2A1LA

Rat pitp-beta complexed to phosphatidylcholine
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
270
structure length
269
Chain Sequence
b'VLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYENDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANTPCPKMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNLHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKKGSVRGTSAADA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol transfer protein beta isoform
publication title Structure of PITPbeta in Complex with Phosphatidylcholine: Comparison of Structure and Lipid Transfer to Other PITP Isoforms.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Lipid binding protein
total genus 84
structure length 269
sequence length 270
ec nomenclature
pdb deposition date 2005-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02121 IP_trans Phosphatidylinositol transfer protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2a1lA00
3KB3A 1QMRA 2L9PA 4IGXA 3TL1A 2A1LA 2D4RA 2BK0A 5E4MA 5I8FA 3UQHA 1KCMA 3H3RA 2Q3QA 1T27A 2LDKA 3WG8A 1IFVA 2FFSA 4Z3LA 3F08A 2LPXA 1FM4A 2M89A 2L65A 2LE1A 1LN2A 4A8VA 2L8OA 2NN5A 4A87A 4OICA 2E3PA 3KDHA 4R7KA 3NMVA 2MOUA 2REZA 1ZXFA 3UJLA 4A83A 2E3SA 1TXCA 1VJHA 4JDAA 5JNNA 3CNWA 5JO2A 3KAZA 4REIA 5BRLA 1BV1A 2Z9ZA 2VNEA 3W9KA 5E4BA 3NJ0A 2IL5A 5E4DA 3TVRA 3H3TA 4MNSA 4XRWA 4BKCA 2E3RA 1FSKA 3NR4A 1JSSA 2K5GA 2RERA 3OH8A 3Q64A 2PCSA 2KTEA 2LUZA 4M9WA 4BTZA 2NS9A 2GKDA 3RD6A 1BTVA 4IGWA 3RT2A 3Q63A 3KLXA 4BK7A 1Z94A 4N0GC 1B6FA 4B9RA 1XDFA 3IJTA 2R55A 2E3MA 5I9JA 2PSOA 2E3QA 4A85A 2K7HA 3H3SA 2VQ5A 4IH0A 1TW0A 3UIDA 2KCZA 2QIMA 4MAPA 4PSBA 1XN5A 2Z9YA 4M9BA 3KAYA 4WVOA 2KEWA 4JHIA 4DS8A 4IHRA 4LA7A 4LG5A 4A8GA 2M47A 3NJ1A 2RESA 3FO5A 3OTLA 2WQLA 3H3QA 3QSZA 3P9VA 3P0LA 3ZVUA 1E09A 3TVQA 3R6PA 3PUTA 1EM2A 3OJIA 2LCGA 3P51A 3ELIA 2LAKA 3NEFA 4DSBA 2EJXA 3NI8A 4BKDA 3IE5A 3NMNA 4A81A 3NJOA 1X53A 3NMTA 4REJA 4C9IA 3NS2A 1LN1A 4DSCA 1XFSA 4Y31A 4A86A 5JO1A 1XUVA 2QPVA 4IH2A 3E85A 4RYVA 4C94A 2E3OA 4A88A 4LGBA 2E3NA 4BK6A 2LIOA 4MA6A 4IGYA 3OQUA 3KDIA 2LEQA 1T17A 4REHA 3NMPA 3C0VA 3W9RA 2LF2A 3GGNA 1LLTA 3JRSA 4N3EA 5AMWA 4A8UA 4JDLA 1ICXA 2I9YA 3KDJA 2LGHA 4LGAA 2N4AA 3NMHA 1XN6A 4A80A 2N4BA 5E46A 3KB0A 1LN3A 1UW5A 3JRQB 3NEGA 4Q0KA 3KL1A 4QIPA 3K90A 1H2OA 4IGVA 2KF2A 4C9CA 5C9YA 3PU2A 4A84A 3K3KA 4XRTA 4FPWA 3QN1A 4JHHA 4GY9A 3RT0C 3TFZA 2FLHA 3Q6AA 4JHGA
