;  4N3E A;  4BK7 A;  2GKD A;  3JRQ B;  4XRT A;  3OTL A;  5JNN A;  2RER A;  3JRS A;  4LGB A;  3PU2 A;  3CNW A;  1TW0 A;  2LGH A;  4MAP A;  5I9J A;  4E6F A;  3C0V A;  4Z3L A;  1LLT A;  2MOU A;  2E3N A;  4C94 A;  4QDD A;  4N47 A;  4PSB A;  4QDF A;  3RT2 A;  3QN1 A;  3TVQ A;  2YH6 A;  5BRL A;  4JHH A;  3KDI A;  3NI8 A;  3DLH A;  3KAZ A;  3P0L A;  4C9I A;  2KF2 A;  3KDJ A;  4NCB A;  3HJF A;  3Q63 A;  3H3R A;  4IGV A;  3NQN A;  3GGN A;  2PSO A;  3NR4 A;  2E3M A;  3PUT A;  2RES A;  2REZ A;  3GB4 A;  2LAF A;  3HM9 A;  1LN1 A;  1T17 A;  4C9C A;  4N0G C;  3KL1 A;  4REI A;  2VNE A;  3IE5 A;  1BTV A;  3DLB A;  3OH8 A;  1FM4 A;  3GL0 A;  4Y31 A;  3TGO C;  2Q3Q A;  4QIP A;  4FPW A;  3UID A;  3GKE A;  4A87 A;  3NS2 A;  4A81 A;  2E3Q A;  1T27 A;  3TL1 A;  2Z9Y A;  4JHI A;  4LG5 A;  1XDF A;  2LIO A;  4DSC A;  2LEQ A;  2NN5 A;  2QPV A;  4A8G A;  1ICX A;  2M89 A;  3E85 A;  3ZVU A;  2LF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...