4A84A

Crystal structure of major birch pollen allergen bet v 1 a f30v mutant in complex with deoxycholate.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
GVFNYETETTSVIPAARLFKAFILDGDNLVPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR POLLEN ALLERGEN BET V 1-A
publication title Crystallographically Mapped Ligand Binding Differs in High and Low Ige Binding Isoforms of Birch Pollen Allergen Bet V 1.
pubmed doi rcsb
source organism Betula pendula
molecule tags Allergen
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2011-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 4a84A00
2E3PA 5JNNA 3NJ0A 3NR4A 4BK6A 2WQLA 1TXCA 4FPWA 3C0VA 2N4AA 3UQHA 4A80A 4JHHA 4MA6A 4BKDA 4PSBA 3KAZA 2M47A 5E4MA 1IFVA 2LEQA 2PCSA 3P0LA 4JDAA 2Z9ZA 2R55A 3UIDA 3UJLA 5I8FA 4R7KA 3Q63A 2VNEA 4A81A 2QPVA 1FM4A 3H3SA 4DS8A 4IGXA 2IL5A 4WVOA 5JO2A 4BKCA 1B6FA 3K90A 2NN5A 3TVQA 4BTZA 3KDHA 3KAYA 3H3TA 4A87A 4Z3LA 2E3OA 4REHA 4A8VA 4DSCA 4IGWA 1T27A 2NS9A 4LA7A 2I9YA 1XFSA 1LN1A 3Q64A 3QN1A 2FFSA 2L9PA 3IJTA 4IGVA 3P51A 2LE1A 4DSBA 3P9VA 4A86A 1KCMA 3H3QA 4M9BA 1UW5A 2LF2A 4LGBA 3NJ1A 4N0GC 2BK0A 2K7HA 2MOUA 2PSOA 3CNWA 3KDIA 3NS2A 3R6PA 1H2OA 4Q0KA 1XUVA 1X53A 1BV1A 3OQUA 2RESA 2KF2A 3RT2A 3WG8A 2VQ5A 2E3NA 2M89A 3W9RA 4A8UA 3NMNA 5JO1A 3PUTA 4REJA 4A85A 3ELIA 4XRTA 2KEWA 4LG5A 3NMPA 2A1LA 4C9CA 2REZA 1XDFA 3KL1A 3Q6AA 1ICXA 2LPXA 3TVRA 2Q3QA 3NI8A 3NMTA 4N3EA 1E09A 3K3KA 3F08A 4C94A 2LCGA 1XN6A 2E3QA 4C9IA 2LAKA 3OH8A 2EJXA 3NMVA 4A83A 3NJOA 3TL1A 2LGHA 3JRSA 4B9RA 1TW0A 3IE5A 4JHIA 2N4BA 2GKDA 3RT0C 4JDLA 5BRLA 2KTEA 3RD6A 5AMWA 3QSZA 5I9JA 4M9WA 1XN5A 4A88A 3GGNA 1LN3A 4GY9A 3KB0A 1BTVA 4MAPA 2FLHA 2E3SA 2RERA 3E85A 3PU2A 4MNSA 3TFZA 3ZVUA 2Z9YA 4RYVA 1QMRA 3KDJA 2E3MA 3KLXA 4Y31A 4A84A 3FO5A 1ZXFA 4IH2A 1FSKA 1EM2A 2LDKA 4OICA 2KCZA 1LN2A 4LGAA 5C9YA 4XRWA 3NEGA 2LUZA 4JHGA 4A8GA 2D4RA 3NEFA 4QIPA 4REIA 5E46A 4IH0A 5E4DA 3OJIA 2QIMA 1JSSA 1Z94A 3W9KA 1LLTA 2K5GA 2L8OA 5E4BA 3H3RA 1T17A 3OTLA 3NMHA 3KB3A 1VJHA 2L65A 4IGYA 2LIOA 4IHRA 4BK7A 3JRQB 2E3RA
chains in the Genus database with same CATH superfamily