chains in the Genus database with same CATH superfamily
3KB3A 1QMRA 2L9PA 4IGXA 2ZYLA 3TL1A 4N47A 2A1LA 2D4RA 2BK0A 5E4MA 5I8FA 3UQHA 1KCMA 3H3RA 2Q3QA 1T27A 2LDKA 3WG8A 1IFVA 2FFSA 4Z3LA 3F08A 2LPXA 1FM4A 2M89A 3HO1A 2L65A 2LE1A 1LN2A 4QDCA 4A8VA 4JHYA 2L8OA 2NN5A 4QDFA 4OICA 2E3PA 3KDHA 4A87A 4N41A 4R7KA 3NMVA 2MOUA 2REZA 1ZXFA 4QDFB 3UJLA 4A83A 2E3SA 1TXCA 1VJHA 4JDAA 4NCAA 3HVRA 5JNNA 3CNWA 5JO2A 3KAZA 4REIA 5BRLA 1BV1A 2Z9ZA 2VNEA 3W9KA 5E4BA 4NCBA 3NJ0A 2IL5A 5E4DA 3TVRA 3H3TA 4MNSA 4XRWA 3F73A 4BKCA 2E3RA 1FSKA 3NR4A 1JSSA 2K5GA 2RERA 3OH8A 4E6FA 3Q64A 2PCSA 2KTEA 2LUZA 4M9WA 4BTZA 2NS9A 3HXMA 2GKDA 3RD6A 1BTVA 4IGWA 3HM9A 3RT2A 3Q63A 3KLXA 4BK7A 1Z94A 4N0GC 1B6FA 4B9RA 1XDFA 3IJTA 2R55A 2E3MA 5I9JA 2PSOA 2E3QA 4A85A 2K7HA 3H3SA 2VQ5A 4IH0A 1TW0A 3UIDA 2KCZA 2QIMA 2YH6A 3GKEA 4MAPA 4PSBA 1XN5A 2Z9YA 4M9BA 4QCKA 3KAYA 4WVOA 2KEWA 4JHIA 4DS8A 4IHRA 2LAFA 4LA7A 4LG5A 4A8GA 2M47A 3NJ1A 2RESA 3FO5A 3OTLA 2WQLA 3H3QA 3QSZA 3P9VA 3P0LA 3ZVUA 1E09A 3TVQA 3GL0A 3PUTA 3R6PA 1EM2A 3OJIA 2LCGA 3P51A 3ELIA 3DLBA 2LAKA 3NEFA 4DSBA 2EJXA 3NI8A 4BKDA 3IE5A 3NMNA 4A81A 3NJOA 1X53A 3NMTA 4REJA 4C9IA 3NS2A 1LN1A 4DSCA 1XFSA 4Y31A 4A86A 5JO1A 1XUVA 2QPVA 4IH2A 3E85A 4RYVA 4C94A 2E3OA 3HK2A 4A88A 3GL2A 4LGBA 2E3NA 4BK6A 4N76A 2LIOA 4MA6A 3GB4A 4IGYA 3OQUA 3KDIA 2LEQA 1T17A 4REHA 3NMPA 3C0VA 3W9RA 4KPYA 2LF2A 3GGNA 1LLTA 3JRSA 4N3EA 5AMWA 4A8UA 4JDLA 1ICXA 2I9YA 3GTEA 3KDJA 2LGHA 4LGAA 2N4AA 3NMHA 4QDDA 5EKQC 1XN6A 4A80A 2N4BA 5E46A 3KB0A 1LN3A 1UW5A 3HJFA 3JRQB 3NEGA 4Q0KA 3KL1A 4QIPA 3K90A 1H2OA 4IGVA 2KF2A 4C9CA 5C9YA 3PU2A 4A84A 3TGOC 3K3KA 4XRTA 3NQNA 4FPWA 3QN1A 3GOBA 3GTSA 4JHHA 3DLHA 4GY9A 3RT0C 3TFZA 2FLHA 3Q6AA 4JHGA
chains in the Genus database with same CATH topology
