4A84A

Crystal structure of major birch pollen allergen bet v 1 a f30v mutant in complex with deoxycholate.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
b'GVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR POLLEN ALLERGEN BET V 1-A
publication title Crystallographically Mapped Ligand Binding Differs in High and Low Ige Binding Isoforms of Birch Pollen Allergen Bet V 1.
pubmed doi rcsb
source organism Betula pendula
molecule tags Allergen
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4a84A00
3P0LA 2PCSA 1JSSA 2WQLA 4LGBA 2L8OA 1LLTA 3OH8A 4REHA 3KL1A 2L9PA 1T17A 1VJHA 4A86A 3C0VA 4GY9A 4A8VA 3KB0A 2LPXA 4DS8A 5E4DA 4M9WA 3KDJA 4A83A 4IGVA 5C9YA 4IHRA 1BV1A 4A80A 3KLXA 4A88A 2NN5A 3NS2A 4C94A 1XN6A 2E3NA 4XRWA 3RT0C 3H3RA 3OQUA 3F08A 5E4MA 1ICXA 4IGXA 1KCMA 2LAKA 4N0GC 2E3MA 3KAYA 2IL5A 2K5GA 4A84A 2KTEA 3PU2A 2QIMA 3UJLA 1IFVA 2K7HA 3GGNA 2M89A 3QN1A 2KF2A 2REZA 3Q6AA 5JO2A 3UIDA 3KDHA 2QPVA 4IH2A 4A8UA 4Y31A 3NMPA 4MAPA 2LEQA 3RD6A 3NMTA 2E3SA 4MNSA 2E3OA 3TFZA 3KAZA 4R7KA 3KDIA 3Q64A 2Q3QA 2E3PA 3TVQA 2MOUA 1BTVA 1QMRA 2BK0A 2E3QA 5I9JA 1ZXFA 2LUZA 3NMHA 3OTLA 4B9RA 2GKDA 3P51A 3NJOA 4BK6A 2FLHA 1EM2A 3H3TA 3NJ0A 4IH0A 4A87A 3QSZA 2A1LA 2L65A 2Z9ZA 2KEWA 5JO1A 1TXCA 1XUVA 4JHIA 1FM4A 4FPWA 3W9RA 3KB3A 3W9KA 4REJA 3E85A 3ZVUA 2RESA 5AMWA 2LDKA 4BKDA 1XFSA 2VQ5A 3K3KA 4REIA 1LN3A 4LG5A 1E09A 2LE1A 4DSBA 3CNWA 3Q63A 3NMNA 3K90A 4OICA 1TW0A 2Z9YA 4Z3LA 4LA7A 4BK7A 3WG8A 2KCZA 3NJ1A 3RT2A 4JHHA 2VNEA 3JRQB 5E46A 1FSKA 4A8GA 5I8FA 5E4BA 4JDAA 2LCGA 2M47A 4BTZA 2LF2A 1UW5A 3FO5A 4IGYA 2PSOA 3ELIA 4M9BA 2FFSA 4RYVA 3TL1A 4A85A 4N3EA 2E3RA 1Z94A 3H3QA 4Q0KA 4LGAA 4QIPA 2D4RA 2I9YA 4WVOA 4C9IA 1LN2A 3NMVA 4BKCA 4C9CA 3IE5A 4JDLA 5JNNA 3UQHA 4DSCA 4IGWA 2R55A 3NR4A 3R6PA 1XDFA 1X53A 2LIOA 3NEGA 4XRTA 2RERA 1T27A 3OJIA 4A81A 3H3SA 3NEFA 2N4AA 3PUTA 4JHGA 2N4BA 4MA6A 3IJTA 1LN1A 2NS9A 4PSBA 5BRLA 3NI8A 3JRSA 2EJXA 1B6FA 2LGHA 1H2OA 3TVRA 1XN5A 3P9VA
chains in the Genus database with same CATH superfamily