2E3PA 5JNNA 3NJ0A 3NR4A 4BK6A 3F73A 2WQLA 1TXCA 4FPWA 3HVRA 3C0VA 2N4AA 2ZYLA 3UQHA 1H2OA 4A80A 2YH6A 4JHHA 4MA6A 4BKDA 4PSBA 3KAZA 4N76A 2M47A 5E4MA 1IFVA 2LEQA 2PCSA 3P0LA 4JDAA 2Z9ZA 2R55A 3UIDA 3UJLA 5I8FA 3TGOC 4R7KA 3Q63A 2VNEA 4A81A 2QPVA 1FM4A 3H3SA 4DS8A 4IGXA 2IL5A 4WVOA 5JO2A 4BKCA 1B6FA 3K90A 2NN5A 3TVQA 4BTZA 3KDHA 3GTEA 3H3TA 3KAYA 4A87A 2E3OA 4REHA 4A8VA 4DSCA 4Z3LA 4N41A 3HK2A 4IGWA 3GB4A 1T27A 2NS9A 4LA7A 2I9YA 1XFSA 1LN1A 3Q64A 3QN1A 2FFSA 2L9PA 3IJTA 4IGVA 3P51A 2LE1A 4DSBA 3P9VA 4A86A 4KPYA 1KCMA 3H3QA 4M9BA 4NCAA 1UW5A 2LF2A 3GKEA 3NJ1A 4LGBA 2BK0A 2K7HA 2MOUA 2PSOA 3CNWA 3KDIA 3NS2A 3NQNA 3R6PA 4Q0KA 1XUVA 1X53A 1BV1A 3OQUA 3DLHA 2RESA 2KF2A 3RT2A 3WG8A 2VQ5A 2E3NA 2M89A 3W9RA 4A8UA 3NMNA 5JO1A 3PUTA 4REJA 4A85A 4E6FA 4N0GC 3ELIA 4XRTA 2KEWA 4LG5A 3NMPA 4QDFB 2A1LA 4C9CA 2REZA 1XDFA 3KL1A 3Q6AA 1ICXA 2LPXA 3TVRA 2Q3QA 3NI8A 3NMTA 4N3EA 1E09A 3K3KA 3F08A 4QDDA 4C94A 2LCGA 1XN6A 2E3QA 4C9IA 2LAKA 3OH8A 2EJXA 3NMVA 4A83A 3NJOA 3TL1A 2LGHA 3JRSA 4B9RA 3HM9A 1TW0A 4N47A 3IE5A 4JHIA 2N4BA 4QCKA 4QDFA 3RT0C 4JDLA 2GKDA 5BRLA 2KTEA 2LAFA 3GL2A 3GOBA 3RD6A 5AMWA 3QSZA 5I9JA 4QDCA 4M9WA 1XN5A 4A88A 3GGNA 1LN3A 4GY9A 3KB0A 1BTVA 3DLBA 4MAPA 2FLHA 2E3SA 2RERA 3E85A 3PU2A 4MNSA 3TFZA 3ZVUA 2Z9YA 4RYVA 1QMRA 3KDJA 2E3MA 3KLXA 4Y31A 3GL0A 4JHYA 3HJFA 4A84A 3FO5A 1ZXFA 4IH2A 1FSKA 1EM2A 2LDKA 4OICA 2KCZA 1LN2A 4LGAA 5C9YA 3HXMA 4XRWA 3NEGA 2LUZA 4JHGA 4A8GA 5EKQC 2D4RA 3NEFA 4QIPA 4REIA 5E46A 4IH0A 5E4DA 3GTSA 3OJIA 2QIMA 1JSSA 1Z94A 3W9KA 1LLTA 2K5GA 2L8OA 4NCBA 5E4BA 3H3RA 1T17A 3OTLA 3NMHA 3KB3A 1VJHA 2L65A 3HO1A 4IGYA 2LIOA 4IHRA 4BK7A 3JRQB 2E3RA
chains in the Genus database with same CATH topology
2E3PA 5JNNA 3NJ0A 3NR4A 4BK6A 3F73A 2WQLA 1TXCA 4FPWA 3HVRA 3C0VA 2N4AA 2ZYLA 3UQHA 1H2OA 4A80A 2YH6A 4JHHA 4MA6A 4BKDA 4PSBA 3KAZA 4N76A 2M47A 5E4MA 1IFVA 2LEQA 2PCSA 3P0LA 4JDAA 2Z9ZA 2R55A 3UIDA 3UJLA 5I8FA 3TGOC 4R7KA 3Q63A 2VNEA 4A81A 2QPVA 1FM4A 3H3SA 4DS8A 4IGXA 2IL5A 4WVOA 5JO2A 4BKCA 1B6FA 3K90A 2NN5A 3TVQA 4BTZA 3KDHA 3GTEA 3H3TA 3KAYA 4A87A 2E3OA 4REHA 4A8VA 4DSCA 4Z3LA 4N41A 3HK2A 4IGWA 3GB4A 1T27A 2NS9A 