3KB3A 1QMRA 2L9PA 4IGXA 2ZYLA 3TL1A 4N47A 2A1LA 2D4RA 2BK0A 5E4MA 5I8FA 3UQHA 1KCMA 3H3RA 2Q3QA 1T27A 2LDKA 3WG8A 1IFVA 2FFSA 4Z3LA 3F08A 2LPXA 1FM4A 2M89A 3HO1A 2L65A 2LE1A 1LN2A 4QDCA 4A8VA 4JHYA 2L8OA 2NN5A 4QDFA 4OICA 2E3PA 3KDHA 4A87A 4N41A 4R7KA 3NMVA 2MOUA 2REZA 1ZXFA 4QDFB 3UJLA 4A83A 2E3SA 1TXCA 1VJHA 4JDAA 4NCAA 3HVRA 5JNNA 3CNWA 5JO2A 3KAZA 4REIA 5BRLA 1BV1A 2Z9ZA 2VNEA 3W9KA 5E4BA 4NCBA 3NJ0A 2IL5A 5E4DA 3TVRA 3H3TA 4MNSA 4XRWA 3F73A 4BKCA 2E3RA 1FSKA 3NR4A 1JSSA 2K5GA 2RERA 3OH8A 4E6FA 3Q64A 2PCSA 2KTEA 2LUZA 4M9WA 4BTZA 2NS9A 3HXMA 2GKDA 3RD6A 1BTVA 4IGWA 3HM9A 3RT2A 3Q63A 3KLXA 4BK7A 1Z94A 4N0GC 1B6FA 4B9RA 1XDFA 3IJTA 2R55A 2E3MA 5I9JA 2PSOA 2E3QA 4A85A 2K7HA 3H3SA 2VQ5A 4IH0A 1TW0A 3UIDA 2KCZA 2QIMA 2YH6A 3GKEA 4MAPA 4PSBA 1XN5A 2Z9YA 4M9BA 4QCKA 3KAYA 4WVOA 2KEWA 4JHIA 4DS8A 4IHRA 2LAFA 4LA7A 4LG5A 4A8GA 2M47A 3NJ1A 2RESA 3FO5A 3OTLA 2WQLA 3H3QA 3QSZA 3P9VA 3P0LA 3ZVUA 1E09A 3TVQA 3GL0A 3PUTA 3R6PA 1EM2A 3OJIA 2LCGA 3P51A 3ELIA 3DLBA 2LAKA 3NEFA 4DSBA 2EJXA 3NI8A 4BKDA 3IE5A 3NMNA 4A81A 3NJOA 1X53A 3NMTA 4REJA 4C9IA 3NS2A 1LN1A 4DSCA 1XFSA 4Y31A 4A86A 5JO1A 1XUVA 2QPVA 4IH2A 3E85A 4RYVA 4C94A 2E3OA 3HK2A 4A88A 3GL2A 4LGBA 2E3NA 4BK6A 4N76A 2LIOA 4MA6A 3GB4A 4IGYA 3OQUA 3KDIA 2LEQA 1T17A 4REHA 3NMPA 3C0VA 3W9RA 4KPYA 2LF2A 3GGNA 1LLTA 3JRSA 4N3EA 5AMWA 4A8UA 4JDLA 1ICXA 2I9YA 3GTEA 3KDJA 2LGHA 4LGAA 2N4AA 3NMHA 4QDDA 5EKQC 1XN6A 4A80A 2N4BA 5E46A 3KB0A 1LN3A 1UW5A 3HJFA 3JRQB 3NEGA 4Q0KA 3KL1A 4QIPA 3K90A 1H2OA 4IGVA 2KF2A 4C9CA 5C9YA 3PU2A 4A84A 3TGOC 3K3KA 4XRTA 3NQNA 4FPWA 3QN1A 3GOBA 3GTSA 4JHHA 3DLHA 4GY9A 3RT0C 3TFZA 2FLHA 3Q6AA 4JHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KB3 A;  1QMR A;  2L9P A;  4IGX A;  3TL1 A;  2A1L A;  2D4R A;  2BK0 A;  5E4M A;  5I8F A;  3UQH A;  1KCM A;  3H3R A;  2Q3Q A;  1T27 A;  2LDK A;  3WG8 A;  1IFV A;  2FFS A;  4Z3L A;  3F08 A;  2LPX A;  1FM4 A;  2M89 A;  2L65 A;  2LE1 A;  1LN2 A;  4A8V A;  2L8O A;  2NN5 A;  4A87 A;  4OIC A;  2E3P A;  3KDH A;  4R7K A;  3NMV A;  2MOU A;  2REZ A;  1ZXF A;  3UJL A;  4A83 A;  2E3S A;  1TXC A;  1VJH A;  4JDA A;  5JNN A;  3CNW A;  5JO2 A;  3KAZ A;  4REI A;  5BRL A;  1BV1 A;  2Z9Z A;  2VNE A;  3W9K A;  5E4B A;  3NJ0 A;  2IL5 A;  5E4D A;  3TVR A;  3H3T A;  4MNS A;  4XRW A;  4BKC A;  2E3R A;  1FSK A;  3NR4 A;  1JSS A;  2K5G A;  2RER A;  3OH8 A;  3Q64 A;  2PCS A;  