2RERA

Crystal structure of the aromatase/cyclase domain of tcmn from streptomyces glaucescens
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
155
structure length
155
Chain Sequence
b'MAARTDNSIVVNAPFELVWDVTNDIEAWPELFSEYAEAEILRQDGDGFDFRLKTRPDANGRVWEWVSHRVPDKGSRTVRAHRVETGPFAYMNLHWTYRAVAGGTEMRWVQEFDMKPGAPFDNAHMTAHLNTTTRANMERIKKIIEDRHREGQRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multifunctional cyclase-dehydratase-3-O-methyl transferase t
publication title Crystal structure and functional analysis of tetracenomycin ARO/CYC: implications for cyclization specificity of aromatic polyketides.
pubmed doi rcsb
source organism Streptomyces glaucescens
molecule tags Biosynthetic protein
total genus 46
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2rerA00
3IE5A 1LN3A 2L9PA 5E46A 4B9RA 3FO5A 4BKDA 3C0VA 3OQUA 2FLHA 3NMTA 2LCGA 3ZVUA 4A88A 2LUZA 2N4AA 2E3MA 3P51A 2RESA 3Q63A 3KDIA 3KAZA 4A85A 1LN1A 1XDFA 3H3RA 5E4BA 4BTZA 1TXCA 4Z3LA 5JO1A 1FM4A 2E3QA 5AMWA 4C9IA 1UW5A 4A8VA 5E4DA 4IGXA 4Q0KA 3H3QA 4MA6A 4R7KA 4FPWA 3KL1A 1XUVA 3OH8A 3NJ1A 3IJTA 4REHA 3JRQB 1JSSA 4LG5A 3KB3A 4DSBA 1VJHA 4IGVA 3NMPA 4A84A 2LE1A 1Z94A 2IL5A 2VQ5A 4IGWA 2PCSA 3KDHA 5I9JA 4JDAA 4RYVA 3P9VA 3NMVA 4BK7A 4DS8A 2LEQA 2FFSA 3NR4A 4MAPA 4A8GA 1QMRA 4GY9A 2E3OA 3UJLA 4JHGA 3NEFA 3TVRA 4IGYA 4OICA 1B6FA 2LPXA 3K3KA 4LGBA 4A8UA 3KAYA 5JO2A 3H3SA 3NEGA 2Z9ZA 5BRLA 2QIMA 2LDKA 2L8OA 4A86A 4WVOA 3P0LA 3RD6A 2K7HA 1E09A 2LF2A 3KDJA 2K5GA 2KTEA 3NS2A 4JHHA 4BKCA 4JHIA 1BV1A 3K90A 2L65A 2M47A 2A1LA 2Q3QA 3Q6AA 4BK6A 2D4RA 2NS9A 2VNEA 3TL1A 4A80A 2RERA 3RT2A 3PUTA 2I9YA 4IHRA 4LGAA 5C9YA 1ICXA 1XN6A 2KCZA 4M9BA 5I8FA 3UQHA 2E3PA 3KLXA 1TW0A 3F08A 3H3TA 4REJA 1BTVA 4LA7A 2R55A 4A81A 2BK0A 3PU2A 3Q64A 1KCMA 3JRSA 3TVQA 2NN5A 4Y31A 3W9RA 4JDLA 1LLTA 4QIPA 2QPVA 2WQLA 4N3EA 2GKDA 1X53A 3ELIA 4IH0A 2KEWA 4M9WA 3WG8A 1IFVA 4A83A 2LIOA 4REIA 3QSZA 3NMHA 2MOUA 3UIDA 4IH2A 1XN5A 2LAKA 1T27A 4N0GC 4PSBA 1EM2A 1FSKA 2N4BA 3RT0C 1LN2A 2PSOA 3NI8A 2E3NA 3TFZA 3E85A 1T17A 3NJ0A 4XRWA 3NMNA 2EJXA 4C9CA 2KF2A 3KB0A 2Z9YA 3R6PA 5E4MA 1ZXFA 4XRTA 1XFSA 3NJOA 5JNNA 2REZA 3OJIA 1H2OA 2E3SA 3QN1A 2M89A 4MNSA 2E3RA 3GGNA 4A87A 3CNWA 3W9KA 4C94A 2LGHA 4DSCA 3OTLA
