3RT0C

Crystal structure of pyl10-hab1 complex in the absence of abscisic acid (aba)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
172
structure length
172
Chain Sequence
b'VESEYIKKHHRHELVESQCSSTLVKHIKAPLHLVWSIVRRFDEPQKYKPFISRCVVQGKKLEVGSVREVDLKSGLPATKSTEVLEILDDNEHILGIRIVGGDHRLKNYSSTISLHSETIDGKTGTLAIESFVVDVPEGNTKEETCFFVEALIQSNLNSLADVTERLQAESME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 2C 16
publication title The Molecular Basis of ABA-Independent Inhibition of PP2Cs by a Subclass of PYL Proteins
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 172
sequence length 172
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3rt0C00
2KCZA 2M47A 2N4AA 3H3SA 5BRLA 3TFZA 3Q64A 1UW5A 3H3QA 2LCGA 2LPXA 2E3SA 3JRSA 2LAKA 4JDLA 4M9WA 4PSBA 3NR4A 4Z3LA 3IJTA 3KAYA 4REHA 4A88A 4IGWA 4WVOA 3UJLA 2R55A 3RT0C 2E3MA 1XFSA 2LGHA 3NMPA 3OJIA 5E46A 3TL1A 3W9RA 4IH2A 3P9VA 4BK7A 2LEQA 4A87A 1XUVA 5E4DA 3NMVA 2LF2A 4IGXA 4A86A 3KLXA 4A85A 3NMTA 2E3NA 1ZXFA 3NEGA 1BTVA 3P0LA 4DS8A 4XRWA 3NJ1A 3NJOA 2A1LA 5E4MA 3KDJA 2Z9YA 4FPWA 4N3EA 2REZA 3OH8A 3NMNA 1VJHA 2L8OA 3QN1A 4MAPA 1JSSA 4A8VA 1B6FA 1XN5A 4JHGA 2E3RA 4BTZA 2K7HA 2E3OA 2KEWA 3GGNA 4OICA 5I8FA 5I9JA 4LGBA 4R7KA 4MNSA 3Q6AA 2KF2A 4A84A 3KDHA 2LUZA 3KB3A 1E09A 2LIOA 3ELIA 2BK0A 3K3KA 3PUTA 3OQUA 4JHIA 2GKDA 4REIA 3JRQB 4RYVA 1KCMA 2RESA 2Q3QA 4IHRA 3RT2A 2K5GA 2M89A 3ZVUA 1FM4A 3KB0A 4C94A 4A8GA 4MA6A 4QIPA 2L9PA 4A8UA 5JNNA 4Y31A 3F08A 5AMWA 4IGYA 2VNEA 3KDIA 1XN6A 1T17A 2RERA 3KAZA 3IE5A 2FFSA 2IL5A 5C9YA 5JO2A 4DSBA 4M9BA 2L65A 2WQLA 3NS2A 4BKCA 3P51A 4JDAA 1XDFA 1H2OA 1LN2A 3OTLA 1LN3A 4BKDA 2LE1A 5JO1A 2MOUA 3NI8A 4C9IA 2QIMA 3C0VA 3WG8A 1EM2A 3TVRA 4B9RA 2PSOA 3FO5A 1IFVA 3NMHA 4LGAA 3CNWA 3KL1A 3H3TA 4LG5A 1X53A 4IGVA 3NJ0A 4C9CA 3R6PA 2I9YA 4BK6A 1ICXA 1BV1A 1FSKA 3H3RA 3NEFA 4JHHA 3PU2A 1LLTA 1TW0A 1TXCA 2FLHA 2LDKA 3QSZA 1QMRA 3K90A 4XRTA 2N4BA 2NS9A 2VQ5A 3TVQA 2QPVA 3E85A 4DSCA 1LN1A 4A81A 2EJXA 4LA7A 1Z94A 4A83A 3W9KA 2Z9ZA 3UQHA 4N0GC 5E4BA 4GY9A 2KTEA 3RD6A 4REJA 4A80A 4Q0KA 3Q63A 3UIDA 4IH0A 2E3QA 1T27A 2NN5A 2PCSA 2E3PA 2D4RA
