3NJ1A

X-ray crystal structure of the pyl2(v114i)-pyrabactin a complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
182
Chain Sequence
KGLTDEEQKTLEPVIKTYHQFEPDPTTCTSLITQRIHAPASVVWPLIRRFDNPERYKHFVKRCRLISGDGDVGSVREVTVISGLPASTSTERLEFVDDDHRVLSFRIVGGEHRLKNYKSVTSVNEFLNQDSGKVYTVVLESYTVDIPEGNTEEDTKMFVDTVVKLNLQKLGVAATSAPMHDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL2
publication title Structural basis for selective activation of ABA receptors.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone receptor
total genus 50
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2010-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3nj1A00
4BKDA 4IH2A 3PUTA 4BK6A 4REHA 5AMWA 2LUZA 2REZA 3NR4A 2Z9ZA 4IGYA 1IFVA 4WVOA 4GY9A 5I8FA 1BTVA 3Q6AA 3NJOA 3PU2A 3F08A 4DSCA 2KCZA 2LGHA 3IE5A 3NEGA 3K3KA 4N0GC 4N3EA 4M9BA 2GKDA 2LCGA 5C9YA 3R6PA 2FLHA 2WQLA 5E4MA 5JNNA 1H2OA 3QSZA 3JRSA 5JO2A 1UW5A 3C0VA 3TVQA 4JHGA 4LA7A 4R7KA 2LE1A 4A84A 4DSBA 4REIA 1B6FA 3CNWA 3H3RA 4BTZA 4MAPA 2E3QA 1XN5A 2RERA 2E3OA 3QN1A 1LN2A 1VJHA 2KF2A 2E3SA 3Q63A 4BK7A 3KDHA 3RD6A 1ICXA 2PSOA 2E3PA 1E09A 3RT0C 3RT2A 4MNSA 3UJLA 2I9YA 3KLXA 1QMRA 4PSBA 5E4BA 4A8GA 2E3RA 1FM4A 3TFZA 1BV1A 4XRWA 5E4DA 3NMTA 4QIPA 3UQHA 2L9PA 4Q0KA 2K7HA 1KCMA 4BKCA 2E3MA 2FFSA 4LG5A 3IJTA 3NMHA 3NS2A 4A86A 3TL1A 1XN6A 2VQ5A 3KB3A 3NJ0A 3P9VA 3FO5A 4A83A 4REJA 2N4AA 2R55A 4Z3LA 3E85A 2LAKA 2M89A 3K90A 3P51A 3ELIA 2A1LA 3H3QA 2E3NA 4Y31A 1JSSA 3KAZA 1TW0A 1ZXFA 2K5GA 2NN5A 4A8VA 4IHRA 1XUVA 3NMNA 2LF2A 3ZVUA 1XDFA 4A80A 4JHIA 2LIOA 4MA6A 5BRLA 4LGBA 2N4BA 4IH0A 1X53A 4JDAA 2PCSA 4IGVA 4C94A 3W9RA 3OQUA 4DS8A 3JRQB 3NMVA 1FSKA 3GGNA 3H3SA 3OH8A 3H3TA 1LLTA 2L8OA 4IGWA 2QIMA 4IGXA 1XFSA 2EJXA 3W9KA 4A87A 1T17A 3KDJA 3P0LA 4XRTA 2NS9A 4A81A 2VNEA 3NI8A 1T27A 2LPXA 4B9RA 4OICA 2L65A 3KDIA 2LDKA 3OTLA 4C9IA 1LN1A 2KTEA 3KB0A 3NEFA 2IL5A 4M9WA 2M47A 5E46A 4RYVA 4JDLA 2LEQA 4A88A 4JHHA 3TVRA 2Z9YA 3KL1A 3OJIA 4LGAA 5I9JA 1Z94A 3WG8A 4C9CA 2MOUA 1EM2A 1LN3A 2Q3QA 3KAYA 2RESA 1TXCA 4A85A 3Q64A 3UIDA 2BK0A 3NJ1A 3NMPA 4FPWA 5JO1A 2D4RA 4A8UA 2QPVA 2KEWA