4LA7A 2I9YA 1XFSA 1LN1A 3Q64A 3QN1A 2FFSA 2L9PA 3IJTA 4IGVA 3P51A 2LE1A 4DSBA 3P9VA 4A86A 4KPYA 1KCMA 3H3QA 4M9BA 4NCAA 1UW5A 2LF2A 3GKEA 3NJ1A 4LGBA 2BK0A 2K7HA 2MOUA 2PSOA 3CNWA 3KDIA 3NS2A 3NQNA 3R6PA 4Q0KA 1XUVA 1X53A 1BV1A 3OQUA 3DLHA 2RESA 2KF2A 3RT2A 3WG8A 2VQ5A 2E3NA 2M89A 3W9RA 4A8UA 3NMNA 5JO1A 3PUTA 4REJA 4A85A 4E6FA 4N0GC 3ELIA 4XRTA 2KEWA 4LG5A 3NMPA 4QDFB 2A1LA 4C9CA 2REZA 1XDFA 3KL1A 3Q6AA 1ICXA 2LPXA 3TVRA 2Q3QA 3NI8A 3NMTA 4N3EA 1E09A 3K3KA 3F08A 4QDDA 4C94A 2LCGA 1XN6A 2E3QA 4C9IA 2LAKA 3OH8A 2EJXA 3NMVA 4A83A 3NJOA 3TL1A 2LGHA 3JRSA 4B9RA 3HM9A 1TW0A 4N47A 3IE5A 4JHIA 2N4BA 4QCKA 4QDFA 3RT0C 4JDLA 2GKDA 5BRLA 2KTEA 2LAFA 3GL2A 3GOBA 3RD6A 5AMWA 3QSZA 5I9JA 4QDCA 4M9WA 1XN5A 4A88A 3GGNA 1LN3A 4GY9A 3KB0A 1BTVA 3DLBA 4MAPA 2FLHA 2E3SA 2RERA 3E85A 3PU2A 4MNSA 3TFZA 3ZVUA 2Z9YA 4RYVA 1QMRA 3KDJA 2E3MA 3KLXA 4Y31A 3GL0A 4JHYA 3HJFA 4A84A 3FO5A 1ZXFA 4IH2A 1FSKA 1EM2A 2LDKA 4OICA 2KCZA 1LN2A 4LGAA 5C9YA 3HXMA 4XRWA 3NEGA 2LUZA 4JHGA 4A8GA 5EKQC 2D4RA 3NEFA 4QIPA 4REIA 5E46A 4IH0A 5E4DA 3GTSA 3OJIA 2QIMA 1JSSA 1Z94A 3W9KA 1LLTA 2K5GA 2L8OA 4NCBA 5E4BA 3H3RA 1T17A 3OTLA 3NMHA 3KB3A 1VJHA 2L65A 3HO1A 4IGYA 2LIOA 4IHRA 4BK7A 3JRQB 2E3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3P A;  5JNN A;  3NJ0 A;  3NR4 A;  4BK6 A;  2WQL A;  1TXC A;  4FPW A;  3C0V A;  2N4A A;  3UQH A;  4A80 A;  4JHH A;  4MA6 A;  4BKD A;  4PSB A;  3KAZ A;  2M47 A;  5E4M A;  1IFV A;  2LEQ A;  2PCS A;  3P0L A;  4JDA A;  2Z9Z A;  2R55 A;  3UID A;  3UJL A;  5I8F A;  4R7K A;  3Q63 A;  2VNE A;  4A81 A;  2QPV A;  1FM4 A;  3H3S A;  4DS8 A;  4IGX A;  2IL5 A;  4WVO A;  5JO2 A;  4BKC A;  1B6F A;  3K90 A;  2NN5 A;  3TVQ A;  4BTZ A;  3KDH A;  3KAY A;  3H3T A;  4A87 A;  4Z3L A;  2E3O A;  4REH A;  4A8V A;  4DSC A;  4IGW A;  1T27 A;  2NS9 A;  4LA7 A;  2I9Y A;  1XFS A;  1LN1 A;  3Q64 A;  3QN1 A;  2FFS A;  2L9P A;  3IJT A;  4IGV A;  3P51 A;  2LE1 A;  4DSB A;  3P9V A;  4A86 A;  1KCM A;  3H3Q A;  4M9B A;  1UW5 A;  2LF2 A;  4LGB A;  3NJ1 A;  4N0G C;  2BK0 A;  2K7H A;  2MOU A;  2PSO A;  3CNW A;  3KDI A;  3NS2 A;  3R6P A;  1H2O A;  4Q0K A;  1XUV A;  