2KTE A;  2LUZ A;  4M9W A;  4BTZ A;  2NS9 A;  2GKD A;  3RD6 A;  1BTV A;  4IGW A;  3RT2 A;  3Q63 A;  3KLX A;  4BK7 A;  1Z94 A;  4N0G C;  1B6F A;  4B9R A;  1XDF A;  3IJT A;  2R55 A;  2E3M A;  5I9J A;  2PSO A;  2E3Q A;  4A85 A;  2K7H A;  3H3S A;  2VQ5 A;  4IH0 A;  1TW0 A;  3UID A;  2KCZ A;  2QIM A;  4MAP A;  4PSB A;  1XN5 A;  2Z9Y A;  4M9B A;  3KAY A;  4WVO A;  2KEW A;  4JHI A;  4DS8 A;  4IHR A;  4LA7 A;  4LG5 A;  4A8G A;  2M47 A;  3NJ1 A;  2RES A;  3FO5 A;  3OTL A;  2WQL A;  3H3Q A;  3QSZ A;  3P9V A;  3P0L A;  3ZVU A;  1E09 A;  3TVQ A;  3R6P A;  3PUT A;  1EM2 A;  3OJI A;  2LCG A;  3P51 A;  3ELI A;  2LAK A;  3NEF A;  4DSB A;  2EJX A;  3NI8 A;  4BKD A;  3IE5 A;  3NMN A;  4A81 A;  3NJO A;  1X53 A;  3NMT A;  4REJ A;  4C9I A;  3NS2 A;  1LN1 A;  4DSC A;  1XFS A;  4Y31 A;  4A86 A;  5JO1 A;  1XUV A;  2QPV A;  4IH2 A;  3E85 A;  4RYV A;  4C94 A;  2E3O A;  4A88 A;  4LGB A;  2E3N A;  4BK6 A;  2LIO A;  4MA6 A;  4IGY A;  3OQU A;  3KDI A;  2LEQ A;  1T17 A;  4REH A;  3NMP A;  3C0V A;  3W9R A;  2LF2 A;  3GGN A;  1LLT A;  3JRS A;  4N3E A;  5AMW A;  4A8U A;  4JDL A;  1ICX A;  2I9Y A;  3KDJ A;  2LGH A;  4LGA A;  2N4A A;  3NMH A;  1XN6 A;  4A80 A;  2N4B A;  5E46 A;  3KB0 A;  1LN3 A;  1UW5 A;  3JRQ B;  3NEG A;  4Q0K A;  3KL1 A;  4QIP A;  3K90 A;  1H2O A;  4IGV A;  2KF2 A;  4C9C A;  5C9Y A;  3PU2 A;  4A84 A;  3K3K A;  4XRT A;  4FPW A;  3QN1 A;  4JHH A;  4GY9 A;  3RT0 C;  3TFZ A;  2FLH A;  3Q6A A;  4JHG A; 
#chains in the Genus database with same CATH topology
 3KB3 A;  1QMR A;  2L9P A;  4IGX A;  2ZYL A;  3TL1 A;  4N47 A;  2A1L A;  2D4R A;  2BK0 A;  5E4M A;  5I8F A;  3UQH A;  1KCM A;  3H3R A;  2Q3Q A;  1T27 A;  2LDK A;  3WG8 A;  1IFV A;  2FFS A;  4Z3L A;  3F08 A;  2LPX A;  1FM4 A;  2M89 A;  3HO1 A;  2L65 A;  2LE1 A;  1LN2 A;  4QDC A;  4A8V A;  4JHY A;  2L8O A;  2NN5 A;  4QDF A;  4OIC A;  2E3P A;  3KDH A;  4A87 A;  4N41 A;  4R7K A;  3NMV A;  2MOU A;  2REZ A;  1ZXF A;  4QDF B;  3UJL A;  4A83 A;  2E3S A;  1TXC A;  1VJH A;  4JDA A;  4NCA A;  3HVR A;  5JNN A;  3CNW A;  5JO2 A;  3KAZ A;  4REI A;  5BRL A;  1BV1 A;  2Z9Z A;  2VNE A;  3W9K A;  5E4B A;  4NCB A;  3NJ0 A;  2IL5 A;  5E4D A;  3TVR A;  3H3T A;  