chains in the Genus database with same CATH superfamily
4BKDA 4IH2A 3PUTA 4BK6A 3HJFA 4REHA 5AMWA 3TGOC 2LUZA 2REZA 3NR4A 2Z9ZA 3NQNA 1IFVA 4IGYA 4GY9A 4WVOA 5I8FA 1BTVA 3Q6AA 3NJOA 3PU2A 3F08A 4DSCA 2KCZA 2LGHA 3IE5A 3NEGA 3K3KA 4N0GC 4N3EA 4M9BA 2GKDA 2LCGA 5C9YA 3R6PA 3HK2A 2FLHA 2WQLA 5E4MA 5JNNA 1H2OA 3QSZA 3JRSA 5JO2A 1UW5A 3C0VA 4JHYA 3TVQA 3HM9A 4JHGA 4LA7A 4R7KA 2LE1A 4A84A 4DSBA 4REIA 3F73A 1B6FA 3CNWA 3H3RA 4BTZA 4MAPA 2E3QA 1XN5A 3HVRA 4NCAA 2RERA 2E3OA 3QN1A 1LN2A 1VJHA 2KF2A 4E6FA 4QDCA 2E3SA 3Q63A 4BK7A 3KDHA 3RD6A 1ICXA 2PSOA 2E3PA 1E09A 3RT0C 3RT2A 4MNSA 3UJLA 2I9YA 3KLXA 1QMRA 4PSBA 3GL2A 5E4BA 2LAFA 4A8GA 2E3RA 1FM4A 3TFZA 1BV1A 4XRWA 5E4DA 3NMTA 4QIPA 4QDFA 3UQHA 2L9PA 5EKQC 4Q0KA 2K7HA 4QDFB 1KCMA 4BKCA 2E3MA 2FFSA 4LG5A 3GOBA 3IJTA 3NMHA 3NS2A 4A86A 3TL1A 1XN6A 2VQ5A 3KB3A 3NJ0A 3P9VA 3FO5A 4A83A 4N41A 3GL0A 4REJA 2N4AA 2R55A 4KPYA 4Z3LA 2YH6A 3E85A 2LAKA 2M89A 3K90A 3P51A 3ELIA 2A1LA 3H3QA 2E3NA 4Y31A 1JSSA 3GKEA 3KAZA 1TW0A 1ZXFA 2K5GA 2NN5A 4A8VA 4NCBA 4IHRA 1XUVA 3NMNA 2LF2A 3ZVUA 1XDFA 4QCKA 4A80A 4JHIA 2LIOA 4MA6A 3DLBA 5BRLA 4N76A 4LGBA 2N4BA 4IH0A 1X53A 4JDAA 2PCSA 4IGVA 4C94A 3W9RA 3OQUA 4DS8A 3JRQB 4N47A 3NMVA 1FSKA 3GGNA 3H3SA 3GTSA 2ZYLA 3OH8A 3HXMA 3H3TA 1LLTA 2L8OA 4IGWA 2QIMA 4IGXA 1XFSA 2EJXA 3W9KA 4A87A 1T17A 3KDJA 3P0LA 4XRTA 2NS9A 4A81A 2VNEA 3NI8A 1T27A 2LPXA 4B9RA 4OICA 2L65A 3KDIA 2LDKA 3OTLA 4C9IA 1LN1A 3HO1A 2KTEA 3KB0A 3NEFA 2IL5A 3GTEA 2M47A 4M9WA 5E46A 4RYVA 4JDLA 2LEQA 4QDDA 4A88A 4JHHA 3TVRA 2Z9YA 3KL1A 3OJIA 4LGAA 3DLHA 5I9JA 1Z94A 3WG8A 4C9CA 2MOUA 1EM2A 3GB4A 1LN3A 2Q3QA 3KAYA 2RESA 1TXCA 4A85A 3Q64A 3UIDA 2BK0A 3NJ1A 3NMPA 4FPWA 5JO1A 2D4RA 4A8UA 2QPVA 2KEWA
chains in the Genus database with same CATH topology
4BKDA 4IH2A 3PUTA 4BK6A 3HJFA 4REHA 5AMWA 3TGOC 2LUZA 2REZA 3NR4A 2Z9ZA 3NQNA 1IFVA 4IGYA 4GY9A 4WVOA 5I8FA 1BTVA 3Q6AA 3NJOA 3PU2A 3F08A 4DSCA 2KCZA 2LGHA 3IE5A 3NEGA 3K3KA 4N0GC 4N3EA 4M9BA 2GKDA 2LCGA 5C9YA 3R6PA 3HK2A 2FLHA 2WQLA 5E4MA 5JNNA 1H2OA 3QSZA 3JRSA 5JO2A 1UW5A 3C0VA 4JHYA 3TVQA 3HM9A 4JHGA 4LA7A 4R7KA 2LE1A 4A84A 4DSBA 4REIA 3F73A 1B6FA 3CNWA 3H3RA 4BTZA 4MAPA 2E3QA 1XN5A 