chains in the Genus database with same CATH superfamily
2KCZA 2M47A 2N4AA 3H3SA 5BRLA 3TFZA 3Q64A 1UW5A 3H3QA 2LCGA 2LPXA 2E3SA 3JRSA 2LAKA 4JDLA 4M9WA 4PSBA 3NR4A 4Z3LA 3IJTA 3KAYA 4REHA 4A88A 4IGWA 4WVOA 3UJLA 2R55A 3RT0C 2E3MA 4N76A 1XFSA 2LGHA 3NMPA 3OJIA 5E46A 3TL1A 3W9RA 4IH2A 3P9VA 4KPYA 4BK7A 2LEQA 4A87A 1XUVA 2LAFA 4QDCA 3NMVA 2LF2A 4IGXA 5E4DA 4A86A 3KLXA 4NCBA 4A85A 3NMTA 2E3NA 3GL2A 1ZXFA 3NEGA 1BTVA 3P0LA 4DS8A 5EKQC 4XRWA 3NJ1A 3NJOA 2A1LA 5E4MA 3KDJA 2Z9YA 4FPWA 4N3EA 2REZA 3OH8A 3NMNA 1VJHA 2L8OA 3QN1A 4MAPA 1JSSA 4A8VA 1B6FA 1XN5A 4JHGA 3DLBA 2E3RA 4BTZA 2K7HA 2E3OA 2KEWA 3GGNA 4OICA 3NQNA 5I8FA 3HM9A 3DLHA 5I9JA 4LGBA 4R7KA 4MNSA 3Q6AA 3HVRA 2KF2A 4A84A 4N41A 3KDHA 4QDFB 4QDDA 2LUZA 3KB3A 1E09A 2LIOA 3ELIA 3HXMA 2BK0A 3GTSA 3K3KA 3PUTA 3OQUA 4JHIA 2GKDA 3GTEA 3JRQB 4REIA 4RYVA 1KCMA 2RESA 3GKEA 2Q3QA 4IHRA 3RT2A 2K5GA 2M89A 3GOBA 3ZVUA 1FM4A 3KB0A 4C94A 4A8GA 3HO1A 4MA6A 4QIPA 3HJFA 2L9PA 4A8UA 5JNNA 4Y31A 3F08A 5AMWA 4IGYA 2VNEA 3KDIA 1XN6A 1T17A 2RERA 3KAZA 3IE5A 2FFSA 2IL5A 4JHYA 5C9YA 4DSBA 5JO2A 4M9BA 2L65A 2WQLA 3NS2A 4BKCA 3P51A 4JDAA 1XDFA 4QCKA 1H2OA 3GL0A 1LN2A 3OTLA 1LN3A 4BKDA 2LE1A 5JO1A 2MOUA 3NI8A 4C9IA 2QIMA 2ZYLA 3C0VA 4N47A 3WG8A 1EM2A 3TVRA 4B9RA 2PSOA 3FO5A 1IFVA 3TGOC 3NMHA 4LGAA 3CNWA 3KL1A 3H3TA 4LG5A 1X53A 4IGVA 3NJ0A 3F73A 3HK2A 4C9CA 3R6PA 2I9YA 2YH6A 4BK6A 1ICXA 1BV1A 1FSKA 3H3RA 3NEFA 4JHHA 3PU2A 1LLTA 1TW0A 1TXCA 2FLHA 2LDKA 3QSZA 1QMRA 3K90A 4XRTA 2N4BA 2NS9A 2VQ5A 3TVQA 2QPVA 3E85A 4DSCA 1LN1A 4NCAA 4A81A 2EJXA 4LA7A 1Z94A 4A83A 3W9KA 2Z9ZA 3UQHA 4N0GC 5E4BA 4GY9A 2KTEA 3GB4A 4REJA 3RD6A 4A80A 4Q0KA 3Q63A 4QDFA 3UIDA 4IH0A 2E3QA 1T27A 2NN5A 4E6FA 2PCSA 2E3PA 2D4RA
chains in the Genus database with same CATH topology
2KCZA 2M47A 2N4AA 3H3SA 5BRLA 3TFZA 3Q64A 1UW5A 3H3QA 2LCGA 2LPXA 2E3SA 3JRSA 2LAKA 4JDLA 4M9WA 4PSBA 3NR4A 4Z3LA 3IJTA 3KAYA 4REHA 4A88A 4IGWA 4WVOA 3UJLA 2R55A 3RT0C 2E3MA 4N76A 1XFSA 2LGHA 3NMPA 3OJIA 5E46A 3TL1A 3W9RA 4IH2A 3P9VA 4KPYA 4BK7A 2LEQA 4A87A 1XUVA 2LAFA 4QDCA 3NMVA 2LF2A 4IGXA 5E4DA 4A86A 3KLXA 4NCBA 4A85A 3NMTA 2E3NA 3GL2A 1ZXFA 3NEGA 1BTVA 3P0LA 4DS8A 5EKQC 4XRWA 