2QPVA

Crystal structure of uncharacterized protein atu1531
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
MPVMQSRIIHLSVEKPWAEVYDFAANPGNMPRWAAGLAGGLEADGEDWIAKGGPLGEVRVNFAPHNEFGVIDHVVTLPDGLKVYNALRVTPNGSGTEVSFTLLRLEGMTDEDFEQDASAITADLEMLKSLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein Atu1531
publication title Crystal structure of uncharacterized protein Atu1531.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Structural genomics, unknown function
total genus 30
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2qpvA00
4MAPA 2PSOA 3KL1A 2K7HA 1XN6A 4C9IA 3KLXA 3NR4A 3KAZA 2L65A 4JDAA 3KDHA 3P51A 2L9PA 4A85A 1Z94A 5E4BA 4N0GC 4A80A 4M9WA 3K3KA 3TFZA 2E3OA 2KEWA 4A8UA 2QIMA 3PUTA 4GY9A 4XRTA 2N4AA 3R6PA 3UIDA 4BKDA 3CNWA 5JO2A 2LAKA 2EJXA 2E3QA 5I9JA 5JNNA 2KCZA 1IFVA 4Q0KA 2N4BA 5I8FA 1JSSA 3UJLA 2VQ5A 4A87A 1LLTA 2RESA 2RERA 3JRQB 2E3PA 2L8OA 3KDIA 1VJHA 2R55A 2LF2A 4MNSA 2MOUA 4IGWA 1E09A 2FFSA 1ICXA 4WVOA 5JO1A 3K90A 3Q6AA 2LCGA 2LUZA 2LPXA 3KDJA 4BK7A 2GKDA 1XN5A 4A8VA 4B9RA 3H3TA 4IH2A 3WG8A 1LN1A 4JHIA 3NJ0A 2D4RA 3KB0A 2PCSA 3NS2A 3ELIA 5BRLA 1ZXFA 1FM4A 4LA7A 1BTVA 1BV1A 4IGXA 4XRWA 3IJTA 3F08A 3C0VA 3NMTA 3GGNA 3NMVA 1TW0A 5AMWA 4LG5A 4C94A 2NS9A 3QN1A 4R7KA 3TVRA 2I9YA 3H3RA 4RYVA 2Z9YA 2BK0A 4FPWA 4IGYA 2FLHA 2WQLA 4IH0A 3NMHA 5E4DA 4Z3LA 2M89A 3E85A 3W9RA 3OQUA 1EM2A 1FSKA 3W9KA 2LIOA 4OICA 2LDKA 1X53A 2VNEA 3OTLA 2IL5A 1KCMA 3Q63A 1QMRA 1H2OA 4A84A 2QPVA 3OH8A 3Q64A 2Q3QA 4M9BA 2M47A 4REIA 4IHRA 1T27A 3JRSA 4LGAA 3H3SA 2LE1A 3PU2A 4JHGA 4REHA 4DS8A 2REZA 4IGVA 4BKCA 3P9VA 4REJA 2LEQA 1XFSA 2E3RA 1LN3A 3TL1A 3TVQA 2Z9ZA 4A86A 3QSZA 2LGHA 4A83A 1T17A 4DSBA 4LGBA 3FO5A 2E3NA 3KAYA 1B6FA 2KTEA 2K5GA 3UQHA 4Y31A 4N3EA 3P0LA 4BK6A 3KB3A 3RT2A 4JHHA 4C9CA 5E46A 4QIPA 4A88A 1TXCA 3H3QA 3NMNA 3RD6A 1LN2A 4PSBA 3NJ1A 4A8GA 4A81A 1XDFA 2E3MA 3NEFA 1UW5A 3NJOA 3RT0C 4JDLA 5E4MA 5C9YA 1XUVA 3IE5A 4BTZA 2NN5A 4DSCA 2E3SA 4MA6A 3NI8A 3ZVUA 3NEGA 2A1LA 3OJIA 3NMPA 2KF2A
chains in the Genus database with same CATH superfamily
