2A1LA

Rat pitp-beta complexed to phosphatidylcholine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
269
Chain Sequence
VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol transfer protein beta isoform
publication title Structure of PITPbeta in Complex with Phosphatidylcholine: Comparison of Structure and Lipid Transfer to Other PITP Isoforms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 84
structure length 269
sequence length 270
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02121 IP_trans Phosphatidylinositol transfer protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2a1lA00
4REHA 3GGNA 3KDIA 3TVQA 4DSCA 2EJXA 2E3SA 2M47A 4BK7A 4A87A 4IHRA 5E46A 2KCZA 3ELIA 3KAZA 1LLTA 4MA6A 1EM2A 3KDJA 3KDHA 3Q63A 4JHGA 1H2OA 2E3OA 1BV1A 1LN1A 5I9JA 1E09A 2L8OA 4REJA 3NJ1A 3FO5A 5JO1A 4A86A 3TVRA 3ZVUA 3QSZA 3RT0C 4QIPA 4A8VA 2LIOA 2IL5A 5E4MA 2LPXA 3TFZA 2K5GA 2RESA 3JRQB 3C0VA 3NEFA 3NMNA 4BKCA 2E3NA 2RERA 2Z9ZA 4A8UA 2E3QA 3KLXA 4Y31A 1XN6A 3UQHA 3H3QA 4A81A 2LDKA 4N0GC 4A88A 2MOUA 2K7HA 4C94A 3NMVA 2FFSA 4BKDA 4Z3LA 3NMTA 4JHHA 4XRWA 3PU2A 2GKDA 1FM4A 2NN5A 2NS9A 3R6PA 5BRLA 2LEQA 2WQLA 2QIMA 3QN1A 3RT2A 1LN3A 3F08A 1JSSA 3PUTA 3OQUA 4IGXA 3NS2A 4JHIA 4REIA 3NMPA 3NI8A 4RYVA 4LA7A 1IFVA 2LAKA 2E3PA 3OJIA 4PSBA 1FSKA 4IH2A 4LGBA 3P9VA 4DS8A 2R55A 3NJ0A 5AMWA 5JNNA 2L9PA 3KL1A 3OTLA 2KEWA 3IJTA 3NMHA 3H3TA 2FLHA 4MNSA 5E4BA 2LGHA 4IGVA 4C9IA 1Z94A 1XFSA 2L65A 2LUZA 2VQ5A 2Q3QA 3P0LA 3Q6AA 4IGYA 4JDAA 3NEGA 4C9CA 1VJHA 3K3KA 4LG5A 3UIDA 5E4DA 4A83A 3IE5A 2E3RA 4IGWA 4JDLA 4M9BA 4MAPA 2D4RA 2BK0A 1ZXFA 2N4AA 3Q64A 3JRSA 2PCSA 4LGAA 4N3EA 4A80A 2I9YA 4WVOA 3NR4A 1T17A 3RD6A 3E85A 3W9RA 3WG8A 4A84A 1UW5A 2E3MA 2KF2A 4XRTA 1T27A 3P51A 4A8GA 4A85A 2M89A 4R7KA 2LCGA 1TXCA 1KCMA 1X53A 3KAYA 4B9RA 3OH8A 2A1LA 4BK6A 3KB3A 1ICXA 4Q0KA 2LF2A 3H3RA 4BTZA 2PSOA 4FPWA 4M9WA 3NJOA 5JO2A 2VNEA 1B6FA 4GY9A 2KTEA 3W9KA 5I8FA 2Z9YA 1BTVA 1XN5A 2QPVA 3KB0A 1TW0A 3H3SA 1QMRA 2LE1A 1LN2A 4IH0A 5C9YA 3CNWA 1XUVA 4OICA 3K90A 3TL1A 4DSBA 2N4BA 2REZA 1XDFA 3UJLA
chains in the Genus database with same CATH superfamily