1X53 A;  1BV1 A;  3OQU A;  2RES A;  2KF2 A;  3RT2 A;  3WG8 A;  2VQ5 A;  2E3N A;  2M89 A;  3W9R A;  4A8U A;  3NMN A;  5JO1 A;  3PUT A;  4REJ A;  4A85 A;  3ELI A;  4XRT A;  2KEW A;  4LG5 A;  3NMP A;  2A1L A;  4C9C A;  2REZ A;  1XDF A;  3KL1 A;  3Q6A A;  1ICX A;  2LPX A;  3TVR A;  2Q3Q A;  3NI8 A;  3NMT A;  4N3E A;  1E09 A;  3K3K A;  3F08 A;  4C94 A;  2LCG A;  1XN6 A;  2E3Q A;  4C9I A;  2LAK A;  3OH8 A;  2EJX A;  3NMV A;  4A83 A;  3NJO A;  3TL1 A;  2LGH A;  3JRS A;  4B9R A;  1TW0 A;  3IE5 A;  4JHI A;  2N4B A;  2GKD A;  3RT0 C;  4JDL A;  5BRL A;  2KTE A;  3RD6 A;  5AMW A;  3QSZ A;  5I9J A;  4M9W A;  1XN5 A;  4A88 A;  3GGN A;  1LN3 A;  4GY9 A;  3KB0 A;  1BTV A;  4MAP A;  2FLH A;  2E3S A;  2RER A;  3E85 A;  3PU2 A;  4MNS A;  3TFZ A;  3ZVU A;  2Z9Y A;  4RYV A;  1QMR A;  3KDJ A;  2E3M A;  3KLX A;  4Y31 A;  4A84 A;  3FO5 A;  1ZXF A;  4IH2 A;  1FSK A;  1EM2 A;  2LDK A;  4OIC A;  2KCZ A;  1LN2 A;  4LGA A;  5C9Y A;  4XRW A;  3NEG A;  2LUZ A;  4JHG A;  4A8G A;  2D4R A;  3NEF A;  4QIP A;  4REI A;  5E46 A;  4IH0 A;  5E4D A;  3OJI A;  2QIM A;  1JSS A;  1Z94 A;  3W9K A;  1LLT A;  2K5G A;  2L8O A;  5E4B A;  3H3R A;  1T17 A;  3OTL A;  3NMH A;  3KB3 A;  1VJH A;  2L65 A;  4IGY A;  2LIO A;  4IHR A;  4BK7 A;  3JRQ B;  2E3R A; 
#chains in the Genus database with same CATH topology
 2E3P A;  5JNN A;  3NJ0 A;  3NR4 A;  4BK6 A;  3F73 A;  2WQL A;  1TXC A;  4FPW A;  3HVR A;  3C0V A;  2N4A A;  2ZYL A;  3UQH A;  1H2O A;  4A80 A;  2YH6 A;  4JHH A;  4MA6 A;  4BKD A;  4PSB A;  3KAZ A;  4N76 A;  2M47 A;  5E4M A;  1IFV A;  2LEQ A;  2PCS A;  3P0L A;  4JDA A;  2Z9Z A;  2R55 A;  3UID A;  3UJL A;  5I8F A;  3TGO C;  4R7K A;  3Q63 A;  2VNE A;  4A81 A;  2QPV A;  1FM4 A;  3H3S A;  4DS8 A;  4IGX A;  2IL5 A;  4WVO A;  5JO2 A;  4BKC A;  1B6F A;  3K90 A;  2NN5 A;  3TVQ A;  4BTZ A;  3KDH A;  3GTE A;  3H3T A;  3KAY A;  4A87 A;  2E3O A;  4REH A;  4A8V A;  4DSC A;  4Z3L A;  4N41 A;  3HK2 A;  4IGW A;  3GB4 A;  1T27 A;  2NS9 A;  4LA7 A;  2I9Y A;  1XFS A;  1LN1 A;  3Q64 A;  3QN1 A;  2FFS A;  2L9P A;  3IJT A;  4IGV A;  3P51 A;  2LE1 A;  4DSB A;  3P9V A;  4A86 A;  