4MAPA 2PSOA 3KL1A 4N47A 2K7HA 1XN6A 2ZYLA 4C9IA 3KLXA 3DLHA 3NR4A 3KAZA 2L65A 4JDAA 3KDHA 3P51A 2L9PA 4A85A 1Z94A 5E4BA 4N0GC 4A80A 4M9WA 3K3KA 3TFZA 2E3OA 2YH6A 2KEWA 4A8UA 2QIMA 3PUTA 5EKQC 4GY9A 4XRTA 3NQNA 2N4AA 3R6PA 3UIDA 4BKDA 3CNWA 5JO2A 2LAKA 2EJXA 2E3QA 5I9JA 5JNNA 2KCZA 1IFVA 3HXMA 4Q0KA 2N4BA 5I8FA 1JSSA 3UJLA 3HJFA 2VQ5A 4KPYA 4A87A 1LLTA 2RESA 2RERA 3JRQB 3HK2A 2E3PA 2L8OA 3KDIA 1VJHA 2R55A 2LF2A 4JHYA 2MOUA 4IGWA 4MNSA 3GL0A 1E09A 2FFSA 3GKEA 1ICXA 4WVOA 5JO1A 3K90A 3Q6AA 2LCGA 3GTEA 2LUZA 2LPXA 3KDJA 4BK7A 2GKDA 1XN5A 4A8VA 4B9RA 3H3TA 4IH2A 4QDFB 3WG8A 1LN1A 4JHIA 3NJ0A 2D4RA 3KB0A 2PCSA 3NS2A 3ELIA 5BRLA 1ZXFA 3HVRA 3GOBA 1FM4A 4QDCA 4LA7A 1BTVA 1BV1A 4IGXA 4XRWA 4QCKA 3IJTA 3F08A 3C0VA 3NMTA 3GGNA 3NMVA 1TW0A 5AMWA 4LG5A 4C94A 2NS9A 3QN1A 4R7KA 3TVRA 2I9YA 3H3RA 4RYVA 2Z9YA 2BK0A 4FPWA 4IGYA 2FLHA 2WQLA 4IH0A 3NMHA 5E4DA 4Z3LA 2M89A 4N76A 3E85A 3W9RA 3OQUA 1EM2A 1FSKA 4QDFA 2LIOA 4OICA 3W9KA 2LDKA 1X53A 2VNEA 3OTLA 2IL5A 1KCMA 3Q63A 1QMRA 1H2OA 4A84A 2QPVA 3OH8A 3HO1A 3Q64A 2Q3QA 3HM9A 4M9BA 2M47A 4REIA 4IHRA 3GL2A 1T27A 3JRSA 4LGAA 3TGOC 3H3SA 2LE1A 3PU2A 4JHGA 4REHA 4DS8A 4NCBA 2REZA 4IGVA 4BKCA 3P9VA 4REJA 2LEQA 1XFSA 2E3RA 1LN3A 3TL1A 4E6FA 3TVQA 2Z9ZA 3DLBA 4A86A 3GB4A 3QSZA 2LGHA 4A83A 1T17A 4DSBA 4LGBA 3F73A 3FO5A 2E3NA 3KAYA 1B6FA 2KTEA 2K5GA 3UQHA 4Y31A 4N3EA 3P0LA 4BK6A 3KB3A 3RT2A 4JHHA 4C9CA 3GTSA 5E46A 2LAFA 4QIPA 4A88A 1TXCA 3H3QA 3NMNA 4NCAA 3RD6A 1LN2A 4PSBA 3NJ1A 4QDDA 4A8GA 4A81A 1XDFA 2E3MA 3NEFA 1UW5A 3NJOA 3RT0C 4JDLA 5E4MA 5C9YA 1XUVA 4N41A 3IE5A 4BTZA 2NN5A 4DSCA 2E3SA 4MA6A 3NI8A 3ZVUA 3NEGA 2A1LA 3OJIA 3NMPA 2KF2A
chains in the Genus database with same CATH topology
4MAPA 2PSOA 3KL1A 4N47A 2K7HA 1XN6A 2ZYLA 4C9IA 3KLXA 3DLHA 3NR4A 3KAZA 2L65A 4JDAA 3KDHA 3P51A 2L9PA 4A85A 1Z94A 5E4BA 4N0GC 4A80A 4M9WA 3K3KA 3TFZA 2E3OA 2YH6A 2KEWA 4A8UA 2QIMA 3PUTA 5EKQC 4GY9A 4XRTA 3NQNA 2N4AA 3R6PA 3UIDA 4BKDA 3CNWA 5JO2A 2LAKA 2EJXA 2E3QA 5I9JA 5JNNA 2KCZA 1IFVA 3HXMA 4Q0KA 2N4BA 5I8FA 1JSSA 3UJLA 3HJFA 2VQ5A 4KPYA 4A87A 1LLTA 2RESA 2RERA 3JRQB 3HK2A 2E3PA 2L8OA 3KDIA 1VJHA 2R55A 2LF2A 4JHYA 2MOUA 4IGWA 4MNSA 3GL0A 1E09A 2FFSA 3GKEA 