chains in the Genus database with same CATH superfamily
3IE5A 1LN3A 2L9PA 5E46A 4B9RA 3FO5A 5EKQC 4BKDA 3C0VA 3OQUA 2FLHA 3NMTA 2LCGA 3ZVUA 4A88A 2LUZA 2N4AA 2E3MA 3P51A 2RESA 3Q63A 3KDIA 3DLHA 3KAZA 4A85A 1LN1A 1XDFA 3H3RA 5E4BA 4BTZA 4N41A 1TXCA 4Z3LA 5JO1A 1FM4A 2E3QA 5AMWA 4C9IA 1UW5A 4A8VA 5E4DA 4IGXA 4Q0KA 3H3QA 4MA6A 4R7KA 4FPWA 3KL1A 1XUVA 3OH8A 3NJ1A 4QCKA 3TGOC 3IJTA 4REHA 3JRQB 1JSSA 4NCBA 4LG5A 3KB3A 3GL2A 4DSBA 1VJHA 4IGVA 3NMPA 4A84A 2LE1A 1Z94A 2IL5A 2VQ5A 4IGWA 2PCSA 3KDHA 5I9JA 4JDAA 4RYVA 3P9VA 3NMVA 4BK7A 4DS8A 2LEQA 2FFSA 3NR4A 3HK2A 4MAPA 4A8GA 1QMRA 4GY9A 4QDDA 2E3OA 3UJLA 4JHGA 3NEFA 3TVRA 3HO1A 4IGYA 4JHYA 4OICA 1B6FA 4QDFB 2LPXA 3K3KA 4LGBA 4A8UA 3NQNA 3KAYA 5JO2A 3H3SA 3NEGA 4KPYA 2Z9ZA 5BRLA 2QIMA 2LDKA 2L8OA 4A86A 4WVOA 3P0LA 3RD6A 2K7HA 1E09A 2LF2A 3KDJA 4QDFA 3GOBA 2K5GA 2KTEA 3GTEA 3NS2A 4JHHA 4N47A 4BKCA 4JHIA 1BV1A 3K90A 2L65A 2M47A 2A1LA 2Q3QA 3Q6AA 4BK6A 2D4RA 3HXMA 2NS9A 2VNEA 3TL1A 4A80A 3HVRA 2RERA 3RT2A 3PUTA 2I9YA 4IHRA 4LGAA 5C9YA 1ICXA 1XN6A 2KCZA 4M9BA 5I8FA 3UQHA 2E3PA 3KLXA 1TW0A 3F08A 3H3TA 4REJA 1BTVA 4LA7A 2R55A 4A81A 3GB4A 3DLBA 4E6FA 2BK0A 3PU2A 3Q64A 1KCMA 3JRSA 3TVQA 2NN5A 4Y31A 3W9RA 4JDLA 1LLTA 4QIPA 2QPVA 2WQLA 4N3EA 2GKDA 2YH6A 1X53A 3ELIA 3GL0A 4IH0A 2KEWA 4M9WA 3WG8A 1IFVA 4A83A 2LIOA 2ZYLA 4REIA 3QSZA 3NMHA 2MOUA 3UIDA 4IH2A 1XN5A 2LAKA 4NCAA 1T27A 4N0GC 4PSBA 1EM2A 1FSKA 3GKEA 2N4BA 3RT0C 4QDCA 3GTSA 1LN2A 2PSOA 3NI8A 2E3NA 3F73A 3TFZA 3E85A 1T17A 3NJ0A 4XRWA 3NMNA 2EJXA 4C9CA 2KF2A 3KB0A 2Z9YA 3R6PA 5E4MA 1ZXFA 3HJFA 4XRTA 1XFSA 3NJOA 5JNNA 2REZA 3OJIA 3HM9A 1H2OA 2E3SA 4N76A 3QN1A 2LAFA 2M89A 4MNSA 2E3RA 3GGNA 4A87A 3CNWA 3W9KA 4C94A 2LGHA 4DSCA 3OTLA
chains in the Genus database with same CATH topology