3HVRA 4NCAA 2RERA 2E3OA 3QN1A 1LN2A 1VJHA 2KF2A 4E6FA 4QDCA 2E3SA 3Q63A 4BK7A 3KDHA 3RD6A 1ICXA 2PSOA 2E3PA 1E09A 3RT0C 3RT2A 4MNSA 3UJLA 2I9YA 3KLXA 1QMRA 4PSBA 3GL2A 5E4BA 2LAFA 4A8GA 2E3RA 1FM4A 3TFZA 1BV1A 4XRWA 5E4DA 3NMTA 4QIPA 4QDFA 3UQHA 2L9PA 5EKQC 4Q0KA 2K7HA 4QDFB 1KCMA 4BKCA 2E3MA 2FFSA 4LG5A 3GOBA 3IJTA 3NMHA 3NS2A 4A86A 3TL1A 1XN6A 2VQ5A 3KB3A 3NJ0A 3P9VA 3FO5A 4A83A 4N41A 3GL0A 4REJA 2N4AA 2R55A 4KPYA 4Z3LA 2YH6A 3E85A 2LAKA 2M89A 3K90A 3P51A 3ELIA 2A1LA 3H3QA 2E3NA 4Y31A 1JSSA 3GKEA 3KAZA 1TW0A 1ZXFA 2K5GA 2NN5A 4A8VA 4NCBA 4IHRA 1XUVA 3NMNA 2LF2A 3ZVUA 1XDFA 4QCKA 4A80A 4JHIA 2LIOA 4MA6A 3DLBA 5BRLA 4N76A 4LGBA 2N4BA 4IH0A 1X53A 4JDAA 2PCSA 4IGVA 4C94A 3W9RA 3OQUA 4DS8A 3JRQB 4N47A 3NMVA 1FSKA 3GGNA 3H3SA 3GTSA 2ZYLA 3OH8A 3HXMA 3H3TA 1LLTA 2L8OA 4IGWA 2QIMA 4IGXA 1XFSA 2EJXA 3W9KA 4A87A 1T17A 3KDJA 3P0LA 4XRTA 2NS9A 4A81A 2VNEA 3NI8A 1T27A 2LPXA 4B9RA 4OICA 2L65A 3KDIA 2LDKA 3OTLA 4C9IA 1LN1A 3HO1A 2KTEA 3KB0A 3NEFA 2IL5A 3GTEA 2M47A 4M9WA 5E46A 4RYVA 4JDLA 2LEQA 4QDDA 4A88A 4JHHA 3TVRA 2Z9YA 3KL1A 3OJIA 4LGAA 3DLHA 5I9JA 1Z94A 3WG8A 4C9CA 2MOUA 1EM2A 3GB4A 1LN3A 2Q3QA 3KAYA 2RESA 1TXCA 4A85A 3Q64A 3UIDA 2BK0A 3NJ1A 3NMPA 4FPWA 5JO1A 2D4RA 4A8UA 2QPVA 2KEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BKD A;  4IH2 A;  3PUT A;  4BK6 A;  4REH A;  5AMW A;  2LUZ A;  2REZ A;  3NR4 A;  2Z9Z A;  4IGY A;  1IFV A;  4WVO A;  4GY9 A;  5I8F A;  1BTV A;  3Q6A A;  3NJO A;  3PU2 A;  3F08 A;  4DSC A;  2KCZ A;  2LGH A;  3IE5 A;  3NEG A;  3K3K A;  4N0G C;  4N3E A;  4M9B A;  2GKD A;  2LCG A;  5C9Y A;  3R6P A;  2FLH A;  2WQL A;  5E4M A;  5JNN A;  1H2O A;  3QSZ A;  3JRS A;  5JO2 A;  1UW5 A;  3C0V A;  3TVQ A;  4JHG A;  4LA7 A;  4R7K A;  2LE1 A;  4A84 A;  4DSB A;  4REI A;  1B6F A;  3CNW A;  3H3R A;  4BTZ A;  4MAP A;  2E3Q A;  1XN5 A;  2RER A;  2E3O A;  3QN1 A;  1LN2 A;  1VJH A;  2KF2 A;  2E3S A;  3Q63 A;  4BK7 A;  3KDH A;  3RD6 A;  1ICX A;  2PSO A;  2E3P A;  1E09 A;  3RT0 C;  3RT2 A;  4MNS A;  3UJL A;  2I9Y A;  3KLX A;  1QMR A;  4PSB A;  5E4B A;  4A8G A;  2E3R A;  1FM4 A;  3TFZ A;  1BV1 A;  4XRW A;  5E4D A;  3NMT A;  