4JHIA

Crystal structure of medicago truncatula nodulin 13 (mtn13) in complex with n6-benzyladenine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
162
Chain Sequence
DPFTMGVITSESEYVSSLSAEKLYRGIVEDGNIIYPKALPRFIEKAETLEGDGGPGTIKKLTFVGDFGSTKQHIDMVDRENCAYTYSVYEGIALSDQPLEKIVFEFKLVPTPEEGCIVKSTTKYYTKGDDIELSKDYLEAGIERFEGFTKAVESFLLANPDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MtN13 protein
publication title The landscape of cytokinin binding by a plant nodulin.
pubmed doi rcsb
source organism Medicago truncatula
molecule tags Plant protein
total genus 39
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4jhiA00
4JDAA 4LA7A 3UIDA 1JSSA 2FFSA 4QIPA 2M89A 2Z9ZA 4IGYA 1LN3A 3OQUA 4MNSA 4REHA 5JO1A 2VQ5A 3NEFA 3P0LA 4XRWA 3IE5A 1EM2A 4Y31A 4C9IA 1X53A 4M9BA 3TVQA 2LE1A 3KAYA 3FO5A 2RERA 1VJHA 1XDFA 3Q63A 2M47A 1FSKA 4JHHA 3KDIA 5E46A 2Z9YA 1LN2A 1XN5A 4JDLA 4A88A 3NMNA 1T17A 2EJXA 4FPWA 4A83A 4M9WA 2NS9A 1TXCA 2LGHA 5BRLA 1IFVA 4XRTA 4A86A 1BV1A 2WQLA 4B9RA 3JRSA 2E3NA 4IGXA 3QN1A 2KTEA 2PSOA 4OICA 4MA6A 3RT2A 3NJ1A 1E09A 2PCSA 4JHGA 2E3QA 2LCGA 4A8UA 3H3QA 3RD6A 3Q64A 2NN5A 2RESA 3NR4A 2I9YA 4A85A 4MAPA 2E3PA 5AMWA 4A8VA 3H3SA 2R55A 4N3EA 4N0GC 1B6FA 4LGBA 3NMHA 3Q6AA 4A80A 4DSCA 2LPXA 3CNWA 4REIA 4A84A 5I8FA 4BKDA 3UQHA 2VNEA 3NI8A 2L8OA 3K90A 3W9KA 3QSZA 2LUZA 2L9PA 2E3RA 3K3KA 3KAZA 4PSBA 4Z3LA 2FLHA 3NJ0A 1XFSA 2E3MA 3NS2A 4RYVA 3E85A 2KCZA 2IL5A 3KLXA 3ZVUA 2Q3QA 3PU2A 2L65A 2N4AA 5E4MA 4BK6A 2LDKA 2LIOA 3OH8A 3WG8A 2MOUA 1LLTA 4BKCA 3R6PA 2N4BA 4IGWA 4BTZA 3TFZA 3KDHA 1ICXA 2E3SA 3KB0A 3P51A 4LGAA 5E4BA 1UW5A 2KF2A 3W9RA 2REZA 2K5GA 4GY9A 3UJLA 3NMVA 3PUTA 3H3RA 1BTVA 4DSBA 4A81A 3TL1A 3OJIA 4DS8A 4WVOA 2D4RA 3KL1A 3OTLA 4R7KA 4Q0KA 3NEGA 3C0VA 1TW0A 3NMTA 4C9CA 3TVRA 3JRQB 4REJA 3KB3A 2BK0A 5E4DA 4JHIA 2LF2A 5JO2A 2GKDA 1H2OA 3IJTA 3NMPA 2K7HA 2LAKA 4BK7A 1XUVA 3RT0C 4LG5A 4IHRA 1Z94A 3F08A 3P9VA 2QIMA 2QPVA 5C9YA 4A87A 5JNNA 2E3OA 1KCMA 1LN1A 4C94A 1ZXFA 4IGVA 1FM4A 1XN6A 3KDJA 4IH0A 5I9JA 4A8GA 1T27A 3H3TA 3GGNA 4IH2A 1QMRA 2LEQA 2KEWA 3ELIA 3NJOA 2A1LA
chains in the Genus database with same CATH superfamily