4MNS A;  4XRW A;  3F73 A;  4BKC A;  2E3R A;  1FSK A;  3NR4 A;  1JSS A;  2K5G A;  2RER A;  3OH8 A;  4E6F A;  3Q64 A;  2PCS A;  2KTE A;  2LUZ A;  4M9W A;  4BTZ A;  2NS9 A;  3HXM A;  2GKD A;  3RD6 A;  1BTV A;  4IGW A;  3HM9 A;  3RT2 A;  3Q63 A;  3KLX A;  4BK7 A;  1Z94 A;  4N0G C;  1B6F A;  4B9R A;  1XDF A;  3IJT A;  2R55 A;  2E3M A;  5I9J A;  2PSO A;  2E3Q A;  4A85 A;  2K7H A;  3H3S A;  2VQ5 A;  4IH0 A;  1TW0 A;  3UID A;  2KCZ A;  2QIM A;  2YH6 A;  3GKE A;  4MAP A;  4PSB A;  1XN5 A;  2Z9Y A;  4M9B A;  4QCK A;  3KAY A;  4WVO A;  2KEW A;  4JHI A;  4DS8 A;  4IHR A;  2LAF A;  4LA7 A;  4LG5 A;  4A8G A;  2M47 A;  3NJ1 A;  2RES A;  3FO5 A;  3OTL A;  2WQL A;  3H3Q A;  3QSZ A;  3P9V A;  3P0L A;  3ZVU A;  1E09 A;  3TVQ A;  3GL0 A;  3PUT A;  3R6P A;  1EM2 A;  3OJI A;  2LCG A;  3P51 A;  3ELI A;  3DLB A;  2LAK A;  3NEF A;  4DSB A;  2EJX A;  3NI8 A;  4BKD A;  3IE5 A;  3NMN A;  4A81 A;  3NJO A;  1X53 A;  3NMT A;  4REJ A;  4C9I A;  3NS2 A;  1LN1 A;  4DSC A;  1XFS A;  4Y31 A;  4A86 A;  5JO1 A;  1XUV A;  2QPV A;  4IH2 A;  3E85 A;  4RYV A;  4C94 A;  2E3O A;  3HK2 A;  4A88 A;  3GL2 A;  4LGB A;  2E3N A;  4BK6 A;  4N76 A;  2LIO A;  4MA6 A;  3GB4 A;  4IGY A;  3OQU A;  3KDI A;  2LEQ A;  1T17 A;  4REH A;  3NMP A;  3C0V A;  3W9R A;  4KPY A;  2LF2 A;  3GGN A;  1LLT A;  3JRS A;  4N3E A;  5AMW A;  4A8U A;  4JDL A;  1ICX A;  2I9Y A;  3GTE A;  3KDJ A;  2LGH A;  4LGA A;  2N4A A;  3NMH A;  4QDD A;  5EKQ C;  1XN6 A;  4A80 A;  2N4B A;  5E46 A;  3KB0 A;  1LN3 A;  1UW5 A;  3HJF A;  3JRQ B;  3NEG A;  4Q0K A;  3KL1 A;  4QIP A;  3K90 A;  1H2O A;  4IGV A;  2KF2 A;  4C9C A;  5C9Y A;  3PU2 A;  4A84 A;  3TGO C;  3K3K A;  4XRT A;  3NQN A;  4FPW A;  3QN1 A;  3GOB A;  3GTS A;  4JHH A;  3DLH A;  4GY9 A;  3RT0 C;  3TFZ A;  2FLH A;  3Q6A A;  4JHG A; 
#chains in the Genus database with same CATH homology
 3KB3 A;  1QMR A;  2L9P A;  4IGX A;  2ZYL A;  3TL1 A;  4N47 A;  2A1L A;  2D4R A;  2BK0 A;  5E4M A;  5I8F A;  3UQH A;  1KCM A;  3H3R A;  2Q3Q A;  1T27 A;  2LDK A;  3WG8 A;  1IFV A;  2FFS A;  4Z3L A;  3F08 A;  2LPX A;  1FM4 A;  2M89 A;  3HO1 A;  2L65 A;  2LE1 A;  1LN2 A;  4QDC A;  4A8V A;  4JHY A;  2L8O A;  2NN5 A;  4QDF