3NJ1A 3NJOA 2A1LA 5E4MA 3KDJA 2Z9YA 4FPWA 4N3EA 2REZA 3OH8A 3NMNA 1VJHA 2L8OA 3QN1A 4MAPA 1JSSA 4A8VA 1B6FA 1XN5A 4JHGA 3DLBA 2E3RA 4BTZA 2K7HA 2E3OA 2KEWA 3GGNA 4OICA 3NQNA 5I8FA 3HM9A 3DLHA 5I9JA 4LGBA 4R7KA 4MNSA 3Q6AA 3HVRA 2KF2A 4A84A 4N41A 3KDHA 4QDFB 4QDDA 2LUZA 3KB3A 1E09A 2LIOA 3ELIA 3HXMA 2BK0A 3GTSA 3K3KA 3PUTA 3OQUA 4JHIA 2GKDA 3GTEA 3JRQB 4REIA 4RYVA 1KCMA 2RESA 3GKEA 2Q3QA 4IHRA 3RT2A 2K5GA 2M89A 3GOBA 3ZVUA 1FM4A 3KB0A 4C94A 4A8GA 3HO1A 4MA6A 4QIPA 3HJFA 2L9PA 4A8UA 5JNNA 4Y31A 3F08A 5AMWA 4IGYA 2VNEA 3KDIA 1XN6A 1T17A 2RERA 3KAZA 3IE5A 2FFSA 2IL5A 4JHYA 5C9YA 4DSBA 5JO2A 4M9BA 2L65A 2WQLA 3NS2A 4BKCA 3P51A 4JDAA 1XDFA 4QCKA 1H2OA 3GL0A 1LN2A 3OTLA 1LN3A 4BKDA 2LE1A 5JO1A 2MOUA 3NI8A 4C9IA 2QIMA 2ZYLA 3C0VA 4N47A 3WG8A 1EM2A 3TVRA 4B9RA 2PSOA 3FO5A 1IFVA 3TGOC 3NMHA 4LGAA 3CNWA 3KL1A 3H3TA 4LG5A 1X53A 4IGVA 3NJ0A 3F73A 3HK2A 4C9CA 3R6PA 2I9YA 2YH6A 4BK6A 1ICXA 1BV1A 1FSKA 3H3RA 3NEFA 4JHHA 3PU2A 1LLTA 1TW0A 1TXCA 2FLHA 2LDKA 3QSZA 1QMRA 3K90A 4XRTA 2N4BA 2NS9A 2VQ5A 3TVQA 2QPVA 3E85A 4DSCA 1LN1A 4NCAA 4A81A 2EJXA 4LA7A 1Z94A 4A83A 3W9KA 2Z9ZA 3UQHA 4N0GC 5E4BA 4GY9A 2KTEA 3GB4A 4REJA 3RD6A 4A80A 4Q0KA 3Q63A 4QDFA 3UIDA 4IH0A 2E3QA 1T27A 2NN5A 4E6FA 2PCSA 2E3PA 2D4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCZ A;  2M47 A;  2N4A A;  3H3S A;  5BRL A;  3TFZ A;  3Q64 A;  1UW5 A;  3H3Q A;  2LCG A;  2LPX A;  2E3S A;  3JRS A;  2LAK A;  4JDL A;  4M9W A;  4PSB A;  3NR4 A;  4Z3L A;  3IJT A;  3KAY A;  4REH A;  4A88 A;  4IGW A;  4WVO A;  3UJL A;  2R55 A;  3RT0 C;  2E3M A;  1XFS A;  2LGH A;  3NMP A;  3OJI A;  5E46 A;  3TL1 A;  3W9R A;  4IH2 A;  3P9V A;  4BK7 A;  2LEQ A;  4A87 A;  1XUV A;  5E4D A;  3NMV A;  2LF2 A;  4IGX A;  4A86 A;  3KLX A;  4A85 A;  3NMT A;  2E3N A;  1ZXF A;  3NEG A;  1BTV A;  3P0L A;  4DS8 A;  4XRW A;  3NJ1 A;  3NJO A;  2A1L A;  5E4M A;  3KDJ A;  2Z9Y A;  4FPW A;  4N3E A;  2REZ A;  3OH8 A;  3NMN A;  1VJH A;  2L8O A;  3QN1 A;  4MAP A;  1JSS A;  4A8V A;  1B6F A;  1XN5 A;  4JHG A;  2E3R A;  4BTZ A;  2K7H A;  2E3O A;  2KEW A;  3GGN A;  4OIC A;  5I8F A;  5I9J A;  4LGB A;  4R7K A;  4MNS A;  3Q6A