4QIP A;  3UQH A;  2L9P A;  4Q0K A;  2K7H A;  1KCM A;  4BKC A;  2E3M A;  2FFS A;  4LG5 A;  3IJT A;  3NMH A;  3NS2 A;  4A86 A;  3TL1 A;  1XN6 A;  2VQ5 A;  3KB3 A;  3NJ0 A;  3P9V A;  3FO5 A;  4A83 A;  4REJ A;  2N4A A;  2R55 A;  4Z3L A;  3E85 A;  2LAK A;  2M89 A;  3K90 A;  3P51 A;  3ELI A;  2A1L A;  3H3Q A;  2E3N A;  4Y31 A;  1JSS A;  3KAZ A;  1TW0 A;  1ZXF A;  2K5G A;  2NN5 A;  4A8V A;  4IHR A;  1XUV A;  3NMN A;  2LF2 A;  3ZVU A;  1XDF A;  4A80 A;  4JHI A;  2LIO A;  4MA6 A;  5BRL A;  4LGB A;  2N4B A;  4IH0 A;  1X53 A;  4JDA A;  2PCS A;  4IGV A;  4C94 A;  3W9R A;  3OQU A;  4DS8 A;  3JRQ B;  3NMV A;  1FSK A;  3GGN A;  3H3S A;  3OH8 A;  3H3T A;  1LLT A;  2L8O A;  4IGW A;  2QIM A;  4IGX A;  1XFS A;  2EJX A;  3W9K A;  4A87 A;  1T17 A;  3KDJ A;  3P0L A;  4XRT A;  2NS9 A;  4A81 A;  2VNE A;  3NI8 A;  1T27 A;  2LPX A;  4B9R A;  4OIC A;  2L65 A;  3KDI A;  2LDK A;  3OTL A;  4C9I A;  1LN1 A;  2KTE A;  3KB0 A;  3NEF A;  2IL5 A;  4M9W A;  2M47 A;  5E46 A;  4RYV A;  4JDL A;  2LEQ A;  4A88 A;  4JHH A;  3TVR A;  2Z9Y A;  3KL1 A;  3OJI A;  4LGA A;  5I9J A;  1Z94 A;  3WG8 A;  4C9C A;  2MOU A;  1EM2 A;  1LN3 A;  2Q3Q A;  3KAY A;  2RES A;  1TXC A;  4A85 A;  3Q64 A;  3UID A;  2BK0 A;  3NJ1 A;  3NMP A;  4FPW A;  5JO1 A;  2D4R A;  4A8U A;  2QPV A;  2KEW A; 
#chains in the Genus database with same CATH topology
 4BKD A;  4IH2 A;  3PUT A;  4BK6 A;  3HJF A;  4REH A;  5AMW A;  3TGO C;  2LUZ A;  2REZ A;  3NR4 A;  2Z9Z A;  3NQN A;  1IFV A;  4IGY A;  4GY9 A;  4WVO A;  5I8F A;  1BTV A;  3Q6A A;  3NJO A;  3PU2 A;  3F08 A;  4DSC A;  2KCZ A;  2LGH A;  3IE5 A;  3NEG A;  3K3K A;  4N0G C;  4N3E A;  4M9B A;  2GKD A;  2LCG A;  5C9Y A;  3R6P A;  3HK2 A;  2FLH A;  2WQL A;  5E4M A;  5JNN A;  1H2O A;  3QSZ A;  3JRS A;  5JO2 A;  1UW5 A;  3C0V A;  4JHY A;  3TVQ A;  3HM9 A;  4JHG A;  4LA7 A;  4R7K A;  2LE1 A;  4A84 A;  4DSB A;  4REI A;  3F73 A;  1B6F A;  3CNW A;  3H3R A;  4BTZ A;  4MAP A;  2E3Q A;  1XN5 A;  3HVR A;  4NCA A;  2RER A;  2E3O A;  3QN1 A;  1LN2 A;  1VJH A;  2KF2 A;  4E6F A;  4QDC A;  2E3S A;  3Q63 A;  4BK7 A;  3KDH A;  3RD6 A;  1ICX A;  2PSO A;  2E3P A;  