4REHA 3GGNA 3KDIA 3TVQA 4DSCA 2EJXA 2E3SA 2M47A 4BK7A 4A87A 4IHRA 5E46A 2KCZA 3ELIA 3KAZA 1LLTA 3GTSA 1EM2A 4MA6A 3KDJA 3KDHA 3Q63A 4NCBA 4JHGA 1H2OA 2E3OA 1BV1A 1LN1A 5I9JA 1E09A 2L8OA 4REJA 3GL0A 3NJ1A 3FO5A 5JO1A 4A86A 3TVRA 3ZVUA 4KPYA 3QSZA 3RT0C 4QIPA 4A8VA 4QDCA 4JHYA 2LIOA 3GB4A 2LAFA 2IL5A 5E4MA 2LPXA 3TFZA 2K5GA 2RESA 3JRQB 3C0VA 3GL2A 3NEFA 3NMNA 3GKEA 2E3NA 4BKCA 2RERA 2Z9ZA 3TGOC 4A8UA 2E3QA 3KLXA 4Y31A 1XN6A 3UQHA 3H3QA 4A81A 2LDKA 4N0GC 4A88A 2MOUA 2K7HA 4QDFB 3NMVA 4C94A 2FFSA 4BKDA 4Z3LA 3NMTA 4JHHA 4XRWA 3PU2A 2GKDA 1FM4A 2NN5A 2NS9A 3R6PA 5BRLA 2LEQA 2WQLA 2QIMA 3QN1A 3RT2A 3GOBA 4E6FA 1LN3A 3F08A 1JSSA 3PUTA 3OQUA 4IGXA 3NS2A 4JHIA 4REIA 3NMPA 3NI8A 4RYVA 4LA7A 5EKQC 1IFVA 2LAKA 2E3PA 4N47A 3OJIA 4PSBA 1FSKA 4IH2A 4LGBA 3P9VA 4DS8A 2R55A 3NJ0A 5AMWA 5JNNA 3HJFA 2L9PA 3KL1A 3OTLA 2KEWA 3IJTA 3NMHA 3NQNA 3HO1A 3H3TA 2FLHA 4MNSA 5E4BA 3DLHA 2LGHA 2ZYLA 4IGVA 4C9IA 1Z94A 1XFSA 2L65A 2LUZA 3HK2A 4NCAA 2VQ5A 2Q3QA 3P0LA 3Q6AA 4IGYA 4JDAA 3NEGA 4QDFA 4C9CA 1VJHA 3K3KA 4LG5A 3UIDA 5E4DA 4A83A 3IE5A 2E3RA 4IGWA 4JDLA 4M9BA 4MAPA 2YH6A 2D4RA 2BK0A 1ZXFA 2N4AA 3Q64A 3DLBA 3JRSA 2PCSA 4LGAA 4N3EA 4QDDA 3HVRA 4A80A 2I9YA 4WVOA 3NR4A 1T17A 3RD6A 3E85A 3W9RA 3WG8A 4A84A 1UW5A 2E3MA 2KF2A 4XRTA 1T27A 3P51A 4A8GA 3GTEA 2M89A 4R7KA 2LCGA 4A85A 1TXCA 1KCMA 1X53A 3KAYA 4B9RA 3OH8A 2A1LA 4BK6A 3KB3A 1ICXA 4Q0KA 2LF2A 3H3RA 4BTZA 4N76A 2PSOA 4FPWA 4M9WA 3NJOA 5JO2A 2VNEA 4QCKA 1B6FA 4GY9A 2KTEA 3HXMA 3W9KA 4N41A 5I8FA 2Z9YA 1BTVA 1XN5A 2QPVA 3KB0A 1TW0A 3F73A 3H3SA 1QMRA 2LE1A 1LN2A 4IH0A 5C9YA 3HM9A 3CNWA 1XUVA 4OICA 3K90A 3TL1A 4DSBA 2N4BA 2REZA 1XDFA 3UJLA
chains in the Genus database with same CATH topology
4REHA 3GGNA 3KDIA 3TVQA 4DSCA 2EJXA 2E3SA 2M47A 4BK7A 4A87A 4IHRA 5E46A 2KCZA 3ELIA 3KAZA 1LLTA 3GTSA 1EM2A 4MA6A 3KDJA 3KDHA 3Q63A 4NCBA 4JHGA 1H2OA 2E3OA 1BV1A 1LN1A 5I9JA 1E09A 2L8OA 4REJA 3GL0A 3NJ1A 3FO5A 5JO1A 4A86A 3TVRA 3ZVUA 4KPYA 3QSZA 3RT0C 4QIPA 4A8VA 4QDCA 4JHYA 2LIOA 3GB4A 2LAFA 2IL5A 5E4MA 2LPXA 3TFZA 2K5GA 2RESA 3JRQB 3C0VA 3GL2A 3NEFA 3NMNA 3GKEA 2E3NA 4BKCA 2RERA 2Z9ZA 3TGOC 4A8UA 2E3QA 3KLXA 