4KPY A;  1KCM A;  3H3Q A;  4M9B A;  4NCA A;  1UW5 A;  2LF2 A;  3GKE A;  3NJ1 A;  4LGB A;  2BK0 A;  2K7H A;  2MOU A;  2PSO A;  3CNW A;  3KDI A;  3NS2 A;  3NQN A;  3R6P A;  4Q0K A;  1XUV A;  1X53 A;  1BV1 A;  3OQU A;  3DLH A;  2RES A;  2KF2 A;  3RT2 A;  3WG8 A;  2VQ5 A;  2E3N A;  2M89 A;  3W9R A;  4A8U A;  3NMN A;  5JO1 A;  3PUT A;  4REJ A;  4A85 A;  4E6F A;  4N0G C;  3ELI A;  4XRT A;  2KEW A;  4LG5 A;  3NMP A;  4QDF B;  2A1L A;  4C9C A;  2REZ A;  1XDF A;  3KL1 A;  3Q6A A;  1ICX A;  2LPX A;  3TVR A;  2Q3Q A;  3NI8 A;  3NMT A;  4N3E A;  1E09 A;  3K3K A;  3F08 A;  4QDD A;  4C94 A;  2LCG A;  1XN6 A;  2E3Q A;  4C9I A;  2LAK A;  3OH8 A;  2EJX A;  3NMV A;  4A83 A;  3NJO A;  3TL1 A;  2LGH A;  3JRS A;  4B9R A;  3HM9 A;  1TW0 A;  4N47 A;  3IE5 A;  4JHI A;  2N4B A;  4QCK A;  4QDF A;  3RT0 C;  4JDL A;  2GKD A;  5BRL A;  2KTE A;  2LAF A;  3GL2 A;  3GOB A;  3RD6 A;  5AMW A;  3QSZ A;  5I9J A;  4QDC A;  4M9W A;  1XN5 A;  4A88 A;  3GGN A;  1LN3 A;  4GY9 A;  3KB0 A;  1BTV A;  3DLB A;  4MAP A;  2FLH A;  2E3S A;  2RER A;  3E85 A;  3PU2 A;  4MNS A;  3TFZ A;  3ZVU A;  2Z9Y A;  4RYV A;  1QMR A;  3KDJ A;  2E3M A;  3KLX A;  4Y31 A;  3GL0 A;  4JHY A;  3HJF A;  4A84 A;  3FO5 A;  1ZXF A;  4IH2 A;  1FSK A;  1EM2 A;  2LDK A;  4OIC A;  2KCZ A;  1LN2 A;  4LGA A;  5C9Y A;  3HXM A;  4XRW A;  3NEG A;  2LUZ A;  4JHG A;  4A8G A;  5EKQ C;  2D4R A;  3NEF A;  4QIP A;  4REI A;  5E46 A;  4IH0 A;  5E4D A;  3GTS A;  3OJI A;  2QIM A;  1JSS A;  1Z94 A;  3W9K A;  1LLT A;  2K5G A;  2L8O A;  4NCB A;  5E4B A;  3H3R A;  1T17 A;  3OTL A;  3NMH A;  3KB3 A;  1VJH A;  2L65 A;  3HO1 A;  4IGY A;  2LIO A;  4IHR A;  4BK7 A;  3JRQ B;  2E3R A; 
#chains in the Genus database with same CATH homology
 2E3P A;  5JNN A;  3NJ0 A;  3NR4 A;  4BK6 A;  3F73 A;  2WQL A;  1TXC A;  4FPW A;  3HVR A;  3C0V A;  2N4A A;  2ZYL A;  3UQH A;  1H2O A;  4A80 A;  2YH6 A;  4JHH A;  4MA6 A;  4BKD A;  4PSB A;  3KAZ A;  4N76 A;  2M47 A;  5E4M A;  1IFV A;  2LEQ A;  2PCS A;  3P0L A;  4JDA A;  2Z9Z A;  2R55 A;  3UID A;  3UJL A;  5I8F A;  3TGO C;  4R7K A;  3Q63 A;  2VNE A;  4A81 A;  2QPV A;  1FM4 A;  