3IE5A 1LN3A 2L9PA 5E46A 4B9RA 3FO5A 5EKQC 4BKDA 3C0VA 3OQUA 2FLHA 3NMTA 2LCGA 3ZVUA 4A88A 2LUZA 2N4AA 2E3MA 3P51A 2RESA 3Q63A 3KDIA 3DLHA 3KAZA 4A85A 1LN1A 1XDFA 3H3RA 5E4BA 4BTZA 4N41A 1TXCA 4Z3LA 5JO1A 1FM4A 2E3QA 5AMWA 4C9IA 1UW5A 4A8VA 5E4DA 4IGXA 4Q0KA 3H3QA 4MA6A 4R7KA 4FPWA 3KL1A 1XUVA 3OH8A 3NJ1A 4QCKA 3TGOC 3IJTA 4REHA 3JRQB 1JSSA 4NCBA 4LG5A 3KB3A 3GL2A 4DSBA 1VJHA 4IGVA 3NMPA 4A84A 2LE1A 1Z94A 2IL5A 2VQ5A 4IGWA 2PCSA 3KDHA 5I9JA 4JDAA 4RYVA 3P9VA 3NMVA 4BK7A 4DS8A 2LEQA 2FFSA 3NR4A 3HK2A 4MAPA 4A8GA 1QMRA 4GY9A 4QDDA 2E3OA 3UJLA 4JHGA 3NEFA 3TVRA 3HO1A 4IGYA 4JHYA 4OICA 1B6FA 4QDFB 2LPXA 3K3KA 4LGBA 4A8UA 3NQNA 3KAYA 5JO2A 3H3SA 3NEGA 4KPYA 2Z9ZA 5BRLA 2QIMA 2LDKA 2L8OA 4A86A 4WVOA 3P0LA 3RD6A 2K7HA 1E09A 2LF2A 3KDJA 4QDFA 3GOBA 2K5GA 2KTEA 3GTEA 3NS2A 4JHHA 4N47A 4BKCA 4JHIA 1BV1A 3K90A 2L65A 2M47A 2A1LA 2Q3QA 3Q6AA 4BK6A 2D4RA 3HXMA 2NS9A 2VNEA 3TL1A 4A80A 3HVRA 2RERA 3RT2A 3PUTA 2I9YA 4IHRA 4LGAA 5C9YA 1ICXA 1XN6A 2KCZA 4M9BA 5I8FA 3UQHA 2E3PA 3KLXA 1TW0A 3F08A 3H3TA 4REJA 1BTVA 4LA7A 2R55A 4A81A 3GB4A 3DLBA 4E6FA 2BK0A 3PU2A 3Q64A 1KCMA 3JRSA 3TVQA 2NN5A 4Y31A 3W9RA 4JDLA 1LLTA 4QIPA 2QPVA 2WQLA 4N3EA 2GKDA 2YH6A 1X53A 3ELIA 3GL0A 4IH0A 2KEWA 4M9WA 3WG8A 1IFVA 4A83A 2LIOA 2ZYLA 4REIA 3QSZA 3NMHA 2MOUA 3UIDA 4IH2A 1XN5A 2LAKA 4NCAA 1T27A 4N0GC 4PSBA 1EM2A 1FSKA 3GKEA 2N4BA 3RT0C 4QDCA 3GTSA 1LN2A 2PSOA 3NI8A 2E3NA 3F73A 3TFZA 3E85A 1T17A 3NJ0A 4XRWA 3NMNA 2EJXA 4C9CA 2KF2A 3KB0A 2Z9YA 3R6PA 5E4MA 1ZXFA 3HJFA 4XRTA 1XFSA 3NJOA 5JNNA 2REZA 3OJIA 3HM9A 1H2OA 2E3SA 4N76A 3QN1A 2LAFA 2M89A 4MNSA 2E3RA 3GGNA 4A87A 3CNWA 3W9KA 4C94A 2LGHA 4DSCA 3OTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IE5 A;  1LN3 A;  2L9P A;  5E46 A;  4B9R A;  3FO5 A;  4BKD A;  3C0V A;  3OQU A;  2FLH A;  3NMT A;  2LCG A;  3ZVU A;  4A88 A;  2LUZ A;  2N4A A;  2E3M A;  3P51 A;  2RES A;  3Q63 A;  3KDI A;  3KAZ A;  4A85 A;  1LN1 A;  1XDF A;  3H3R A;  5E4B A;  4BTZ A;  1TXC A;  4Z3L A;  5JO1 A;  1FM4 A;  2E3Q A;  5AMW A;  4C9I A;  1UW5 A;  4A8V A;  5E4D A;  4IGX A;  4Q0K A;  3H3Q A;  4MA6 A;  4R7K A;  4FPW A;  3KL1 A;  1XUV A;  3OH8 A;  3NJ1 A;  3IJT A;  4REH A;  3JRQ B;  1JSS A;  4LG5 A;  3KB3 A;  4DSB A;  1VJH A;  4IGV A;  3NMP A;  4A84 A;  2LE1 A;  1Z94 A;  2IL5 A;  2VQ5 A;  4IGW A;  2PCS A;  3KDH A;  5I9J A;  4JDA A;  4RYV A;  3P9V A;  3NMV A;  4BK7 A;  4DS8 A;  2LEQ A;  2FFS A;  3NR4 A;  4MAP A;  4A8G A;  1QMR A;  4GY9 A;  2E3O A;  3UJL A;  4JHG A;  