1ICXA 4WVOA 5JO1A 3K90A 3Q6AA 2LCGA 3GTEA 2LUZA 2LPXA 3KDJA 4BK7A 2GKDA 1XN5A 4A8VA 4B9RA 3H3TA 4IH2A 4QDFB 3WG8A 1LN1A 4JHIA 3NJ0A 2D4RA 3KB0A 2PCSA 3NS2A 3ELIA 5BRLA 1ZXFA 3HVRA 3GOBA 1FM4A 4QDCA 4LA7A 1BTVA 1BV1A 4IGXA 4XRWA 4QCKA 3IJTA 3F08A 3C0VA 3NMTA 3GGNA 3NMVA 1TW0A 5AMWA 4LG5A 4C94A 2NS9A 3QN1A 4R7KA 3TVRA 2I9YA 3H3RA 4RYVA 2Z9YA 2BK0A 4FPWA 4IGYA 2FLHA 2WQLA 4IH0A 3NMHA 5E4DA 4Z3LA 2M89A 4N76A 3E85A 3W9RA 3OQUA 1EM2A 1FSKA 4QDFA 2LIOA 4OICA 3W9KA 2LDKA 1X53A 2VNEA 3OTLA 2IL5A 1KCMA 3Q63A 1QMRA 1H2OA 4A84A 2QPVA 3OH8A 3HO1A 3Q64A 2Q3QA 3HM9A 4M9BA 2M47A 4REIA 4IHRA 3GL2A 1T27A 3JRSA 4LGAA 3TGOC 3H3SA 2LE1A 3PU2A 4JHGA 4REHA 4DS8A 4NCBA 2REZA 4IGVA 4BKCA 3P9VA 4REJA 2LEQA 1XFSA 2E3RA 1LN3A 3TL1A 4E6FA 3TVQA 2Z9ZA 3DLBA 4A86A 3GB4A 3QSZA 2LGHA 4A83A 1T17A 4DSBA 4LGBA 3F73A 3FO5A 2E3NA 3KAYA 1B6FA 2KTEA 2K5GA 3UQHA 4Y31A 4N3EA 3P0LA 4BK6A 3KB3A 3RT2A 4JHHA 4C9CA 3GTSA 5E46A 2LAFA 4QIPA 4A88A 1TXCA 3H3QA 3NMNA 4NCAA 3RD6A 1LN2A 4PSBA 3NJ1A 4QDDA 4A8GA 4A81A 1XDFA 2E3MA 3NEFA 1UW5A 3NJOA 3RT0C 4JDLA 5E4MA 5C9YA 1XUVA 4N41A 3IE5A 4BTZA 2NN5A 4DSCA 2E3SA 4MA6A 3NI8A 3ZVUA 3NEGA 2A1LA 3OJIA 3NMPA 2KF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MAP A;  2PSO A;  3KL1 A;  2K7H A;  1XN6 A;  4C9I A;  3KLX A;  3NR4 A;  3KAZ A;  2L65 A;  4JDA A;  3KDH A;  3P51 A;  2L9P A;  4A85 A;  1Z94 A;  5E4B A;  4N0G C;  4A80 A;  4M9W A;  3K3K A;  3TFZ A;  2E3O A;  2KEW A;  4A8U A;  2QIM A;  3PUT A;  4GY9 A;  4XRT A;  2N4A A;  3R6P A;  3UID A;  4BKD A;  3CNW A;  5JO2 A;  2LAK A;  2EJX A;  2E3Q A;  5I9J A;  5JNN A;  2KCZ A;  1IFV A;  4Q0K A;  2N4B A;  5I8F A;  1JSS A;  3UJL A;  2VQ5 A;  4A87 A;  1LLT A;  2RES A;  2RER A;  3JRQ B;  2E3P A;  2L8O A;  3KDI A;  1VJH A;  2R55 A;  2LF2 A;  4MNS A;  2MOU A;  4IGW A;  1E09 A;  2FFS A;  1ICX A;  4WVO A;  5JO1 A;  3K90 A;  3Q6A A;  2LCG A;  2LUZ A;  2LPX A;  3KDJ A;  4BK7 A;  2GKD A;  1XN5 A;  4A8V A;  4B9R A;  3H3T A;  4IH2 A;  3WG8 A;  1LN1 A;  4JHI A;  3NJ0 A;  2D4R A;  3KB0 A;  2PCS A;  3NS2 A;  3ELI A;  5BRL A;  1ZXF A;  1FM4 A;  4LA7 A;  1BTV A;  1BV1 A;  4IGX A;  