A;  2KF2 A;  4A84 A;  3KDH A;  2LUZ A;  3KB3 A;  1E09 A;  2LIO A;  3ELI A;  2BK0 A;  3K3K A;  3PUT A;  3OQU A;  4JHI A;  2GKD A;  4REI A;  3JRQ B;  4RYV A;  1KCM A;  2RES A;  2Q3Q A;  4IHR A;  3RT2 A;  2K5G A;  2M89 A;  3ZVU A;  1FM4 A;  3KB0 A;  4C94 A;  4A8G A;  4MA6 A;  4QIP A;  2L9P A;  4A8U A;  5JNN A;  4Y31 A;  3F08 A;  5AMW A;  4IGY A;  2VNE A;  3KDI A;  1XN6 A;  1T17 A;  2RER A;  3KAZ A;  3IE5 A;  2FFS A;  2IL5 A;  5C9Y A;  5JO2 A;  4DSB A;  4M9B A;  2L65 A;  2WQL A;  3NS2 A;  4BKC A;  3P51 A;  4JDA A;  1XDF A;  1H2O A;  1LN2 A;  3OTL A;  1LN3 A;  4BKD A;  2LE1 A;  5JO1 A;  2MOU A;  3NI8 A;  4C9I A;  2QIM A;  3C0V A;  3WG8 A;  1EM2 A;  3TVR A;  4B9R A;  2PSO A;  3FO5 A;  1IFV A;  3NMH A;  4LGA A;  3CNW A;  3KL1 A;  3H3T A;  4LG5 A;  1X53 A;  4IGV A;  3NJ0 A;  4C9C A;  3R6P A;  2I9Y A;  4BK6 A;  1ICX A;  1BV1 A;  1FSK A;  3H3R A;  3NEF A;  4JHH A;  3PU2 A;  1LLT A;  1TW0 A;  1TXC A;  2FLH A;  2LDK A;  3QSZ A;  1QMR A;  3K90 A;  4XRT A;  2N4B A;  2NS9 A;  2VQ5 A;  3TVQ A;  2QPV A;  3E85 A;  4DSC A;  1LN1 A;  4A81 A;  2EJX A;  4LA7 A;  1Z94 A;  4A83 A;  3W9K A;  2Z9Z A;  3UQH A;  4N0G C;  5E4B A;  4GY9 A;  2KTE A;  3RD6 A;  4REJ A;  4A80 A;  4Q0K A;  3Q63 A;  3UID A;  4IH0 A;  2E3Q A;  1T27 A;  2NN5 A;  2PCS A;  2E3P A;  2D4R A; 
#chains in the Genus database with same CATH topology
 2KCZ A;  2M47 A;  2N4A A;  3H3S A;  5BRL A;  3TFZ A;  3Q64 A;  1UW5 A;  3H3Q A;  2LCG A;  2LPX A;  2E3S A;  3JRS A;  2LAK A;  4JDL A;  4M9W A;  4PSB A;  3NR4 A;  4Z3L A;  3IJT A;  3KAY A;  4REH A;  4A88 A;  4IGW A;  4WVO A;  3UJL A;  2R55 A;  3RT0 C;  2E3M A;  4N76 A;  1XFS A;  2LGH A;  3NMP A;  3OJI A;  5E46 A;  3TL1 A;  3W9R A;  4IH2 A;  3P9V A;  4KPY A;  4BK7 A;  2LEQ A;  4A87 A;  1XUV A;  2LAF A;  4QDC A;  3NMV A;  2LF2 A;  4IGX A;  5E4D A;  4A86 A;  3KLX A;  4NCB A;  4A85 A;  3NMT A;  2E3N A;  3GL2 A;  1ZXF A;  3NEG A;  1BTV A;  3P0L A;  4DS8 A;  5EKQ C;  4XRW A;  3NJ1 A;  3NJO A;  2A1L A;  5E4M A;  3KDJ A;  2Z9Y A;  4FPW A;  4N3E A;  2REZ A;  3OH8 A;  3NMN A;  1VJH A;  2L8O A;  3QN1 A;  4MAP A;  1JSS A;  4A8V A;  1B6F A;  1XN5 A;  