4Y31A 1XN6A 3UQHA 3H3QA 4A81A 2LDKA 4N0GC 4A88A 2MOUA 2K7HA 4QDFB 3NMVA 4C94A 2FFSA 4BKDA 4Z3LA 3NMTA 4JHHA 4XRWA 3PU2A 2GKDA 1FM4A 2NN5A 2NS9A 3R6PA 5BRLA 2LEQA 2WQLA 2QIMA 3QN1A 3RT2A 3GOBA 4E6FA 1LN3A 3F08A 1JSSA 3PUTA 3OQUA 4IGXA 3NS2A 4JHIA 4REIA 3NMPA 3NI8A 4RYVA 4LA7A 5EKQC 1IFVA 2LAKA 2E3PA 4N47A 3OJIA 4PSBA 1FSKA 4IH2A 4LGBA 3P9VA 4DS8A 2R55A 3NJ0A 5AMWA 5JNNA 3HJFA 2L9PA 3KL1A 3OTLA 2KEWA 3IJTA 3NMHA 3NQNA 3HO1A 3H3TA 2FLHA 4MNSA 5E4BA 3DLHA 2LGHA 2ZYLA 4IGVA 4C9IA 1Z94A 1XFSA 2L65A 2LUZA 3HK2A 4NCAA 2VQ5A 2Q3QA 3P0LA 3Q6AA 4IGYA 4JDAA 3NEGA 4QDFA 4C9CA 1VJHA 3K3KA 4LG5A 3UIDA 5E4DA 4A83A 3IE5A 2E3RA 4IGWA 4JDLA 4M9BA 4MAPA 2YH6A 2D4RA 2BK0A 1ZXFA 2N4AA 3Q64A 3DLBA 3JRSA 2PCSA 4LGAA 4N3EA 4QDDA 3HVRA 4A80A 2I9YA 4WVOA 3NR4A 1T17A 3RD6A 3E85A 3W9RA 3WG8A 4A84A 1UW5A 2E3MA 2KF2A 4XRTA 1T27A 3P51A 4A8GA 3GTEA 2M89A 4R7KA 2LCGA 4A85A 1TXCA 1KCMA 1X53A 3KAYA 4B9RA 3OH8A 2A1LA 4BK6A 3KB3A 1ICXA 4Q0KA 2LF2A 3H3RA 4BTZA 4N76A 2PSOA 4FPWA 4M9WA 3NJOA 5JO2A 2VNEA 4QCKA 1B6FA 4GY9A 2KTEA 3HXMA 3W9KA 4N41A 5I8FA 2Z9YA 1BTVA 1XN5A 2QPVA 3KB0A 1TW0A 3F73A 3H3SA 1QMRA 2LE1A 1LN2A 4IH0A 5C9YA 3HM9A 3CNWA 1XUVA 4OICA 3K90A 3TL1A 4DSBA 2N4BA 2REZA 1XDFA 3UJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4REH A;  3GGN A;  3KDI A;  3TVQ A;  4DSC A;  2EJX A;  2E3S A;  2M47 A;  4BK7 A;  4A87 A;  4IHR A;  5E46 A;  2KCZ A;  3ELI A;  3KAZ A;  1LLT A;  4MA6 A;  1EM2 A;  3KDJ A;  3KDH A;  3Q63 A;  4JHG A;  1H2O A;  2E3O A;  1BV1 A;  1LN1 A;  5I9J A;  1E09 A;  2L8O A;  4REJ A;  3NJ1 A;  3FO5 A;  5JO1 A;  4A86 A;  3TVR A;  3ZVU A;  3QSZ A;  3RT0 C;  4QIP A;  4A8V A;  2LIO A;  2IL5 A;  5E4M A;  2LPX A;  3TFZ A;  2K5G A;  2RES A;  3JRQ B;  3C0V A;  3NEF A;  3NMN A;  4BKC A;  2E3N A;  2RER A;  2Z9Z A;  4A8U A;  2E3Q A;  3KLX A;  4Y31 A;  1XN6 A;  3UQH A;  3H3Q A;  4A81 A;  2LDK A;  4N0G C;  4A88 A;  2MOU A;  2K7H A;  4C94 A;  3NMV A;  2FFS A;  4BKD A;  4Z3L A;  3NMT A;  4JHH A;  4XRW A;  3PU2 A;  2GKD A;  1FM4 A;  2NN5 A;  2NS9 A;  3R6P A;  5BRL A;  2LEQ A;  2WQL A;  2QIM A;  3QN1 A;  3RT2 A;  1LN3 A;  3F08 A;  1JSS A;  3PUT A;  