1E09 A;  3RT0 C;  3RT2 A;  4MNS A;  3UJL A;  2I9Y A;  3KLX A;  1QMR A;  4PSB A;  3GL2 A;  5E4B A;  2LAF A;  4A8G A;  2E3R A;  1FM4 A;  3TFZ A;  1BV1 A;  4XRW A;  5E4D A;  3NMT A;  4QIP A;  4QDF A;  3UQH A;  2L9P A;  5EKQ C;  4Q0K A;  2K7H A;  4QDF B;  1KCM A;  4BKC A;  2E3M A;  2FFS A;  4LG5 A;  3GOB A;  3IJT A;  3NMH A;  3NS2 A;  4A86 A;  3TL1 A;  1XN6 A;  2VQ5 A;  3KB3 A;  3NJ0 A;  3P9V A;  3FO5 A;  4A83 A;  4N41 A;  3GL0 A;  4REJ A;  2N4A A;  2R55 A;  4KPY A;  4Z3L A;  2YH6 A;  3E85 A;  2LAK A;  2M89 A;  3K90 A;  3P51 A;  3ELI A;  2A1L A;  3H3Q A;  2E3N A;  4Y31 A;  1JSS A;  3GKE A;  3KAZ A;  1TW0 A;  1ZXF A;  2K5G A;  2NN5 A;  4A8V A;  4NCB A;  4IHR A;  1XUV A;  3NMN A;  2LF2 A;  3ZVU A;  1XDF A;  4QCK A;  4A80 A;  4JHI A;  2LIO A;  4MA6 A;  3DLB A;  5BRL A;  4N76 A;  4LGB A;  2N4B A;  4IH0 A;  1X53 A;  4JDA A;  2PCS A;  4IGV A;  4C94 A;  3W9R A;  3OQU A;  4DS8 A;  3JRQ B;  4N47 A;  3NMV A;  1FSK A;  3GGN A;  3H3S A;  3GTS A;  2ZYL A;  3OH8 A;  3HXM A;  3H3T A;  1LLT A;  2L8O A;  4IGW A;  2QIM A;  4IGX A;  1XFS A;  2EJX A;  3W9K A;  4A87 A;  1T17 A;  3KDJ A;  3P0L A;  4XRT A;  2NS9 A;  4A81 A;  2VNE A;  3NI8 A;  1T27 A;  2LPX A;  4B9R A;  4OIC A;  2L65 A;  3KDI A;  2LDK A;  3OTL A;  4C9I A;  1LN1 A;  3HO1 A;  2KTE A;  3KB0 A;  3NEF A;  2IL5 A;  3GTE A;  2M47 A;  4M9W A;  5E46 A;  4RYV A;  4JDL A;  2LEQ A;  4QDD A;  4A88 A;  4JHH A;  3TVR A;  2Z9Y A;  3KL1 A;  3OJI A;  4LGA A;  3DLH A;  5I9J A;  1Z94 A;  3WG8 A;  4C9C A;  2MOU A;  1EM2 A;  3GB4 A;  1LN3 A;  2Q3Q A;  3KAY A;  2RES A;  1TXC A;  4A85 A;  3Q64 A;  3UID A;  2BK0 A;  3NJ1 A;  3NMP A;  4FPW A;  5JO1 A;  2D4R A;  4A8U A;  2QPV A;  2KEW A; 
#chains in the Genus database with same CATH homology
 4BKD A;  4IH2 A;  3PUT A;  4BK6 A;  3HJF A;  4REH A;  5AMW A;  3TGO C;  2LUZ A;  2REZ A;  3NR4 A;  2Z9Z A;  3NQN A;  1IFV A;  4IGY A;  4GY9 A;  4WVO A;  5I8F A;  1BTV A;  3Q6A A;  3NJO A;  3PU2 A;  3F08 A;  4DSC A;  2KCZ A;  2LGH A;  3IE5 A;  3NEG A;  3K3K A;  4N0G C;  4N3E A;  4M9B A;  2GKD A;  2LCG A;  5C9Y A;  3R6P A;  3HK2 A;  2FLH A;  2WQL A;  5E4M A;  5JNN A;  