4JDAA 4LA7A 3UIDA 1JSSA 2FFSA 3GTEA 4QIPA 2M89A 2Z9ZA 4IGYA 1LN3A 3OQUA 4MNSA 4REHA 5JO1A 2VQ5A 3NEFA 3P0LA 4XRWA 3IE5A 1EM2A 4Y31A 4C9IA 1X53A 4M9BA 2ZYLA 4JHYA 3GL0A 3HO1A 3TVQA 2LE1A 3KAYA 3FO5A 2RERA 1VJHA 3GL2A 1XDFA 3Q63A 2M47A 1FSKA 4JHHA 3KDIA 5E46A 4NCAA 4QDDA 2Z9YA 1LN2A 1XN5A 4JDLA 4A88A 3NMNA 1T17A 2EJXA 4FPWA 4A83A 4M9WA 2NS9A 1TXCA 2LGHA 5BRLA 1IFVA 4XRTA 4A86A 1BV1A 2WQLA 4B9RA 3JRSA 2E3NA 4IGXA 3QN1A 2KTEA 2PSOA 4OICA 4MA6A 3RT2A 2LAFA 3NJ1A 1E09A 2PCSA 4JHGA 2E3QA 2LCGA 4A8UA 3H3QA 3RD6A 4QDFB 3Q64A 2NN5A 3GB4A 2RESA 3NR4A 3HVRA 4NCBA 4E6FA 2I9YA 4A85A 4MAPA 3GOBA 2E3PA 5AMWA 4A8VA 3H3SA 2R55A 4N3EA 4N0GC 1B6FA 4QDCA 5EKQC 4LGBA 3NMHA 3Q6AA 4A80A 3HJFA 3GTSA 4DSCA 4N47A 2LPXA 3CNWA 4REIA 4A84A 5I8FA 4BKDA 3UQHA 2VNEA 3NI8A 2L8OA 3K90A 3W9KA 3QSZA 3GKEA 2LUZA 2L9PA 2E3RA 3K3KA 3KAZA 4PSBA 4Z3LA 2FLHA 3NJ0A 1XFSA 2E3MA 3NS2A 4RYVA 3E85A 2KCZA 2IL5A 3KLXA 3ZVUA 2Q3QA 3PU2A 2L65A 2N4AA 5E4MA 2YH6A 4BK6A 2LDKA 2LIOA 3OH8A 3WG8A 2MOUA 1LLTA 4BKCA 3R6PA 2N4BA 3HXMA 4IGWA 4N41A 4BTZA 3TFZA 3KDHA 1ICXA 2E3SA 3KB0A 3P51A 4LGAA 5E4BA 1UW5A 2KF2A 4KPYA 3W9RA 2REZA 4QDFA 2K5GA 4GY9A 3UJLA 3NMVA 3PUTA 3H3RA 1BTVA 4N76A 4DSBA 4A81A 3TL1A 3OJIA 3HM9A 4DS8A 3NQNA 3DLHA 4WVOA 2D4RA 3KL1A 3OTLA 4R7KA 4Q0KA 3NEGA 3C0VA 1TW0A 3NMTA 4C9CA 3TVRA 3JRQB 4REJA 3KB3A 2BK0A 5E4DA 4JHIA 2LF2A 5JO2A 2GKDA 1H2OA 3IJTA 3NMPA 2K7HA 3DLBA 2LAKA 4BK7A 1XUVA 3RT0C 4LG5A 4IHRA 1Z94A 3F08A 3P9VA 2QIMA 2QPVA 5C9YA 4A87A 5JNNA 2E3OA 1KCMA 1LN1A 4C94A 3TGOC 1ZXFA 4IGVA 1FM4A 1XN6A 3KDJA 4IH0A 5I9JA 4QCKA 1T27A 3H3TA 3GGNA 4IH2A 4A8GA 3F73A 3HK2A 1QMRA 2LEQA 2KEWA 3ELIA 3NJOA 2A1LA
chains in the Genus database with same CATH topology
4JDAA 4LA7A 3UIDA 1JSSA 2FFSA 3GTEA 4QIPA 2M89A 2Z9ZA 4IGYA 1LN3A 3OQUA 4MNSA 4REHA 5JO1A 2VQ5A 3NEFA 3P0LA 4XRWA 3IE5A 1EM2A 4Y31A 4C9IA 1X53A 4M9BA 2ZYLA 4JHYA 3GL0A 3HO1A 3TVQA 2LE1A 3KAYA 3FO5A 2RERA 1VJHA 3GL2A 1XDFA 3Q63A 2M47A 1FSKA 4JHHA 3KDIA 5E46A 4NCAA 4QDDA 2Z9YA 1LN2A 1XN5A 4JDLA 4A88A 3NMNA 1T17A 2EJXA 4FPWA 4A83A 4M9WA 2NS9A 1TXCA 2LGHA 5BRLA 1IFVA 4XRTA 4A86A 1BV1A 2WQLA 4B9RA 3JRSA 