3H3S A;  4DS8 A;  4IGX A;  2IL5 A;  4WVO A;  5JO2 A;  4BKC A;  1B6F A;  3K90 A;  2NN5 A;  3TVQ A;  4BTZ A;  3KDH A;  3GTE A;  3H3T A;  3KAY A;  4A87 A;  2E3O A;  4REH A;  4A8V A;  4DSC A;  4Z3L A;  4N41 A;  3HK2 A;  4IGW A;  3GB4 A;  1T27 A;  2NS9 A;  4LA7 A;  2I9Y A;  1XFS A;  1LN1 A;  3Q64 A;  3QN1 A;  2FFS A;  2L9P A;  3IJT A;  4IGV A;  3P51 A;  2LE1 A;  4DSB A;  3P9V A;  4A86 A;  4KPY A;  1KCM A;  3H3Q A;  4M9B A;  4NCA A;  1UW5 A;  2LF2 A;  3GKE A;  3NJ1 A;  4LGB A;  2BK0 A;  2K7H A;  2MOU A;  2PSO A;  3CNW A;  3KDI A;  3NS2 A;  3NQN A;  3R6P A;  4Q0K A;  1XUV A;  1X53 A;  1BV1 A;  3OQU A;  3DLH A;  2RES A;  2KF2 A;  3RT2 A;  3WG8 A;  2VQ5 A;  2E3N A;  2M89 A;  3W9R A;  4A8U A;  3NMN A;  5JO1 A;  3PUT A;  4REJ A;  4A85 A;  4E6F A;  4N0G C;  3ELI A;  4XRT A;  2KEW A;  4LG5 A;  3NMP A;  4QDF B;  2A1L A;  4C9C A;  2REZ A;  1XDF A;  3KL1 A;  3Q6A A;  1ICX A;  2LPX A;  3TVR A;  2Q3Q A;  3NI8 A;  3NMT A;  4N3E A;  1E09 A;  3K3K A;  3F08 A;  4QDD A;  4C94 A;  2LCG A;  1XN6 A;  2E3Q A;  4C9I A;  2LAK A;  3OH8 A;  2EJX A;  3NMV A;  4A83 A;  3NJO A;  3TL1 A;  2LGH A;  3JRS A;  4B9R A;  3HM9 A;  1TW0 A;  4N47 A;  3IE5 A;  4JHI A;  2N4B A;  4QCK A;  4QDF A;  3RT0 C;  4JDL A;  2GKD A;  5BRL A;  2KTE A;  2LAF A;  3GL2 A;  3GOB A;  3RD6 A;  5AMW A;  3QSZ A;  5I9J A;  4QDC A;  4M9W A;  1XN5 A;  4A88 A;  3GGN A;  1LN3 A;  4GY9 A;  3KB0 A;  1BTV A;  3DLB A;  4MAP A;  2FLH A;  2E3S A;  2RER A;  3E85 A;  3PU2 A;  4MNS A;  3TFZ A;  3ZVU A;  2Z9Y A;  4RYV A;  1QMR A;  3KDJ A;  2E3M A;  3KLX A;  4Y31 A;  3GL0 A;  4JHY A;  3HJF A;  4A84 A;  3FO5 A;  1ZXF A;  4IH2 A;  1FSK A;  1EM2 A;  2LDK A;  4OIC A;  2KCZ A;  1LN2 A;  4LGA A;  5C9Y A;  3HXM A;  4XRW A;  3NEG A;  2LUZ A;  4JHG A;  4A8G A;  5EKQ C;  2D4R A;  3NEF A;  4QIP A;  4REI A;  5E46 A;  4IH0 A;  5E4D A;  3GTS A;  3OJI A;  2QIM A;  1JSS A;  1Z94 A;  3W9K A;  1LLT A;  2K5G A;  2L8O A;  4NCB A;  5E4B A;  3H3R A;  1T17 A;  3OTL A;  3NMH A;  3KB3 A;  1VJH A;  2L65 A;  3HO1 A;  4IGY A;  2LIO A;  4IHR A;  4BK7 A;  3JRQ B;  2E3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...