3NEF A;  3TVR A;  4IGY A;  4OIC A;  1B6F A;  2LPX A;  3K3K A;  4LGB A;  4A8U A;  3KAY A;  5JO2 A;  3H3S A;  3NEG A;  2Z9Z A;  5BRL A;  2QIM A;  2LDK A;  2L8O A;  4A86 A;  4WVO A;  3P0L A;  3RD6 A;  2K7H A;  1E09 A;  2LF2 A;  3KDJ A;  2K5G A;  2KTE A;  3NS2 A;  4JHH A;  4BKC A;  4JHI A;  1BV1 A;  3K90 A;  2L65 A;  2M47 A;  2A1L A;  2Q3Q A;  3Q6A A;  4BK6 A;  2D4R A;  2NS9 A;  2VNE A;  3TL1 A;  4A80 A;  2RER A;  3RT2 A;  3PUT A;  2I9Y A;  4IHR A;  4LGA A;  5C9Y A;  1ICX A;  1XN6 A;  2KCZ A;  4M9B A;  5I8F A;  3UQH A;  2E3P A;  3KLX A;  1TW0 A;  3F08 A;  3H3T A;  4REJ A;  1BTV A;  4LA7 A;  2R55 A;  4A81 A;  2BK0 A;  3PU2 A;  3Q64 A;  1KCM A;  3JRS A;  3TVQ A;  2NN5 A;  4Y31 A;  3W9R A;  4JDL A;  1LLT A;  4QIP A;  2QPV A;  2WQL A;  4N3E A;  2GKD A;  1X53 A;  3ELI A;  4IH0 A;  2KEW A;  4M9W A;  3WG8 A;  1IFV A;  4A83 A;  2LIO A;  4REI A;  3QSZ A;  3NMH A;  2MOU A;  3UID A;  4IH2 A;  1XN5 A;  2LAK A;  1T27 A;  4N0G C;  4PSB A;  1EM2 A;  1FSK A;  2N4B A;  3RT0 C;  1LN2 A;  2PSO A;  3NI8 A;  2E3N A;  3TFZ A;  3E85 A;  1T17 A;  3NJ0 A;  4XRW A;  3NMN A;  2EJX A;  4C9C A;  2KF2 A;  3KB0 A;  2Z9Y A;  3R6P A;  5E4M A;  1ZXF A;  4XRT A;  1XFS A;  3NJO A;  5JNN A;  2REZ A;  3OJI A;  1H2O A;  2E3S A;  3QN1 A;  2M89 A;  4MNS A;  2E3R A;  3GGN A;  4A87 A;  3CNW A;  3W9K A;  4C94 A;  2LGH A;  4DSC A;  3OTL A; 
#chains in the Genus database with same CATH topology
 3IE5 A;  1LN3 A;  2L9P A;  5E46 A;  4B9R A;  3FO5 A;  5EKQ C;  4BKD A;  3C0V A;  3OQU A;  2FLH A;  3NMT A;  2LCG A;  3ZVU A;  4A88 A;  2LUZ A;  2N4A A;  2E3M A;  3P51 A;  2RES A;  3Q63 A;  3KDI A;  3DLH A;  3KAZ A;  4A85 A;  1LN1 A;  1XDF A;  3H3R A;  5E4B A;  4BTZ A;  4N41 A;  1TXC A;  4Z3L A;  5JO1 A;  1FM4 A;  2E3Q A;  5AMW A;  4C9I A;  1UW5 A;  4A8V A;  5E4D A;  4IGX A;  4Q0K A;  3H3Q A;  4MA6 A;  4R7K A;  4FPW A;  3KL1 A;  1XUV A;  3OH8 A;  3NJ1 A;  4QCK A;  3TGO C;  3IJT A;  4REH A;  3JRQ B;  1JSS A;  4NCB A;  4LG5 A;  3KB3 A;  3GL2 A;  4DSB A;  1VJH A;  4IGV A;  3NMP A;  4A84 A;  2LE1 A;  1Z94 A;  2IL5 A;  2VQ5 A;  4IGW A;  2PCS A;  3KDH A;  5I9J A;  4JDA A;  4RYV A;  3P9V A;  3NMV A;  4BK7 