3OQU A;  4IGX A;  3NS2 A;  4JHI A;  4REI A;  3NMP A;  3NI8 A;  4RYV A;  4LA7 A;  1IFV A;  2LAK A;  2E3P A;  3OJI A;  4PSB A;  1FSK A;  4IH2 A;  4LGB A;  3P9V A;  4DS8 A;  2R55 A;  3NJ0 A;  5AMW A;  5JNN A;  2L9P A;  3KL1 A;  3OTL A;  2KEW A;  3IJT A;  3NMH A;  3H3T A;  2FLH A;  4MNS A;  5E4B A;  2LGH A;  4IGV A;  4C9I A;  1Z94 A;  1XFS A;  2L65 A;  2LUZ A;  2VQ5 A;  2Q3Q A;  3P0L A;  3Q6A A;  4IGY A;  4JDA A;  3NEG A;  4C9C A;  1VJH A;  3K3K A;  4LG5 A;  3UID A;  5E4D A;  4A83 A;  3IE5 A;  2E3R A;  4IGW A;  4JDL A;  4M9B A;  4MAP A;  2D4R A;  2BK0 A;  1ZXF A;  2N4A A;  3Q64 A;  3JRS A;  2PCS A;  4LGA A;  4N3E A;  4A80 A;  2I9Y A;  4WVO A;  3NR4 A;  1T17 A;  3RD6 A;  3E85 A;  3W9R A;  3WG8 A;  4A84 A;  1UW5 A;  2E3M A;  2KF2 A;  4XRT A;  1T27 A;  3P51 A;  4A8G A;  4A85 A;  2M89 A;  4R7K A;  2LCG A;  1TXC A;  1KCM A;  1X53 A;  3KAY A;  4B9R A;  3OH8 A;  2A1L A;  4BK6 A;  3KB3 A;  1ICX A;  4Q0K A;  2LF2 A;  3H3R A;  4BTZ A;  2PSO A;  4FPW A;  4M9W A;  3NJO A;  5JO2 A;  2VNE A;  1B6F A;  4GY9 A;  2KTE A;  3W9K A;  5I8F A;  2Z9Y A;  1BTV A;  1XN5 A;  2QPV A;  3KB0 A;  1TW0 A;  3H3S A;  1QMR A;  2LE1 A;  1LN2 A;  4IH0 A;  5C9Y A;  3CNW A;  1XUV A;  4OIC A;  3K90 A;  3TL1 A;  4DSB A;  2N4B A;  2REZ A;  1XDF A;  3UJL A; 
#chains in the Genus database with same CATH topology
 4REH A;  3GGN A;  3KDI A;  3TVQ A;  4DSC A;  2EJX A;  2E3S A;  2M47 A;  4BK7 A;  4A87 A;  4IHR A;  5E46 A;  2KCZ A;  3ELI A;  3KAZ A;  1LLT A;  3GTS A;  1EM2 A;  4MA6 A;  3KDJ A;  3KDH A;  3Q63 A;  4NCB A;  4JHG A;  1H2O A;  2E3O A;  1BV1 A;  1LN1 A;  5I9J A;  1E09 A;  2L8O A;  4REJ A;  3GL0 A;  3NJ1 A;  3FO5 A;  5JO1 A;  4A86 A;  3TVR A;  3ZVU A;  4KPY A;  3QSZ A;  3RT0 C;  4QIP A;  4A8V A;  4QDC A;  4JHY A;  2LIO A;  3GB4 A;  2LAF A;  2IL5 A;  5E4M A;  2LPX A;  3TFZ A;  2K5G A;  2RES A;  3JRQ B;  3C0V A;  3GL2 A;  3NEF A;  3NMN A;  3GKE A;  2E3N A;  4BKC A;  2RER A;  2Z9Z A;  3TGO C;  4A8U A;  2E3Q A;  3KLX A;  4Y31 A;  1XN6 A;  3UQH A;  3H3Q A;  4A81 A;  2LDK A;  4N0G C;  4A88 A;  2MOU A;  2K7H A;  4QDF B;  3NMV A;  4C94 A;  2FFS A;  4BKD A;  4Z3L