4JHG A;  3DLB A;  2E3R A;  4BTZ A;  2K7H A;  2E3O A;  2KEW A;  3GGN A;  4OIC A;  3NQN A;  5I8F A;  3HM9 A;  3DLH A;  5I9J A;  4LGB A;  4R7K A;  4MNS A;  3Q6A A;  3HVR A;  2KF2 A;  4A84 A;  4N41 A;  3KDH A;  4QDF B;  4QDD A;  2LUZ A;  3KB3 A;  1E09 A;  2LIO A;  3ELI A;  3HXM A;  2BK0 A;  3GTS A;  3K3K A;  3PUT A;  3OQU A;  4JHI A;  2GKD A;  3GTE A;  3JRQ B;  4REI A;  4RYV A;  1KCM A;  2RES A;  3GKE A;  2Q3Q A;  4IHR A;  3RT2 A;  2K5G A;  2M89 A;  3GOB A;  3ZVU A;  1FM4 A;  3KB0 A;  4C94 A;  4A8G A;  3HO1 A;  4MA6 A;  4QIP A;  3HJF A;  2L9P A;  4A8U A;  5JNN A;  4Y31 A;  3F08 A;  5AMW A;  4IGY A;  2VNE A;  3KDI A;  1XN6 A;  1T17 A;  2RER A;  3KAZ A;  3IE5 A;  2FFS A;  2IL5 A;  4JHY A;  5C9Y A;  4DSB A;  5JO2 A;  4M9B A;  2L65 A;  2WQL A;  3NS2 A;  4BKC A;  3P51 A;  4JDA A;  1XDF A;  4QCK A;  1H2O A;  3GL0 A;  1LN2 A;  3OTL A;  1LN3 A;  4BKD A;  2LE1 A;  5JO1 A;  2MOU A;  3NI8 A;  4C9I A;  2QIM A;  2ZYL A;  3C0V A;  4N47 A;  3WG8 A;  1EM2 A;  3TVR A;  4B9R A;  2PSO A;  3FO5 A;  1IFV A;  3TGO C;  3NMH A;  4LGA A;  3CNW A;  3KL1 A;  3H3T A;  4LG5 A;  1X53 A;  4IGV A;  3NJ0 A;  3F73 A;  3HK2 A;  4C9C A;  3R6P A;  2I9Y A;  2YH6 A;  4BK6 A;  1ICX A;  1BV1 A;  1FSK A;  3H3R A;  3NEF A;  4JHH A;  3PU2 A;  1LLT A;  1TW0 A;  1TXC A;  2FLH A;  2LDK A;  3QSZ A;  1QMR A;  3K90 A;  4XRT A;  2N4B A;  2NS9 A;  2VQ5 A;  3TVQ A;  2QPV A;  3E85 A;  4DSC A;  1LN1 A;  4NCA A;  4A81 A;  2EJX A;  4LA7 A;  1Z94 A;  4A83 A;  3W9K A;  2Z9Z A;  3UQH A;  4N0G C;  5E4B A;  4GY9 A;  2KTE A;  3GB4 A;  4REJ A;  3RD6 A;  4A80 A;  4Q0K A;  3Q63 A;  4QDF A;  3UID A;  4IH0 A;  2E3Q A;  1T27 A;  2NN5 A;  4E6F A;  2PCS A;  2E3P A;  2D4R A; 
#chains in the Genus database with same CATH homology
 2KCZ A;  2M47 A;  2N4A A;  3H3S A;  5BRL A;  3TFZ A;  3Q64 A;  1UW5 A;  3H3Q A;  2LCG A;  2LPX A;  2E3S A;  3JRS A;  2LAK A;  4JDL A;  4M9W A;  4PSB A;  3NR4 A;  4Z3L A;  3IJT A;  3KAY A;  4REH A;  4A88 A;  4IGW A;  4WVO A;  3UJL A;  2R55 A;  3RT0 C;  2E3M A;  4N76 A;  1XFS A;  2LGH A;  3NMP A;  3OJI A;  5E46 A;  3TL1 A;  3W9R A;  4IH2 A;  3P9V A;  4KPY A;  4BK7 A;  