3P0LA 2PCSA 4N76A 1JSSA 2WQLA 2ZYLA 2L8OA 1LLTA 4LGBA 3OH8A 4REHA 3KL1A 2L9PA 1T17A 1VJHA 4A86A 3C0VA 4GY9A 4A8VA 3KB0A 2LPXA 4DS8A 5E4DA 4M9WA 3KDJA 4A83A 4IGVA 5C9YA 4IHRA 3F73A 1BV1A 4A80A 3KLXA 4A88A 2NN5A 3NS2A 4C94A 1XN6A 4NCAA 2E3NA 4XRWA 3RT0C 3H3RA 3OQUA 3F08A 5E4MA 3TGOC 1ICXA 4IGXA 1KCMA 2LAKA 4N0GC 2E3MA 3KAYA 2IL5A 2K5GA 4A84A 4QDDA 3HJFA 2KTEA 3PU2A 2QIMA 3UJLA 1IFVA 2K7HA 3GB4A 3GGNA 2M89A 3QN1A 2KF2A 2REZA 3Q6AA 5JO2A 4N41A 3UIDA 3KDHA 2QPVA 4IH2A 4A8UA 4Y31A 3NMPA 4MAPA 2LEQA 3RD6A 3NMTA 2E3SA 4MNSA 2E3OA 3TFZA 3KAZA 4R7KA 3KDIA 3Q64A 2Q3QA 2E3PA 3TVQA 2MOUA 1BTVA 1QMRA 4QCKA 2BK0A 3HO1A 2E3QA 5I9JA 1ZXFA 3GKEA 2LUZA 3NMHA 4NCBA 3OTLA 4B9RA 2GKDA 3P51A 3NJOA 4BK6A 2FLHA 1EM2A 3H3TA 3NJ0A 4IH0A 4A87A 3QSZA 2A1LA 2L65A 2Z9ZA 2KEWA 5JO1A 1TXCA 1XUVA 4JHIA 1FM4A 4FPWA 3W9RA 3KB3A 3W9KA 4JHYA 4REJA 3E85A 3ZVUA 2RESA 5AMWA 2LDKA 4BKDA 1XFSA 2VQ5A 5EKQC 3K3KA 4REIA 1LN3A 4LG5A 1E09A 2LE1A 4DSBA 3CNWA 3Q63A 2LAFA 3NMNA 3K90A 4OICA 1TW0A 2Z9YA 4Z3LA 4LA7A 3DLBA 4BK7A 3WG8A 2KCZA 3NJ1A 3GOBA 4JHHA 2VNEA 3JRQB 3GTEA 1FSKA 5E46A 3RT2A 4A8GA 5I8FA 5E4BA 4JDAA 4QDFB 2LCGA 3DLHA 2M47A 4E6FA 4BTZA 2LF2A 1UW5A 3FO5A 4IGYA 2PSOA 3ELIA 4M9BA 2FFSA 4RYVA 3TL1A 4A85A 4N3EA 2E3RA 1Z94A 3GL0A 3H3QA 4Q0KA 4LGAA 3HM9A 4N47A 4QIPA 4QDCA 2D4RA 2I9YA 4WVOA 4C9IA 1LN2A 3NMVA 4BKCA 4C9CA 3GTSA 3IE5A 4JDLA 5JNNA 4QDFA 3UQHA 3NQNA 4DSCA 4IGWA 2R55A 3NR4A 3R6PA 1XDFA 1X53A 2LIOA 3NEGA 4XRTA 2RERA 1T27A 3OJIA 4A81A 3H3SA 3NEFA 2N4AA 3PUTA 4JHGA 3HVRA 2N4BA 4MA6A 3IJTA 1LN1A 2NS9A 4PSBA 5BRLA 3GL2A 3NI8A 3HK2A 3JRSA 2YH6A 3HXMA 4KPYA 2EJXA 1B6FA 2LGHA 1H2OA 3TVRA 1XN5A 3P9VA
chains in the Genus database with same CATH topology
3P0LA 2PCSA 4N76A 1JSSA 2WQLA 2ZYLA 2L8OA 1LLTA 4LGBA 3OH8A 4REHA 3KL1A 2L9PA 1T17A 1VJHA 4A86A 3C0VA 4GY9A 4A8VA 3KB0A 2LPXA 4DS8A 5E4DA 4M9WA 3KDJA 4A83A 4IGVA 5C9YA 4IHRA 3F73A 1BV1A 4A80A 3KLXA 4A88A 2NN5A 3NS2A 4C94A 1XN6A 4NCAA 2E3NA 4XRWA 3RT0C 3H3RA 3OQUA 3F08A 5E4MA 3TGOC 1ICXA 4IGXA 1KCMA 2LAKA 4N0GC 2E3MA 3KAYA 2IL5A 2K5GA 4A84A 4QDDA 3HJFA 2KTEA 3PU2A 2QIMA 3UJLA 1IFVA 2K7HA 3GB4A 3GGNA 2M89A 3QN1A 2KF2A 2REZA 3Q6AA 5JO2A 4N41A 3UIDA 3KDHA 2QPVA 4IH2A 4A8UA 4Y31A 