1H2O A;  3QSZ A;  3JRS A;  5JO2 A;  1UW5 A;  3C0V A;  4JHY A;  3TVQ A;  3HM9 A;  4JHG A;  4LA7 A;  4R7K A;  2LE1 A;  4A84 A;  4DSB A;  4REI A;  3F73 A;  1B6F A;  3CNW A;  3H3R A;  4BTZ A;  4MAP A;  2E3Q A;  1XN5 A;  3HVR A;  4NCA A;  2RER A;  2E3O A;  3QN1 A;  1LN2 A;  1VJH A;  2KF2 A;  4E6F A;  4QDC A;  2E3S A;  3Q63 A;  4BK7 A;  3KDH A;  3RD6 A;  1ICX A;  2PSO A;  2E3P A;  1E09 A;  3RT0 C;  3RT2 A;  4MNS A;  3UJL A;  2I9Y A;  3KLX A;  1QMR A;  4PSB A;  3GL2 A;  5E4B A;  2LAF A;  4A8G A;  2E3R A;  1FM4 A;  3TFZ A;  1BV1 A;  4XRW A;  5E4D A;  3NMT A;  4QIP A;  4QDF A;  3UQH A;  2L9P A;  5EKQ C;  4Q0K A;  2K7H A;  4QDF B;  1KCM A;  4BKC A;  2E3M A;  2FFS A;  4LG5 A;  3GOB A;  3IJT A;  3NMH A;  3NS2 A;  4A86 A;  3TL1 A;  1XN6 A;  2VQ5 A;  3KB3 A;  3NJ0 A;  3P9V A;  3FO5 A;  4A83 A;  4N41 A;  3GL0 A;  4REJ A;  2N4A A;  2R55 A;  4KPY A;  4Z3L A;  2YH6 A;  3E85 A;  2LAK A;  2M89 A;  3K90 A;  3P51 A;  3ELI A;  2A1L A;  3H3Q A;  2E3N A;  4Y31 A;  1JSS A;  3GKE A;  3KAZ A;  1TW0 A;  1ZXF A;  2K5G A;  2NN5 A;  4A8V A;  4NCB A;  4IHR A;  1XUV A;  3NMN A;  2LF2 A;  3ZVU A;  1XDF A;  4QCK A;  4A80 A;  4JHI A;  2LIO A;  4MA6 A;  3DLB A;  5BRL A;  4N76 A;  4LGB A;  2N4B A;  4IH0 A;  1X53 A;  4JDA A;  2PCS A;  4IGV A;  4C94 A;  3W9R A;  3OQU A;  4DS8 A;  3JRQ B;  4N47 A;  3NMV A;  1FSK A;  3GGN A;  3H3S A;  3GTS A;  2ZYL A;  3OH8 A;  3HXM A;  3H3T A;  1LLT A;  2L8O A;  4IGW A;  2QIM A;  4IGX A;  1XFS A;  2EJX A;  3W9K A;  4A87 A;  1T17 A;  3KDJ A;  3P0L A;  4XRT A;  2NS9 A;  4A81 A;  2VNE A;  3NI8 A;  1T27 A;  2LPX A;  4B9R A;  4OIC A;  2L65 A;  3KDI A;  2LDK A;  3OTL A;  4C9I A;  1LN1 A;  3HO1 A;  2KTE A;  3KB0 A;  3NEF A;  2IL5 A;  3GTE A;  2M47 A;  4M9W A;  5E46 A;  4RYV A;  4JDL A;  2LEQ A;  4QDD A;  4A88 A;  4JHH A;  3TVR A;  2Z9Y A;  3KL1 A;  3OJI A;  4LGA A;  3DLH A;  5I9J A;  1Z94 A;  3WG8 A;  4C9C A;  2MOU A;  1EM2 A;  3GB4 A;  1LN3 A;  2Q3Q A;  3KAY A;  2RES A;  1TXC A;  4A85 A;  3Q64 A;  3UID A;  2BK0 A;  3NJ1 A;  3NMP A;  4FPW A;  5JO1 A;  2D4R A;  4A8U A;  2QPV A;  2KEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...