A;  4OIC A;  2E3P A;  3KDH A;  4A87 A;  4N41 A;  4R7K A;  3NMV A;  2MOU A;  2REZ A;  1ZXF A;  4QDF B;  3UJL A;  4A83 A;  2E3S A;  1TXC A;  1VJH A;  4JDA A;  4NCA A;  3HVR A;  5JNN A;  3CNW A;  5JO2 A;  3KAZ A;  4REI A;  5BRL A;  1BV1 A;  2Z9Z A;  2VNE A;  3W9K A;  5E4B A;  4NCB A;  3NJ0 A;  2IL5 A;  5E4D A;  3TVR A;  3H3T A;  4MNS A;  4XRW A;  3F73 A;  4BKC A;  2E3R A;  1FSK A;  3NR4 A;  1JSS A;  2K5G A;  2RER A;  3OH8 A;  4E6F A;  3Q64 A;  2PCS A;  2KTE A;  2LUZ A;  4M9W A;  4BTZ A;  2NS9 A;  3HXM A;  2GKD A;  3RD6 A;  1BTV A;  4IGW A;  3HM9 A;  3RT2 A;  3Q63 A;  3KLX A;  4BK7 A;  1Z94 A;  4N0G C;  1B6F A;  4B9R A;  1XDF A;  3IJT A;  2R55 A;  2E3M A;  5I9J A;  2PSO A;  2E3Q A;  4A85 A;  2K7H A;  3H3S A;  2VQ5 A;  4IH0 A;  1TW0 A;  3UID A;  2KCZ A;  2QIM A;  2YH6 A;  3GKE A;  4MAP A;  4PSB A;  1XN5 A;  2Z9Y A;  4M9B A;  4QCK A;  3KAY A;  4WVO A;  2KEW A;  4JHI A;  4DS8 A;  4IHR A;  2LAF A;  4LA7 A;  4LG5 A;  4A8G A;  2M47 A;  3NJ1 A;  2RES A;  3FO5 A;  3OTL A;  2WQL A;  3H3Q A;  3QSZ A;  3P9V A;  3P0L A;  3ZVU A;  1E09 A;  3TVQ A;  3GL0 A;  3PUT A;  3R6P A;  1EM2 A;  3OJI A;  2LCG A;  3P51 A;  3ELI A;  3DLB A;  2LAK A;  3NEF A;  4DSB A;  2EJX A;  3NI8 A;  4BKD A;  3IE5 A;  3NMN A;  4A81 A;  3NJO A;  1X53 A;  3NMT A;  4REJ A;  4C9I A;  3NS2 A;  1LN1 A;  4DSC A;  1XFS A;  4Y31 A;  4A86 A;  5JO1 A;  1XUV A;  2QPV A;  4IH2 A;  3E85 A;  4RYV A;  4C94 A;  2E3O A;  3HK2 A;  4A88 A;  3GL2 A;  4LGB A;  2E3N A;  4BK6 A;  4N76 A;  2LIO A;  4MA6 A;  3GB4 A;  4IGY A;  3OQU A;  3KDI A;  2LEQ A;  1T17 A;  4REH A;  3NMP A;  3C0V A;  3W9R A;  4KPY A;  2LF2 A;  3GGN A;  1LLT A;  3JRS A;  4N3E A;  5AMW A;  4A8U A;  4JDL A;  1ICX A;  2I9Y A;  3GTE A;  3KDJ A;  2LGH A;  4LGA A;  2N4A A;  3NMH A;  4QDD A;  5EKQ C;  1XN6 A;  4A80 A;  2N4B A;  5E46 A;  3KB0 A;  1LN3 A;  1UW5 A;  3HJF A;  3JRQ B;  3NEG A;  4Q0K A;  3KL1 A;  4QIP A;  3K90 A;  1H2O A;  4IGV A;  2KF2 A;  4C9C A;  5C9Y A;  3PU2 A;  4A84 A;  3TGO C;  3K3K A;  4XRT A;  3NQN A;  4FPW A;  3QN1 A;  3GOB A;  3GTS A;  4JHH A;  3DLH A;  4GY9 A;  3RT0 C;  3TFZ A;  2FLH A;  3Q6A A;  4JHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...