3NMPA 4MAPA 2LEQA 3RD6A 3NMTA 2E3SA 4MNSA 2E3OA 3TFZA 3KAZA 4R7KA 3KDIA 3Q64A 2Q3QA 2E3PA 3TVQA 2MOUA 1BTVA 1QMRA 4QCKA 2BK0A 3HO1A 2E3QA 5I9JA 1ZXFA 3GKEA 2LUZA 3NMHA 4NCBA 3OTLA 4B9RA 2GKDA 3P51A 3NJOA 4BK6A 2FLHA 1EM2A 3H3TA 3NJ0A 4IH0A 4A87A 3QSZA 2A1LA 2L65A 2Z9ZA 2KEWA 5JO1A 1TXCA 1XUVA 4JHIA 1FM4A 4FPWA 3W9RA 3KB3A 3W9KA 4JHYA 4REJA 3E85A 3ZVUA 2RESA 5AMWA 2LDKA 4BKDA 1XFSA 2VQ5A 5EKQC 3K3KA 4REIA 1LN3A 4LG5A 1E09A 2LE1A 4DSBA 3CNWA 3Q63A 2LAFA 3NMNA 3K90A 4OICA 1TW0A 2Z9YA 4Z3LA 4LA7A 3DLBA 4BK7A 3WG8A 2KCZA 3NJ1A 3GOBA 4JHHA 2VNEA 3JRQB 3GTEA 1FSKA 5E46A 3RT2A 4A8GA 5I8FA 5E4BA 4JDAA 4QDFB 2LCGA 3DLHA 2M47A 4E6FA 4BTZA 2LF2A 1UW5A 3FO5A 4IGYA 2PSOA 3ELIA 4M9BA 2FFSA 4RYVA 3TL1A 4A85A 4N3EA 2E3RA 1Z94A 3GL0A 3H3QA 4Q0KA 4LGAA 3HM9A 4N47A 4QIPA 4QDCA 2D4RA 2I9YA 4WVOA 4C9IA 1LN2A 3NMVA 4BKCA 4C9CA 3GTSA 3IE5A 4JDLA 5JNNA 4QDFA 3UQHA 3NQNA 4DSCA 4IGWA 2R55A 3NR4A 3R6PA 1XDFA 1X53A 2LIOA 3NEGA 4XRTA 2RERA 1T27A 3OJIA 4A81A 3H3SA 3NEFA 2N4AA 3PUTA 4JHGA 3HVRA 2N4BA 4MA6A 3IJTA 1LN1A 2NS9A 4PSBA 5BRLA 3GL2A 3NI8A 3HK2A 3JRSA 2YH6A 3HXMA 4KPYA 2EJXA 1B6FA 2LGHA 1H2OA 3TVRA 1XN5A 3P9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P0L A;  2PCS A;  1JSS A;  2WQL A;  4LGB A;  2L8O A;  1LLT A;  3OH8 A;  4REH A;  3KL1 A;  2L9P A;  1T17 A;  1VJH A;  4A86 A;  3C0V A;  4GY9 A;  4A8V A;  3KB0 A;  2LPX A;  4DS8 A;  5E4D A;  4M9W A;  3KDJ A;  4A83 A;  4IGV A;  5C9Y A;  4IHR A;  1BV1 A;  4A80 A;  3KLX A;  4A88 A;  2NN5 A;  3NS2 A;  4C94 A;  1XN6 A;  2E3N A;  4XRW A;  3RT0 C;  3H3R A;  3OQU A;  3F08 A;  5E4M A;  1ICX A;  4IGX A;  1KCM A;  2LAK A;  4N0G C;  2E3M A;  3KAY A;  2IL5 A;  2K5G A;  4A84 A;  2KTE A;  3PU2 A;  2QIM A;  3UJL A;  1IFV A;  2K7H A;  3GGN A;  2M89 A;  3QN1 A;  2KF2 A;  2REZ A;  3Q6A A;  5JO2 A;  3UID A;  3KDH A;  2QPV A;  4IH2 A;  4A8U A;  4Y31 A;  3NMP A;  4MAP A;  2LEQ A;  3RD6 A;  3NMT A;  2E3S A;  4MNS A;  2E3O A;  3TFZ A;  3KAZ A;  4R7K A;  3KDI A;  3Q64 A;  2Q3Q A;  2E3P A;  3TVQ A;  2MOU A;  1BTV A;  1QMR A;  2BK0 A;  2E3Q A;  5I9J A;  1ZXF A;  2LUZ A;  3NMH A;  3OTL A;  4B9R