2E3NA 4IGXA 3QN1A 2KTEA 2PSOA 4OICA 4MA6A 3RT2A 2LAFA 3NJ1A 1E09A 2PCSA 4JHGA 2E3QA 2LCGA 4A8UA 3H3QA 3RD6A 4QDFB 3Q64A 2NN5A 3GB4A 2RESA 3NR4A 3HVRA 4NCBA 4E6FA 2I9YA 4A85A 4MAPA 3GOBA 2E3PA 5AMWA 4A8VA 3H3SA 2R55A 4N3EA 4N0GC 1B6FA 4QDCA 5EKQC 4LGBA 3NMHA 3Q6AA 4A80A 3HJFA 3GTSA 4DSCA 4N47A 2LPXA 3CNWA 4REIA 4A84A 5I8FA 4BKDA 3UQHA 2VNEA 3NI8A 2L8OA 3K90A 3W9KA 3QSZA 3GKEA 2LUZA 2L9PA 2E3RA 3K3KA 3KAZA 4PSBA 4Z3LA 2FLHA 3NJ0A 1XFSA 2E3MA 3NS2A 4RYVA 3E85A 2KCZA 2IL5A 3KLXA 3ZVUA 2Q3QA 3PU2A 2L65A 2N4AA 5E4MA 2YH6A 4BK6A 2LDKA 2LIOA 3OH8A 3WG8A 2MOUA 1LLTA 4BKCA 3R6PA 2N4BA 3HXMA 4IGWA 4N41A 4BTZA 3TFZA 3KDHA 1ICXA 2E3SA 3KB0A 3P51A 4LGAA 5E4BA 1UW5A 2KF2A 4KPYA 3W9RA 2REZA 4QDFA 2K5GA 4GY9A 3UJLA 3NMVA 3PUTA 3H3RA 1BTVA 4N76A 4DSBA 4A81A 3TL1A 3OJIA 3HM9A 4DS8A 3NQNA 3DLHA 4WVOA 2D4RA 3KL1A 3OTLA 4R7KA 4Q0KA 3NEGA 3C0VA 1TW0A 3NMTA 4C9CA 3TVRA 3JRQB 4REJA 3KB3A 2BK0A 5E4DA 4JHIA 2LF2A 5JO2A 2GKDA 1H2OA 3IJTA 3NMPA 2K7HA 3DLBA 2LAKA 4BK7A 1XUVA 3RT0C 4LG5A 4IHRA 1Z94A 3F08A 3P9VA 2QIMA 2QPVA 5C9YA 4A87A 5JNNA 2E3OA 1KCMA 1LN1A 4C94A 3TGOC 1ZXFA 4IGVA 1FM4A 1XN6A 3KDJA 4IH0A 5I9JA 4QCKA 1T27A 3H3TA 3GGNA 4IH2A 4A8GA 3F73A 3HK2A 1QMRA 2LEQA 2KEWA 3ELIA 3NJOA 2A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JDA A;  4LA7 A;  3UID A;  1JSS A;  2FFS A;  4QIP A;  2M89 A;  2Z9Z A;  4IGY A;  1LN3 A;  3OQU A;  4MNS A;  4REH A;  5JO1 A;  2VQ5 A;  3NEF A;  3P0L A;  4XRW A;  3IE5 A;  1EM2 A;  4Y31 A;  4C9I A;  1X53 A;  4M9B A;  3TVQ A;  2LE1 A;  3KAY A;  3FO5 A;  2RER A;  1VJH A;  1XDF A;  3Q63 A;  2M47 A;  1FSK A;  4JHH A;  3KDI A;  5E46 A;  2Z9Y A;  1LN2 A;  1XN5 A;  4JDL A;  4A88 A;  3NMN A;  1T17 A;  2EJX A;  4FPW A;  4A83 A;  4M9W A;  2NS9 A;  1TXC A;  2LGH A;  5BRL A;  1IFV A;  4XRT A;  4A86 A;  1BV1 A;  2WQL A;  4B9R A;  3JRS A;  2E3N A;  4IGX A;  3QN1 A;  2KTE A;  2PSO A;  4OIC A;  4MA6 A;  3RT2 A;  3NJ1 A;  1E09 A;  2PCS A;  4JHG A;  2E3Q A;  2LCG A;  4A8U A;  3H3Q A;  3RD6 A;  3Q64 A;  2NN5 A;  2RES A;  3NR4 A;  2I9Y A;  4A85 A;  4MAP A;  2E3P A;  5AMW A;  4A8V A;  3H3S A;  2R55 A;  4N3E A;  4N0G C;  1B6F A;  4LGB