4XRW A;  3IJT A;  3F08 A;  3C0V A;  3NMT A;  3GGN A;  3NMV A;  1TW0 A;  5AMW A;  4LG5 A;  4C94 A;  2NS9 A;  3QN1 A;  4R7K A;  3TVR A;  2I9Y A;  3H3R A;  4RYV A;  2Z9Y A;  2BK0 A;  4FPW A;  4IGY A;  2FLH A;  2WQL A;  4IH0 A;  3NMH A;  5E4D A;  4Z3L A;  2M89 A;  3E85 A;  3W9R A;  3OQU A;  1EM2 A;  1FSK A;  3W9K A;  2LIO A;  4OIC A;  2LDK A;  1X53 A;  2VNE A;  3OTL A;  2IL5 A;  1KCM A;  3Q63 A;  1QMR A;  1H2O A;  4A84 A;  2QPV A;  3OH8 A;  3Q64 A;  2Q3Q A;  4M9B A;  2M47 A;  4REI A;  4IHR A;  1T27 A;  3JRS A;  4LGA A;  3H3S A;  2LE1 A;  3PU2 A;  4JHG A;  4REH A;  4DS8 A;  2REZ A;  4IGV A;  4BKC A;  3P9V A;  4REJ A;  2LEQ A;  1XFS A;  2E3R A;  1LN3 A;  3TL1 A;  3TVQ A;  2Z9Z A;  4A86 A;  3QSZ A;  2LGH A;  4A83 A;  1T17 A;  4DSB A;  4LGB A;  3FO5 A;  2E3N A;  3KAY A;  1B6F A;  2KTE A;  2K5G A;  3UQH A;  4Y31 A;  4N3E A;  3P0L A;  4BK6 A;  3KB3 A;  3RT2 A;  4JHH A;  4C9C A;  5E46 A;  4QIP A;  4A88 A;  1TXC A;  3H3Q A;  3NMN A;  3RD6 A;  1LN2 A;  4PSB A;  3NJ1 A;  4A8G A;  4A81 A;  1XDF A;  2E3M A;  3NEF A;  1UW5 A;  3NJO A;  3RT0 C;  4JDL A;  5E4M A;  5C9Y A;  1XUV A;  3IE5 A;  4BTZ A;  2NN5 A;  4DSC A;  2E3S A;  4MA6 A;  3NI8 A;  3ZVU A;  3NEG A;  2A1L A;  3OJI A;  3NMP A;  2KF2 A; 
#chains in the Genus database with same CATH topology
 4MAP A;  2PSO A;  3KL1 A;  4N47 A;  2K7H A;  1XN6 A;  2ZYL A;  4C9I A;  3KLX A;  3DLH A;  3NR4 A;  3KAZ A;  2L65 A;  4JDA A;  3KDH A;  3P51 A;  2L9P A;  4A85 A;  1Z94 A;  5E4B A;  4N0G C;  4A80 A;  4M9W A;  3K3K A;  3TFZ A;  2E3O A;  2YH6 A;  2KEW A;  4A8U A;  2QIM A;  3PUT A;  5EKQ C;  4GY9 A;  4XRT A;  3NQN A;  2N4A A;  3R6P A;  3UID A;  4BKD A;  3CNW A;  5JO2 A;  2LAK A;  2EJX A;  2E3Q A;  5I9J A;  5JNN A;  2KCZ A;  1IFV A;  3HXM A;  4Q0K A;  2N4B A;  5I8F A;  1JSS A;  3UJL A;  3HJF A;  2VQ5 A;  4KPY A;  4A87 A;  1LLT A;  2RES A;  2RER A;  3JRQ B;  3HK2 A;  2E3P A;  2L8O A;  3KDI A;  1VJH A;  2R55 A;  2LF2 A;  4JHY A;  2MOU A;  4IGW A;  4MNS A;  3GL0 A;  1E09 A;  2FFS A;  3GKE A;  1ICX A;  4WVO A;  5JO1 A;  3K90 A;  3Q6A A;  2LCG A;  3GTE A;  2LUZ A;  2LPX A;  3KDJ A;  