A;  2GKD A;  3P51 A;  3NJO A;  4BK6 A;  2FLH A;  1EM2 A;  3H3T A;  3NJ0 A;  4IH0 A;  4A87 A;  3QSZ A;  2A1L A;  2L65 A;  2Z9Z A;  2KEW A;  5JO1 A;  1TXC A;  1XUV A;  4JHI A;  1FM4 A;  4FPW A;  3W9R A;  3KB3 A;  3W9K A;  4REJ A;  3E85 A;  3ZVU A;  2RES A;  5AMW A;  2LDK A;  4BKD A;  1XFS A;  2VQ5 A;  3K3K A;  4REI A;  1LN3 A;  4LG5 A;  1E09 A;  2LE1 A;  4DSB A;  3CNW A;  3Q63 A;  3NMN A;  3K90 A;  4OIC A;  1TW0 A;  2Z9Y A;  4Z3L A;  4LA7 A;  4BK7 A;  3WG8 A;  2KCZ A;  3NJ1 A;  3RT2 A;  4JHH A;  2VNE A;  3JRQ B;  5E46 A;  1FSK A;  4A8G A;  5I8F A;  5E4B A;  4JDA A;  2LCG A;  2M47 A;  4BTZ A;  2LF2 A;  1UW5 A;  3FO5 A;  4IGY A;  2PSO A;  3ELI A;  4M9B A;  2FFS A;  4RYV A;  3TL1 A;  4A85 A;  4N3E A;  2E3R A;  1Z94 A;  3H3Q A;  4Q0K A;  4LGA A;  4QIP A;  2D4R A;  2I9Y A;  4WVO A;  4C9I A;  1LN2 A;  3NMV A;  4BKC A;  4C9C A;  3IE5 A;  4JDL A;  5JNN A;  3UQH A;  4DSC A;  4IGW A;  2R55 A;  3NR4 A;  3R6P A;  1XDF A;  1X53 A;  2LIO A;  3NEG A;  4XRT A;  2RER A;  1T27 A;  3OJI A;  4A81 A;  3H3S A;  3NEF A;  2N4A A;  3PUT A;  4JHG A;  2N4B A;  4MA6 A;  3IJT A;  1LN1 A;  2NS9 A;  4PSB A;  5BRL A;  3NI8 A;  3JRS A;  2EJX A;  1B6F A;  2LGH A;  1H2O A;  3TVR A;  1XN5 A;  3P9V A; 
#chains in the Genus database with same CATH topology
 3P0L A;  2PCS A;  4N76 A;  1JSS A;  2WQL A;  2ZYL A;  2L8O A;  1LLT A;  4LGB A;  3OH8 A;  4REH A;  3KL1 A;  2L9P A;  1T17 A;  1VJH A;  4A86 A;  3C0V A;  4GY9 A;  4A8V A;  3KB0 A;  2LPX A;  4DS8 A;  5E4D A;  4M9W A;  3KDJ A;  4A83 A;  4IGV A;  5C9Y A;  4IHR A;  3F73 A;  1BV1 A;  4A80 A;  3KLX A;  4A88 A;  2NN5 A;  3NS2 A;  4C94 A;  1XN6 A;  4NCA A;  2E3N A;  4XRW A;  3RT0 C;  3H3R A;  3OQU A;  3F08 A;  5E4M A;  3TGO C;  1ICX A;  4IGX A;  1KCM A;  2LAK A;  4N0G C;  2E3M A;  3KAY A;  2IL5 A;  2K5G A;  4A84 A;  4QDD A;  3HJF A;  2KTE A;  3PU2 A;  2QIM A;  3UJL A;  1IFV A;  2K7H A;  3GB4 A;  3GGN A;  2M89 A;  3QN1 A;  2KF2 A;  2REZ A;  3Q6A A;  5JO2 A;  4N41 A;  3UID A;  3KDH A;  2QPV A;  4IH2 A;  4A8U A;  4Y31 A;  3NMP A;  4MAP A;  2LEQ A;  3RD6 A;  3NMT A;  2E3S A;  4MNS A;  2E3O A;  