A;  3NMH A;  3Q6A A;  4A80 A;  4DSC A;  2LPX A;  3CNW A;  4REI A;  4A84 A;  5I8F A;  4BKD A;  3UQH A;  2VNE A;  3NI8 A;  2L8O A;  3K90 A;  3W9K A;  3QSZ A;  2LUZ A;  2L9P A;  2E3R A;  3K3K A;  3KAZ A;  4PSB A;  4Z3L A;  2FLH A;  3NJ0 A;  1XFS A;  2E3M A;  3NS2 A;  4RYV A;  3E85 A;  2KCZ A;  2IL5 A;  3KLX A;  3ZVU A;  2Q3Q A;  3PU2 A;  2L65 A;  2N4A A;  5E4M A;  4BK6 A;  2LDK A;  2LIO A;  3OH8 A;  3WG8 A;  2MOU A;  1LLT A;  4BKC A;  3R6P A;  2N4B A;  4IGW A;  4BTZ A;  3TFZ A;  3KDH A;  1ICX A;  2E3S A;  3KB0 A;  3P51 A;  4LGA A;  5E4B A;  1UW5 A;  2KF2 A;  3W9R A;  2REZ A;  2K5G A;  4GY9 A;  3UJL A;  3NMV A;  3PUT A;  3H3R A;  1BTV A;  4DSB A;  4A81 A;  3TL1 A;  3OJI A;  4DS8 A;  4WVO A;  2D4R A;  3KL1 A;  3OTL A;  4R7K A;  4Q0K A;  3NEG A;  3C0V A;  1TW0 A;  3NMT A;  4C9C A;  3TVR A;  3JRQ B;  4REJ A;  3KB3 A;  2BK0 A;  5E4D A;  4JHI A;  2LF2 A;  5JO2 A;  2GKD A;  1H2O A;  3IJT A;  3NMP A;  2K7H A;  2LAK A;  4BK7 A;  1XUV A;  3RT0 C;  4LG5 A;  4IHR A;  1Z94 A;  3F08 A;  3P9V A;  2QIM A;  2QPV A;  5C9Y A;  4A87 A;  5JNN A;  2E3O A;  1KCM A;  1LN1 A;  4C94 A;  1ZXF A;  4IGV A;  1FM4 A;  1XN6 A;  3KDJ A;  4IH0 A;  5I9J A;  4A8G A;  1T27 A;  3H3T A;  3GGN A;  4IH2 A;  1QMR A;  2LEQ A;  2KEW A;  3ELI A;  3NJO A;  2A1L A; 
#chains in the Genus database with same CATH topology
 4JDA A;  4LA7 A;  3UID A;  1JSS A;  2FFS A;  3GTE A;  4QIP A;  2M89 A;  2Z9Z A;  4IGY A;  1LN3 A;  3OQU A;  4MNS A;  4REH A;  5JO1 A;  2VQ5 A;  3NEF A;  3P0L A;  4XRW A;  3IE5 A;  1EM2 A;  4Y31 A;  4C9I A;  1X53 A;  4M9B A;  2ZYL A;  4JHY A;  3GL0 A;  3HO1 A;  3TVQ A;  2LE1 A;  3KAY A;  3FO5 A;  2RER A;  1VJH A;  3GL2 A;  1XDF A;  3Q63 A;  2M47 A;  1FSK A;  4JHH A;  3KDI A;  5E46 A;  4NCA A;  4QDD A;  2Z9Y A;  1LN2 A;  1XN5 A;  4JDL A;  4A88 A;  3NMN A;  1T17 A;  2EJX A;  4FPW A;  4A83 A;  4M9W A;  2NS9 A;  1TXC A;  2LGH A;  5BRL A;  1IFV A;  4XRT A;  4A86 A;  1BV1 A;  2WQL A;  4B9R A;  3JRS A;  2E3N A;  4IGX A;  3QN1 A;  2KTE A;  2PSO A;  4OIC A;  4MA6 A;  3RT2 A;  2LAF A;  3NJ1 A;  1E09 A;  2PCS A;  4JHG A;  2E3Q A;  2LCG A;  4A8U A;  3H3Q A;  