4BK7 A;  2GKD A;  1XN5 A;  4A8V A;  4B9R A;  3H3T A;  4IH2 A;  4QDF B;  3WG8 A;  1LN1 A;  4JHI A;  3NJ0 A;  2D4R A;  3KB0 A;  2PCS A;  3NS2 A;  3ELI A;  5BRL A;  1ZXF A;  3HVR A;  3GOB A;  1FM4 A;  4QDC A;  4LA7 A;  1BTV A;  1BV1 A;  4IGX A;  4XRW A;  4QCK A;  3IJT A;  3F08 A;  3C0V A;  3NMT A;  3GGN A;  3NMV A;  1TW0 A;  5AMW A;  4LG5 A;  4C94 A;  2NS9 A;  3QN1 A;  4R7K A;  3TVR A;  2I9Y A;  3H3R A;  4RYV A;  2Z9Y A;  2BK0 A;  4FPW A;  4IGY A;  2FLH A;  2WQL A;  4IH0 A;  3NMH A;  5E4D A;  4Z3L A;  2M89 A;  4N76 A;  3E85 A;  3W9R A;  3OQU A;  1EM2 A;  1FSK A;  4QDF A;  2LIO A;  4OIC A;  3W9K A;  2LDK A;  1X53 A;  2VNE A;  3OTL A;  2IL5 A;  1KCM A;  3Q63 A;  1QMR A;  1H2O A;  4A84 A;  2QPV A;  3OH8 A;  3HO1 A;  3Q64 A;  2Q3Q A;  3HM9 A;  4M9B A;  2M47 A;  4REI A;  4IHR A;  3GL2 A;  1T27 A;  3JRS A;  4LGA A;  3TGO C;  3H3S A;  2LE1 A;  3PU2 A;  4JHG A;  4REH A;  4DS8 A;  4NCB A;  2REZ A;  4IGV A;  4BKC A;  3P9V A;  4REJ A;  2LEQ A;  1XFS A;  2E3R A;  1LN3 A;  3TL1 A;  4E6F A;  3TVQ A;  2Z9Z A;  3DLB A;  4A86 A;  3GB4 A;  3QSZ A;  2LGH A;  4A83 A;  1T17 A;  4DSB A;  4LGB A;  3F73 A;  3FO5 A;  2E3N A;  3KAY A;  1B6F A;  2KTE A;  2K5G A;  3UQH A;  4Y31 A;  4N3E A;  3P0L A;  4BK6 A;  3KB3 A;  3RT2 A;  4JHH A;  4C9C A;  3GTS A;  5E46 A;  2LAF A;  4QIP A;  4A88 A;  1TXC A;  3H3Q A;  3NMN A;  4NCA A;  3RD6 A;  1LN2 A;  4PSB A;  3NJ1 A;  4QDD A;  4A8G A;  4A81 A;  1XDF A;  2E3M A;  3NEF A;  1UW5 A;  3NJO A;  3RT0 C;  4JDL A;  5E4M A;  5C9Y A;  1XUV A;  4N41 A;  3IE5 A;  4BTZ A;  2NN5 A;  4DSC A;  2E3S A;  4MA6 A;  3NI8 A;  3ZVU A;  3NEG A;  2A1L A;  3OJI A;  3NMP A;  2KF2 A; 
#chains in the Genus database with same CATH homology
 4MAP A;  2PSO A;  3KL1 A;  4N47 A;  2K7H A;  1XN6 A;  2ZYL A;  4C9I A;  3KLX A;  3DLH A;  3NR4 A;  3KAZ A;  2L65 A;  4JDA A;  3KDH A;  3P51 A;  2L9P A;  4A85 A;  1Z94 A;  5E4B A;  4N0G C;  4A80 A;  4M9W A;  3K3K A;  3TFZ A;  2E3O A;  2YH6 A;  2KEW A;  4A8U A;  2QIM A;  3PUT A;  5EKQ C;  4GY9 A;  4XRT A;  3NQN A;  2N4A A;  3R6P A;  3UID A;  4BKD A;  3CNW A;  5JO2 A;  2LAK A;  2EJX A;  