2LEQ A;  4A87 A;  1XUV A;  2LAF A;  4QDC A;  3NMV A;  2LF2 A;  4IGX A;  5E4D A;  4A86 A;  3KLX A;  4NCB A;  4A85 A;  3NMT A;  2E3N A;  3GL2 A;  1ZXF A;  3NEG A;  1BTV A;  3P0L A;  4DS8 A;  5EKQ C;  4XRW A;  3NJ1 A;  3NJO A;  2A1L A;  5E4M A;  3KDJ A;  2Z9Y A;  4FPW A;  4N3E A;  2REZ A;  3OH8 A;  3NMN A;  1VJH A;  2L8O A;  3QN1 A;  4MAP A;  1JSS A;  4A8V A;  1B6F A;  1XN5 A;  4JHG A;  3DLB A;  2E3R A;  4BTZ A;  2K7H A;  2E3O A;  2KEW A;  3GGN A;  4OIC A;  3NQN A;  5I8F A;  3HM9 A;  3DLH A;  5I9J A;  4LGB A;  4R7K A;  4MNS A;  3Q6A A;  3HVR A;  2KF2 A;  4A84 A;  4N41 A;  3KDH A;  4QDF B;  4QDD A;  2LUZ A;  3KB3 A;  1E09 A;  2LIO A;  3ELI A;  3HXM A;  2BK0 A;  3GTS A;  3K3K A;  3PUT A;  3OQU A;  4JHI A;  2GKD A;  3GTE A;  3JRQ B;  4REI A;  4RYV A;  1KCM A;  2RES A;  3GKE A;  2Q3Q A;  4IHR A;  3RT2 A;  2K5G A;  2M89 A;  3GOB A;  3ZVU A;  1FM4 A;  3KB0 A;  4C94 A;  4A8G A;  3HO1 A;  4MA6 A;  4QIP A;  3HJF A;  2L9P A;  4A8U A;  5JNN A;  4Y31 A;  3F08 A;  5AMW A;  4IGY A;  2VNE A;  3KDI A;  1XN6 A;  1T17 A;  2RER A;  3KAZ A;  3IE5 A;  2FFS A;  2IL5 A;  4JHY A;  5C9Y A;  4DSB A;  5JO2 A;  4M9B A;  2L65 A;  2WQL A;  3NS2 A;  4BKC A;  3P51 A;  4JDA A;  1XDF A;  4QCK A;  1H2O A;  3GL0 A;  1LN2 A;  3OTL A;  1LN3 A;  4BKD A;  2LE1 A;  5JO1 A;  2MOU A;  3NI8 A;  4C9I A;  2QIM A;  2ZYL A;  3C0V A;  4N47 A;  3WG8 A;  1EM2 A;  3TVR A;  4B9R A;  2PSO A;  3FO5 A;  1IFV A;  3TGO C;  3NMH A;  4LGA A;  3CNW A;  3KL1 A;  3H3T A;  4LG5 A;  1X53 A;  4IGV A;  3NJ0 A;  3F73 A;  3HK2 A;  4C9C A;  3R6P A;  2I9Y A;  2YH6 A;  4BK6 A;  1ICX A;  1BV1 A;  1FSK A;  3H3R A;  3NEF A;  4JHH A;  3PU2 A;  1LLT A;  1TW0 A;  1TXC A;  2FLH A;  2LDK A;  3QSZ A;  1QMR A;  3K90 A;  4XRT A;  2N4B A;  2NS9 A;  2VQ5 A;  3TVQ A;  2QPV A;  3E85 A;  4DSC A;  1LN1 A;  4NCA A;  4A81 A;  2EJX A;  4LA7 A;  1Z94 A;  4A83 A;  3W9K A;  2Z9Z A;  3UQH A;  4N0G C;  5E4B A;  4GY9 A;  2KTE A;  3GB4 A;  4REJ A;  3RD6 A;  4A80 A;  4Q0K A;  3Q63 A;  4QDF A;  3UID A;  4IH0 A;  2E3Q A;  1T27 A;  2NN5 A;  4E6F A;  2PCS A;  2E3P A;  2D4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...