3RD6 A;  4QDF B;  3Q64 A;  2NN5 A;  3GB4 A;  2RES A;  3NR4 A;  3HVR A;  4NCB A;  4E6F A;  2I9Y A;  4A85 A;  4MAP A;  3GOB A;  2E3P A;  5AMW A;  4A8V A;  3H3S A;  2R55 A;  4N3E A;  4N0G C;  1B6F A;  4QDC A;  5EKQ C;  4LGB A;  3NMH A;  3Q6A A;  4A80 A;  3HJF A;  3GTS A;  4DSC A;  4N47 A;  2LPX A;  3CNW A;  4REI A;  4A84 A;  5I8F A;  4BKD A;  3UQH A;  2VNE A;  3NI8 A;  2L8O A;  3K90 A;  3W9K A;  3QSZ A;  3GKE A;  2LUZ A;  2L9P A;  2E3R A;  3K3K A;  3KAZ A;  4PSB A;  4Z3L A;  2FLH A;  3NJ0 A;  1XFS A;  2E3M A;  3NS2 A;  4RYV A;  3E85 A;  2KCZ A;  2IL5 A;  3KLX A;  3ZVU A;  2Q3Q A;  3PU2 A;  2L65 A;  2N4A A;  5E4M A;  2YH6 A;  4BK6 A;  2LDK A;  2LIO A;  3OH8 A;  3WG8 A;  2MOU A;  1LLT A;  4BKC A;  3R6P A;  2N4B A;  3HXM A;  4IGW A;  4N41 A;  4BTZ A;  3TFZ A;  3KDH A;  1ICX A;  2E3S A;  3KB0 A;  3P51 A;  4LGA A;  5E4B A;  1UW5 A;  2KF2 A;  4KPY A;  3W9R A;  2REZ A;  4QDF A;  2K5G A;  4GY9 A;  3UJL A;  3NMV A;  3PUT A;  3H3R A;  1BTV A;  4N76 A;  4DSB A;  4A81 A;  3TL1 A;  3OJI A;  3HM9 A;  4DS8 A;  3NQN A;  3DLH A;  4WVO A;  2D4R A;  3KL1 A;  3OTL A;  4R7K A;  4Q0K A;  3NEG A;  3C0V A;  1TW0 A;  3NMT A;  4C9C A;  3TVR A;  3JRQ B;  4REJ A;  3KB3 A;  2BK0 A;  5E4D A;  4JHI A;  2LF2 A;  5JO2 A;  2GKD A;  1H2O A;  3IJT A;  3NMP A;  2K7H A;  3DLB A;  2LAK A;  4BK7 A;  1XUV A;  3RT0 C;  4LG5 A;  4IHR A;  1Z94 A;  3F08 A;  3P9V A;  2QIM A;  2QPV A;  5C9Y A;  4A87 A;  5JNN A;  2E3O A;  1KCM A;  1LN1 A;  4C94 A;  3TGO C;  1ZXF A;  4IGV A;  1FM4 A;  1XN6 A;  3KDJ A;  4IH0 A;  5I9J A;  4QCK A;  1T27 A;  3H3T A;  3GGN A;  4IH2 A;  4A8G A;  3F73 A;  3HK2 A;  1QMR A;  2LEQ A;  2KEW A;  3ELI A;  3NJO A;  2A1L A; 
#chains in the Genus database with same CATH homology
 4JDA A;  4LA7 A;  3UID A;  1JSS A;  2FFS A;  3GTE A;  4QIP A;  2M89 A;  2Z9Z A;  4IGY A;  1LN3 A;  3OQU A;  4MNS A;  4REH A;  5JO1 A;  2VQ5 A;  3NEF A;  3P0L A;  4XRW A;  3IE5 A;  1EM2 A;  4Y31 A;  4C9I A;  1X53 A;  4M9B A;  2ZYL A;  4JHY A;  3GL0 A;  3HO1 A;  3TVQ A;  2LE1 A;  3KAY A;  3FO5 A;  2RER A;  1VJH A;  3GL2 A;  1XDF A;  3Q63 A;  2M47 A;  1FSK A;  4JHH A;  3KDI