3TFZ A;  3KAZ A;  4R7K A;  3KDI A;  3Q64 A;  2Q3Q A;  2E3P A;  3TVQ A;  2MOU A;  1BTV A;  1QMR A;  4QCK A;  2BK0 A;  3HO1 A;  2E3Q A;  5I9J A;  1ZXF A;  3GKE A;  2LUZ A;  3NMH A;  4NCB A;  3OTL A;  4B9R A;  2GKD A;  3P51 A;  3NJO A;  4BK6 A;  2FLH A;  1EM2 A;  3H3T A;  3NJ0 A;  4IH0 A;  4A87 A;  3QSZ A;  2A1L A;  2L65 A;  2Z9Z A;  2KEW A;  5JO1 A;  1TXC A;  1XUV A;  4JHI A;  1FM4 A;  4FPW A;  3W9R A;  3KB3 A;  3W9K A;  4JHY A;  4REJ A;  3E85 A;  3ZVU A;  2RES A;  5AMW A;  2LDK A;  4BKD A;  1XFS A;  2VQ5 A;  5EKQ C;  3K3K A;  4REI A;  1LN3 A;  4LG5 A;  1E09 A;  2LE1 A;  4DSB A;  3CNW A;  3Q63 A;  2LAF A;  3NMN A;  3K90 A;  4OIC A;  1TW0 A;  2Z9Y A;  4Z3L A;  4LA7 A;  3DLB A;  4BK7 A;  3WG8 A;  2KCZ A;  3NJ1 A;  3GOB A;  4JHH A;  2VNE A;  3JRQ B;  3GTE A;  1FSK A;  5E46 A;  3RT2 A;  4A8G A;  5I8F A;  5E4B A;  4JDA A;  4QDF B;  2LCG A;  3DLH A;  2M47 A;  4E6F A;  4BTZ A;  2LF2 A;  1UW5 A;  3FO5 A;  4IGY A;  2PSO A;  3ELI A;  4M9B A;  2FFS A;  4RYV A;  3TL1 A;  4A85 A;  4N3E A;  2E3R A;  1Z94 A;  3GL0 A;  3H3Q A;  4Q0K A;  4LGA A;  3HM9 A;  4N47 A;  4QIP A;  4QDC A;  2D4R A;  2I9Y A;  4WVO A;  4C9I A;  1LN2 A;  3NMV A;  4BKC A;  4C9C A;  3GTS A;  3IE5 A;  4JDL A;  5JNN A;  4QDF A;  3UQH A;  3NQN A;  4DSC A;  4IGW A;  2R55 A;  3NR4 A;  3R6P A;  1XDF A;  1X53 A;  2LIO A;  3NEG A;  4XRT A;  2RER A;  1T27 A;  3OJI A;  4A81 A;  3H3S A;  3NEF A;  2N4A A;  3PUT A;  4JHG A;  3HVR A;  2N4B A;  4MA6 A;  3IJT A;  1LN1 A;  2NS9 A;  4PSB A;  5BRL A;  3GL2 A;  3NI8 A;  3HK2 A;  3JRS A;  2YH6 A;  3HXM A;  4KPY A;  2EJX A;  1B6F A;  2LGH A;  1H2O A;  3TVR A;  1XN5 A;  3P9V A; 
#chains in the Genus database with same CATH homology
 3P0L A;  2PCS A;  4N76 A;  1JSS A;  2WQL A;  2ZYL A;  2L8O A;  1LLT A;  4LGB A;  3OH8 A;  4REH A;  3KL1 A;  2L9P A;  1T17 A;  1VJH A;  4A86 A;  3C0V A;  4GY9 A;  4A8V A;  3KB0 A;  2LPX A;  4DS8 A;  5E4D A;  4M9W A;  3KDJ A;  4A83 A;  4IGV A;  5C9Y A;  4IHR A;  3F73 A;  1BV1 A;  4A80 A;  3KLX A;  4A88 A;  2NN5 A;  3NS2 A;  4C94 A;  1XN6 A;  4NCA A;  2E3N A;  4XRW A;  3RT0 C;  3H3R A;  3OQU A;  