A;  4DS8 A;  2LEQ A;  2FFS A;  3NR4 A;  3HK2 A;  4MAP A;  4A8G A;  1QMR A;  4GY9 A;  4QDD A;  2E3O A;  3UJL A;  4JHG A;  3NEF A;  3TVR A;  3HO1 A;  4IGY A;  4JHY A;  4OIC A;  1B6F A;  4QDF B;  2LPX A;  3K3K A;  4LGB A;  4A8U A;  3NQN A;  3KAY A;  5JO2 A;  3H3S A;  3NEG A;  4KPY A;  2Z9Z A;  5BRL A;  2QIM A;  2LDK A;  2L8O A;  4A86 A;  4WVO A;  3P0L A;  3RD6 A;  2K7H A;  1E09 A;  2LF2 A;  3KDJ A;  4QDF A;  3GOB A;  2K5G A;  2KTE A;  3GTE A;  3NS2 A;  4JHH A;  4N47 A;  4BKC A;  4JHI A;  1BV1 A;  3K90 A;  2L65 A;  2M47 A;  2A1L A;  2Q3Q A;  3Q6A A;  4BK6 A;  2D4R A;  3HXM A;  2NS9 A;  2VNE A;  3TL1 A;  4A80 A;  3HVR A;  2RER A;  3RT2 A;  3PUT A;  2I9Y A;  4IHR A;  4LGA A;  5C9Y A;  1ICX A;  1XN6 A;  2KCZ A;  4M9B A;  5I8F A;  3UQH A;  2E3P A;  3KLX A;  1TW0 A;  3F08 A;  3H3T A;  4REJ A;  1BTV A;  4LA7 A;  2R55 A;  4A81 A;  3GB4 A;  3DLB A;  4E6F A;  2BK0 A;  3PU2 A;  3Q64 A;  1KCM A;  3JRS A;  3TVQ A;  2NN5 A;  4Y31 A;  3W9R A;  4JDL A;  1LLT A;  4QIP A;  2QPV A;  2WQL A;  4N3E A;  2GKD A;  2YH6 A;  1X53 A;  3ELI A;  3GL0 A;  4IH0 A;  2KEW A;  4M9W A;  3WG8 A;  1IFV A;  4A83 A;  2LIO A;  2ZYL A;  4REI A;  3QSZ A;  3NMH A;  2MOU A;  3UID A;  4IH2 A;  1XN5 A;  2LAK A;  4NCA A;  1T27 A;  4N0G C;  4PSB A;  1EM2 A;  1FSK A;  3GKE A;  2N4B A;  3RT0 C;  4QDC A;  3GTS A;  1LN2 A;  2PSO A;  3NI8 A;  2E3N A;  3F73 A;  3TFZ A;  3E85 A;  1T17 A;  3NJ0 A;  4XRW A;  3NMN A;  2EJX A;  4C9C A;  2KF2 A;  3KB0 A;  2Z9Y A;  3R6P A;  5E4M A;  1ZXF A;  3HJF A;  4XRT A;  1XFS A;  3NJO A;  5JNN A;  2REZ A;  3OJI A;  3HM9 A;  1H2O A;  2E3S A;  4N76 A;  3QN1 A;  2LAF A;  2M89 A;  4MNS A;  2E3R A;  3GGN A;  4A87 A;  3CNW A;  3W9K A;  4C94 A;  2LGH A;  4DSC A;  3OTL A; 
#chains in the Genus database with same CATH homology
 3IE5 A;  1LN3 A;  2L9P A;  5E46 A;  4B9R A;  3FO5 A;  5EKQ C;  4BKD A;  3C0V A;  3OQU A;  2FLH A;  3NMT A;  2LCG A;  3ZVU A;  4A88 A;  2LUZ A;  2N4A A;  2E3M A;  3P51 A;  2RES A;  3Q63 A;  3KDI A;  3DLH A;  3KAZ A;  4A85 A;  1LN1 A;  1XDF A;  3H3R A;  5E4B A;  4BTZ A;  4N41 A;  1TXC A;  4Z3L A;  5JO1 A;  1FM4 A;  2E3Q A;  5AMW A;  4C9I A;  1UW5 A;  