A;  5E46 A;  4NCA A;  4QDD A;  2Z9Y A;  1LN2 A;  1XN5 A;  4JDL A;  4A88 A;  3NMN A;  1T17 A;  2EJX A;  4FPW A;  4A83 A;  4M9W A;  2NS9 A;  1TXC A;  2LGH A;  5BRL A;  1IFV A;  4XRT A;  4A86 A;  1BV1 A;  2WQL A;  4B9R A;  3JRS A;  2E3N A;  4IGX A;  3QN1 A;  2KTE A;  2PSO A;  4OIC A;  4MA6 A;  3RT2 A;  2LAF A;  3NJ1 A;  1E09 A;  2PCS A;  4JHG A;  2E3Q A;  2LCG A;  4A8U A;  3H3Q A;  3RD6 A;  4QDF B;  3Q64 A;  2NN5 A;  3GB4 A;  2RES A;  3NR4 A;  3HVR A;  4NCB A;  4E6F A;  2I9Y A;  4A85 A;  4MAP A;  3GOB A;  2E3P A;  5AMW A;  4A8V A;  3H3S A;  2R55 A;  4N3E A;  4N0G C;  1B6F A;  4QDC A;  5EKQ C;  4LGB A;  3NMH A;  3Q6A A;  4A80 A;  3HJF A;  3GTS A;  4DSC A;  4N47 A;  2LPX A;  3CNW A;  4REI A;  4A84 A;  5I8F A;  4BKD A;  3UQH A;  2VNE A;  3NI8 A;  2L8O A;  3K90 A;  3W9K A;  3QSZ A;  3GKE A;  2LUZ A;  2L9P A;  2E3R A;  3K3K A;  3KAZ A;  4PSB A;  4Z3L A;  2FLH A;  3NJ0 A;  1XFS A;  2E3M A;  3NS2 A;  4RYV A;  3E85 A;  2KCZ A;  2IL5 A;  3KLX A;  3ZVU A;  2Q3Q A;  3PU2 A;  2L65 A;  2N4A A;  5E4M A;  2YH6 A;  4BK6 A;  2LDK A;  2LIO A;  3OH8 A;  3WG8 A;  2MOU A;  1LLT A;  4BKC A;  3R6P A;  2N4B A;  3HXM A;  4IGW A;  4N41 A;  4BTZ A;  3TFZ A;  3KDH A;  1ICX A;  2E3S A;  3KB0 A;  3P51 A;  4LGA A;  5E4B A;  1UW5 A;  2KF2 A;  4KPY A;  3W9R A;  2REZ A;  4QDF A;  2K5G A;  4GY9 A;  3UJL A;  3NMV A;  3PUT A;  3H3R A;  1BTV A;  4N76 A;  4DSB A;  4A81 A;  3TL1 A;  3OJI A;  3HM9 A;  4DS8 A;  3NQN A;  3DLH A;  4WVO A;  2D4R A;  3KL1 A;  3OTL A;  4R7K A;  4Q0K A;  3NEG A;  3C0V A;  1TW0 A;  3NMT A;  4C9C A;  3TVR A;  3JRQ B;  4REJ A;  3KB3 A;  2BK0 A;  5E4D A;  4JHI A;  2LF2 A;  5JO2 A;  2GKD A;  1H2O A;  3IJT A;  3NMP A;  2K7H A;  3DLB A;  2LAK A;  4BK7 A;  1XUV A;  3RT0 C;  4LG5 A;  4IHR A;  1Z94 A;  3F08 A;  3P9V A;  2QIM A;  2QPV A;  5C9Y A;  4A87 A;  5JNN A;  2E3O A;  1KCM A;  1LN1 A;  4C94 A;  3TGO C;  1ZXF A;  4IGV A;  1FM4 A;  1XN6 A;  3KDJ A;  4IH0 A;  5I9J A;  4QCK A;  1T27 A;  3H3T A;  3GGN A;  4IH2 A;  4A8G A;  3F73 A;  3HK2 A;  1QMR A;  2LEQ A;  2KEW A;  3ELI A;  3NJO A;  2A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...