3F08 A;  5E4M A;  3TGO C;  1ICX A;  4IGX A;  1KCM A;  2LAK A;  4N0G C;  2E3M A;  3KAY A;  2IL5 A;  2K5G A;  4A84 A;  4QDD A;  3HJF A;  2KTE A;  3PU2 A;  2QIM A;  3UJL A;  1IFV A;  2K7H A;  3GB4 A;  3GGN A;  2M89 A;  3QN1 A;  2KF2 A;  2REZ A;  3Q6A A;  5JO2 A;  4N41 A;  3UID A;  3KDH A;  2QPV A;  4IH2 A;  4A8U A;  4Y31 A;  3NMP A;  4MAP A;  2LEQ A;  3RD6 A;  3NMT A;  2E3S A;  4MNS A;  2E3O A;  3TFZ A;  3KAZ A;  4R7K A;  3KDI A;  3Q64 A;  2Q3Q A;  2E3P A;  3TVQ A;  2MOU A;  1BTV A;  1QMR A;  4QCK A;  2BK0 A;  3HO1 A;  2E3Q A;  5I9J A;  1ZXF A;  3GKE A;  2LUZ A;  3NMH A;  4NCB A;  3OTL A;  4B9R A;  2GKD A;  3P51 A;  3NJO A;  4BK6 A;  2FLH A;  1EM2 A;  3H3T A;  3NJ0 A;  4IH0 A;  4A87 A;  3QSZ A;  2A1L A;  2L65 A;  2Z9Z A;  2KEW A;  5JO1 A;  1TXC A;  1XUV A;  4JHI A;  1FM4 A;  4FPW A;  3W9R A;  3KB3 A;  3W9K A;  4JHY A;  4REJ A;  3E85 A;  3ZVU A;  2RES A;  5AMW A;  2LDK A;  4BKD A;  1XFS A;  2VQ5 A;  5EKQ C;  3K3K A;  4REI A;  1LN3 A;  4LG5 A;  1E09 A;  2LE1 A;  4DSB A;  3CNW A;  3Q63 A;  2LAF A;  3NMN A;  3K90 A;  4OIC A;  1TW0 A;  2Z9Y A;  4Z3L A;  4LA7 A;  3DLB A;  4BK7 A;  3WG8 A;  2KCZ A;  3NJ1 A;  3GOB A;  4JHH A;  2VNE A;  3JRQ B;  3GTE A;  1FSK A;  5E46 A;  3RT2 A;  4A8G A;  5I8F A;  5E4B A;  4JDA A;  4QDF B;  2LCG A;  3DLH A;  2M47 A;  4E6F A;  4BTZ A;  2LF2 A;  1UW5 A;  3FO5 A;  4IGY A;  2PSO A;  3ELI A;  4M9B A;  2FFS A;  4RYV A;  3TL1 A;  4A85 A;  4N3E A;  2E3R A;  1Z94 A;  3GL0 A;  3H3Q A;  4Q0K A;  4LGA A;  3HM9 A;  4N47 A;  4QIP A;  4QDC A;  2D4R A;  2I9Y A;  4WVO A;  4C9I A;  1LN2 A;  3NMV A;  4BKC A;  4C9C A;  3GTS A;  3IE5 A;  4JDL A;  5JNN A;  4QDF A;  3UQH A;  3NQN A;  4DSC A;  4IGW A;  2R55 A;  3NR4 A;  3R6P A;  1XDF A;  1X53 A;  2LIO A;  3NEG A;  4XRT A;  2RER A;  1T27 A;  3OJI A;  4A81 A;  3H3S A;  3NEF A;  2N4A A;  3PUT A;  4JHG A;  3HVR A;  2N4B A;  4MA6 A;  3IJT A;  1LN1 A;  2NS9 A;  4PSB A;  5BRL A;  3GL2 A;  3NI8 A;  3HK2 A;  3JRS A;  2YH6 A;  3HXM A;  4KPY A;  2EJX A;  1B6F A;  2LGH A;  1H2O A;  3TVR A;  1XN5 A;  3P9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...