A;  3NMT A;  4JHH A;  4XRW A;  3PU2 A;  2GKD A;  1FM4 A;  2NN5 A;  2NS9 A;  3R6P A;  5BRL A;  2LEQ A;  2WQL A;  2QIM A;  3QN1 A;  3RT2 A;  3GOB A;  4E6F A;  1LN3 A;  3F08 A;  1JSS A;  3PUT A;  3OQU A;  4IGX A;  3NS2 A;  4JHI A;  4REI A;  3NMP A;  3NI8 A;  4RYV A;  4LA7 A;  5EKQ C;  1IFV A;  2LAK A;  2E3P A;  4N47 A;  3OJI A;  4PSB A;  1FSK A;  4IH2 A;  4LGB A;  3P9V A;  4DS8 A;  2R55 A;  3NJ0 A;  5AMW A;  5JNN A;  3HJF A;  2L9P A;  3KL1 A;  3OTL A;  2KEW A;  3IJT A;  3NMH A;  3NQN A;  3HO1 A;  3H3T A;  2FLH A;  4MNS A;  5E4B A;  3DLH A;  2LGH A;  2ZYL A;  4IGV A;  4C9I A;  1Z94 A;  1XFS A;  2L65 A;  2LUZ A;  3HK2 A;  4NCA A;  2VQ5 A;  2Q3Q A;  3P0L A;  3Q6A A;  4IGY A;  4JDA A;  3NEG A;  4QDF A;  4C9C A;  1VJH A;  3K3K A;  4LG5 A;  3UID A;  5E4D A;  4A83 A;  3IE5 A;  2E3R A;  4IGW A;  4JDL A;  4M9B A;  4MAP A;  2YH6 A;  2D4R A;  2BK0 A;  1ZXF A;  2N4A A;  3Q64 A;  3DLB A;  3JRS A;  2PCS A;  4LGA A;  4N3E A;  4QDD A;  3HVR A;  4A80 A;  2I9Y A;  4WVO A;  3NR4 A;  1T17 A;  3RD6 A;  3E85 A;  3W9R A;  3WG8 A;  4A84 A;  1UW5 A;  2E3M A;  2KF2 A;  4XRT A;  1T27 A;  3P51 A;  4A8G A;  3GTE A;  2M89 A;  4R7K A;  2LCG A;  4A85 A;  1TXC A;  1KCM A;  1X53 A;  3KAY A;  4B9R A;  3OH8 A;  2A1L A;  4BK6 A;  3KB3 A;  1ICX A;  4Q0K A;  2LF2 A;  3H3R A;  4BTZ A;  4N76 A;  2PSO A;  4FPW A;  4M9W A;  3NJO A;  5JO2 A;  2VNE A;  4QCK A;  1B6F A;  4GY9 A;  2KTE A;  3HXM A;  3W9K A;  4N41 A;  5I8F A;  2Z9Y A;  1BTV A;  1XN5 A;  2QPV A;  3KB0 A;  1TW0 A;  3F73 A;  3H3S A;  1QMR A;  2LE1 A;  1LN2 A;  4IH0 A;  5C9Y A;  3HM9 A;  3CNW A;  1XUV A;  4OIC A;  3K90 A;  3TL1 A;  4DSB A;  2N4B A;  2REZ A;  1XDF A;  3UJL A; 
#chains in the Genus database with same CATH homology
 4REH A;  3GGN A;  3KDI A;  3TVQ A;  4DSC A;  2EJX A;  2E3S A;  2M47 A;  4BK7 A;  4A87 A;  4IHR A;  5E46 A;  2KCZ A;  3ELI A;  3KAZ A;  1LLT A;  3GTS A;  1EM2 A;  4MA6 A;  3KDJ A;  3KDH A;  3Q63 A;  4NCB A;  4JHG A;  1H2O A;  2E3O A;  1BV1 A;  1LN1 A;  5I9J A;  1E09 A;  2L8O A;  4REJ A;  3GL0 A;  3NJ1 A;  3FO5 A;  5JO1 A;  4A86 A;  3TVR A;  3ZVU A;  4KPY A;  3QSZ A;  3RT0 C;  