4A8V A;  5E4D A;  4IGX A;  4Q0K A;  3H3Q A;  4MA6 A;  4R7K A;  4FPW A;  3KL1 A;  1XUV A;  3OH8 A;  3NJ1 A;  4QCK A;  3TGO C;  3IJT A;  4REH A;  3JRQ B;  1JSS A;  4NCB A;  4LG5 A;  3KB3 A;  3GL2 A;  4DSB A;  1VJH A;  4IGV A;  3NMP A;  4A84 A;  2LE1 A;  1Z94 A;  2IL5 A;  2VQ5 A;  4IGW A;  2PCS A;  3KDH A;  5I9J A;  4JDA A;  4RYV A;  3P9V A;  3NMV A;  4BK7 A;  4DS8 A;  2LEQ A;  2FFS A;  3NR4 A;  3HK2 A;  4MAP A;  4A8G A;  1QMR A;  4GY9 A;  4QDD A;  2E3O A;  3UJL A;  4JHG A;  3NEF A;  3TVR A;  3HO1 A;  4IGY A;  4JHY A;  4OIC A;  1B6F A;  4QDF B;  2LPX A;  3K3K A;  4LGB A;  4A8U A;  3NQN A;  3KAY A;  5JO2 A;  3H3S A;  3NEG A;  4KPY A;  2Z9Z A;  5BRL A;  2QIM A;  2LDK A;  2L8O A;  4A86 A;  4WVO A;  3P0L A;  3RD6 A;  2K7H A;  1E09 A;  2LF2 A;  3KDJ A;  4QDF A;  3GOB A;  2K5G A;  2KTE A;  3GTE A;  3NS2 A;  4JHH A;  4N47 A;  4BKC A;  4JHI A;  1BV1 A;  3K90 A;  2L65 A;  2M47 A;  2A1L A;  2Q3Q A;  3Q6A A;  4BK6 A;  2D4R A;  3HXM A;  2NS9 A;  2VNE A;  3TL1 A;  4A80 A;  3HVR A;  2RER A;  3RT2 A;  3PUT A;  2I9Y A;  4IHR A;  4LGA A;  5C9Y A;  1ICX A;  1XN6 A;  2KCZ A;  4M9B A;  5I8F A;  3UQH A;  2E3P A;  3KLX A;  1TW0 A;  3F08 A;  3H3T A;  4REJ A;  1BTV A;  4LA7 A;  2R55 A;  4A81 A;  3GB4 A;  3DLB A;  4E6F A;  2BK0 A;  3PU2 A;  3Q64 A;  1KCM A;  3JRS A;  3TVQ A;  2NN5 A;  4Y31 A;  3W9R A;  4JDL A;  1LLT A;  4QIP A;  2QPV A;  2WQL A;  4N3E A;  2GKD A;  2YH6 A;  1X53 A;  3ELI A;  3GL0 A;  4IH0 A;  2KEW A;  4M9W A;  3WG8 A;  1IFV A;  4A83 A;  2LIO A;  2ZYL A;  4REI A;  3QSZ A;  3NMH A;  2MOU A;  3UID A;  4IH2 A;  1XN5 A;  2LAK A;  4NCA A;  1T27 A;  4N0G C;  4PSB A;  1EM2 A;  1FSK A;  3GKE A;  2N4B A;  3RT0 C;  4QDC A;  3GTS A;  1LN2 A;  2PSO A;  3NI8 A;  2E3N A;  3F73 A;  3TFZ A;  3E85 A;  1T17 A;  3NJ0 A;  4XRW A;  3NMN A;  2EJX A;  4C9C A;  2KF2 A;  3KB0 A;  2Z9Y A;  3R6P A;  5E4M A;  1ZXF A;  3HJF A;  4XRT A;  1XFS A;  3NJO A;  5JNN A;  2REZ A;  3OJI A;  3HM9 A;  1H2O A;  2E3S A;  4N76 A;  3QN1 A;  2LAF A;  2M89 A;  4MNS A;  2E3R A;  3GGN A;  4A87 A;  3CNW A;  3W9K A;  4C94 A;  2LGH A;  4DSC A;  3OTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...