2E3Q A;  5I9J A;  5JNN A;  2KCZ A;  1IFV A;  3HXM A;  4Q0K A;  2N4B A;  5I8F A;  1JSS A;  3UJL A;  3HJF A;  2VQ5 A;  4KPY A;  4A87 A;  1LLT A;  2RES A;  2RER A;  3JRQ B;  3HK2 A;  2E3P A;  2L8O A;  3KDI A;  1VJH A;  2R55 A;  2LF2 A;  4JHY A;  2MOU A;  4IGW A;  4MNS A;  3GL0 A;  1E09 A;  2FFS A;  3GKE A;  1ICX A;  4WVO A;  5JO1 A;  3K90 A;  3Q6A A;  2LCG A;  3GTE A;  2LUZ A;  2LPX A;  3KDJ A;  4BK7 A;  2GKD A;  1XN5 A;  4A8V A;  4B9R A;  3H3T A;  4IH2 A;  4QDF B;  3WG8 A;  1LN1 A;  4JHI A;  3NJ0 A;  2D4R A;  3KB0 A;  2PCS A;  3NS2 A;  3ELI A;  5BRL A;  1ZXF A;  3HVR A;  3GOB A;  1FM4 A;  4QDC A;  4LA7 A;  1BTV A;  1BV1 A;  4IGX A;  4XRW A;  4QCK A;  3IJT A;  3F08 A;  3C0V A;  3NMT A;  3GGN A;  3NMV A;  1TW0 A;  5AMW A;  4LG5 A;  4C94 A;  2NS9 A;  3QN1 A;  4R7K A;  3TVR A;  2I9Y A;  3H3R A;  4RYV A;  2Z9Y A;  2BK0 A;  4FPW A;  4IGY A;  2FLH A;  2WQL A;  4IH0 A;  3NMH A;  5E4D A;  4Z3L A;  2M89 A;  4N76 A;  3E85 A;  3W9R A;  3OQU A;  1EM2 A;  1FSK A;  4QDF A;  2LIO A;  4OIC A;  3W9K A;  2LDK A;  1X53 A;  2VNE A;  3OTL A;  2IL5 A;  1KCM A;  3Q63 A;  1QMR A;  1H2O A;  4A84 A;  2QPV A;  3OH8 A;  3HO1 A;  3Q64 A;  2Q3Q A;  3HM9 A;  4M9B A;  2M47 A;  4REI A;  4IHR A;  3GL2 A;  1T27 A;  3JRS A;  4LGA A;  3TGO C;  3H3S A;  2LE1 A;  3PU2 A;  4JHG A;  4REH A;  4DS8 A;  4NCB A;  2REZ A;  4IGV A;  4BKC A;  3P9V A;  4REJ A;  2LEQ A;  1XFS A;  2E3R A;  1LN3 A;  3TL1 A;  4E6F A;  3TVQ A;  2Z9Z A;  3DLB A;  4A86 A;  3GB4 A;  3QSZ A;  2LGH A;  4A83 A;  1T17 A;  4DSB A;  4LGB A;  3F73 A;  3FO5 A;  2E3N A;  3KAY A;  1B6F A;  2KTE A;  2K5G A;  3UQH A;  4Y31 A;  4N3E A;  3P0L A;  4BK6 A;  3KB3 A;  3RT2 A;  4JHH A;  4C9C A;  3GTS A;  5E46 A;  2LAF A;  4QIP A;  4A88 A;  1TXC A;  3H3Q A;  3NMN A;  4NCA A;  3RD6 A;  1LN2 A;  4PSB A;  3NJ1 A;  4QDD A;  4A8G A;  4A81 A;  1XDF A;  2E3M A;  3NEF A;  1UW5 A;  3NJO A;  3RT0 C;  4JDL A;  5E4M A;  5C9Y A;  1XUV A;  4N41 A;  3IE5 A;  4BTZ A;  2NN5 A;  4DSC A;  2E3S A;  4MA6 A;  3NI8 A;  3ZVU A;  3NEG A;  2A1L A;  3OJI A;  3NMP A;  2KF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...