4QIP A;  4A8V A;  4QDC A;  4JHY A;  2LIO A;  3GB4 A;  2LAF A;  2IL5 A;  5E4M A;  2LPX A;  3TFZ A;  2K5G A;  2RES A;  3JRQ B;  3C0V A;  3GL2 A;  3NEF A;  3NMN A;  3GKE A;  2E3N A;  4BKC A;  2RER A;  2Z9Z A;  3TGO C;  4A8U A;  2E3Q A;  3KLX A;  4Y31 A;  1XN6 A;  3UQH A;  3H3Q A;  4A81 A;  2LDK A;  4N0G C;  4A88 A;  2MOU A;  2K7H A;  4QDF B;  3NMV A;  4C94 A;  2FFS A;  4BKD A;  4Z3L A;  3NMT A;  4JHH A;  4XRW A;  3PU2 A;  2GKD A;  1FM4 A;  2NN5 A;  2NS9 A;  3R6P A;  5BRL A;  2LEQ A;  2WQL A;  2QIM A;  3QN1 A;  3RT2 A;  3GOB A;  4E6F A;  1LN3 A;  3F08 A;  1JSS A;  3PUT A;  3OQU A;  4IGX A;  3NS2 A;  4JHI A;  4REI A;  3NMP A;  3NI8 A;  4RYV A;  4LA7 A;  5EKQ C;  1IFV A;  2LAK A;  2E3P A;  4N47 A;  3OJI A;  4PSB A;  1FSK A;  4IH2 A;  4LGB A;  3P9V A;  4DS8 A;  2R55 A;  3NJ0 A;  5AMW A;  5JNN A;  3HJF A;  2L9P A;  3KL1 A;  3OTL A;  2KEW A;  3IJT A;  3NMH A;  3NQN A;  3HO1 A;  3H3T A;  2FLH A;  4MNS A;  5E4B A;  3DLH A;  2LGH A;  2ZYL A;  4IGV A;  4C9I A;  1Z94 A;  1XFS A;  2L65 A;  2LUZ A;  3HK2 A;  4NCA A;  2VQ5 A;  2Q3Q A;  3P0L A;  3Q6A A;  4IGY A;  4JDA A;  3NEG A;  4QDF A;  4C9C A;  1VJH A;  3K3K A;  4LG5 A;  3UID A;  5E4D A;  4A83 A;  3IE5 A;  2E3R A;  4IGW A;  4JDL A;  4M9B A;  4MAP A;  2YH6 A;  2D4R A;  2BK0 A;  1ZXF A;  2N4A A;  3Q64 A;  3DLB A;  3JRS A;  2PCS A;  4LGA A;  4N3E A;  4QDD A;  3HVR A;  4A80 A;  2I9Y A;  4WVO A;  3NR4 A;  1T17 A;  3RD6 A;  3E85 A;  3W9R A;  3WG8 A;  4A84 A;  1UW5 A;  2E3M A;  2KF2 A;  4XRT A;  1T27 A;  3P51 A;  4A8G A;  3GTE A;  2M89 A;  4R7K A;  2LCG A;  4A85 A;  1TXC A;  1KCM A;  1X53 A;  3KAY A;  4B9R A;  3OH8 A;  2A1L A;  4BK6 A;  3KB3 A;  1ICX A;  4Q0K A;  2LF2 A;  3H3R A;  4BTZ A;  4N76 A;  2PSO A;  4FPW A;  4M9W A;  3NJO A;  5JO2 A;  2VNE A;  4QCK A;  1B6F A;  4GY9 A;  2KTE A;  3HXM A;  3W9K A;  4N41 A;  5I8F A;  2Z9Y A;  1BTV A;  1XN5 A;  2QPV A;  3KB0 A;  1TW0 A;  3F73 A;  3H3S A;  1QMR A;  2LE1 A;  1LN2 A;  4IH0 A;  5C9Y A;  3HM9 A;  3CNW A;  1XUV A;  4OIC A;  3K90 A;  3TL1 A;  4DSB A;  2N4B A;  2REZ A;  1XDF A;  3UJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...