2WQLA

Crystal structure of the major carrot allergen dau c 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
152
structure length
152
Chain Sequence
AQSHSLEITSSVSAEKIFSGIVLDVDTVIPKAATGAYKSVEVKGDGGAGTVRIITLPEGSPITTMTVRTDAVNKEALSYDSTVIDGDILLGFIESIETHMVVVPTADGGSITKTTAIFHTKGDAVVPEENIKFADAQNTALFKAIEAYLIAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR ALLERGEN DAU C 1
publication title Structure of the Major Carrot Allergen Dau C 1.
pubmed doi rcsb
source organism Daucus carota
molecule tags Allergen
total genus 41
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 2wqlA00
3OTLA 2BK0A 2N4BA 4LGBA 2LPXA 4A87A 3R6PA 4IHRA 3NR4A 4A81A 2LE1A 3NMHA 3P9VA 4OICA 4A8UA 4LA7A 4M9BA 2M47A 3TVRA 4BTZA 3TL1A 5AMWA 2LF2A 3W9RA 4GY9A 4M9WA 2D4RA 4IH2A 2K5GA 3NEFA 2EJXA 1ICXA 3Q6AA 4BKDA 3NJ0A 2E3OA 4IGVA 3KAZA 3Q64A 4RYVA 4C9CA 2Q3QA 3GGNA 2PSOA 4B9RA 2LCGA 3UQHA 2IL5A 3PU2A 1XUVA 1LN1A 2VNEA 3IE5A 3OJIA 3PUTA 3IJTA 2Z9YA 4LGAA 4PSBA 4R7KA 2I9YA 4MNSA 2REZA 1UW5A 3OH8A 3QSZA 5I9JA 3H3RA 4IGXA 4JHHA 2N4AA 3RT2A 2VQ5A 5E4MA 1QMRA 2FFSA 3KDJA 1BV1A 5JNNA 3C0VA 4C94A 2LIOA 3KAYA 4MA6A 1T17A 2LEQA 1LN3A 2E3PA 2KTEA 2E3RA 4DS8A 3NI8A 4JHGA 2E3QA 2LUZA 1FSKA 2LDKA 3KL1A 1LN2A 3JRQB 2E3MA 5E46A 2L8OA 3K90A 4A8VA 4IGWA 4A88A 3WG8A 2M89A 1FM4A 1XN5A 3H3QA 3RD6A 4REIA 5E4BA 1TXCA 3ZVUA 4JHIA 1B6FA 4QIPA 2L65A 1XN6A 3NMVA 4N3EA 4LG5A 2NS9A 3ELIA 4A86A 1E09A 2RESA 3NMPA 1KCMA 1XDFA 2PCSA 3H3TA 3P51A 5E4DA 4BK6A 4Z3LA 2QPVA 3NEGA 3NMTA 2GKDA 2FLHA 3QN1A 4IH0A 4A85A 4XRTA 2K7HA 2LAKA 3KLXA 3KB0A 4REHA 4A8GA 1TW0A 1LLTA 2E3NA 2RERA 5BRLA 1Z94A 3NJ1A 1VJHA 2KF2A 3Q63A 3W9KA 4BK7A 3JRSA 1XFSA 4JDAA 4DSCA 2R55A 3KDHA 3NJOA 2KEWA 4WVOA 3UJLA 4MAPA 2Z9ZA 4REJA 2A1LA 4N0GC 1EM2A 3TFZA 3P0LA 3UIDA 3CNWA 3RT0C 3FO5A 2LGHA 4Q0KA 5JO2A 2WQLA 2MOUA 4IGYA 4A80A 3E85A 4Y31A 4A84A 3NS2A 3F08A 2QIMA 1T27A 4XRWA 4C9IA 3H3SA 5I8FA 2NN5A 4DSBA 1ZXFA 4BKCA 1X53A 5C9YA 2L9PA 4JDLA 4FPWA 4A83A 1H2OA 3KB3A 1IFVA 3KDIA 3TVQA 5JO1A 1BTVA 1JSSA 3K3KA 2KCZA 3NMNA 3OQUA 2E3SA
chains in the Genus database with same CATH superfamily
3GOBA 3OTLA 2BK0A 2N4BA 4LGBA 2LPXA 4A87A 4QDCA 3R6PA 5EKQC 4IHRA 3NR4A 4A81A 2LE1A 3NMHA 3P9VA 4OICA 4A8UA 4LA7A 4M9BA 2M47A 3TVRA 4BTZA 3GTEA 3TL1A 5AMWA 2LF2A 3GKEA 4GY9A 4M9WA 2D4RA 4IH2A 3W9RA 2K5GA 3NEFA 2EJXA 1ICXA 3Q6AA 4BKDA 3NJ0A 4JHYA 2E3OA 4IGVA 3KAZA 3Q64A 4RYVA 4C9CA 2Q3QA 3GGNA 2PSOA 4B9RA 2LCGA 3UQHA 2IL5A 3PU2A 1XUVA 1LN1A 2VNEA 3IE5A 3OJIA 3PUTA 3IJTA 2Z9YA 4LGAA 4PSBA 4R7KA 2I9YA 4MNSA 2REZA 1UW5A 3OH8A 3QSZA 5I9JA 3H3RA 4N76A 2ZYLA 4IGXA 4JHHA 2N4AA 3RT2A 3HJFA 2VQ5A 5E4MA 1QMRA 2FFSA 3KDJA 4QDFB 1BV1A 4QDFA 5JNNA 3C0VA 4C94A 2LIOA 3KAYA 4MA6A 1T17A 2LEQA 1LN3A 2E3PA 2KTEA 2E3RA 4DS8A 3NI8A 4JHGA 3GL0A 2E3QA 2LUZA 1FSKA 2LDKA 3KL1A 1LN2A 3JRQB 2E3MA 5E46A 2L8OA 3DLHA 3K90A 4A8VA 4IGWA 4A88A 3WG8A 2M89A 1FM4A 1XN5A 3GL2A 3H3QA 3RD6A 4REIA 5E4BA 1TXCA 3NQNA 3ZVUA 4JHIA 1B6FA 4QDDA 4QIPA 2L65A 1XN6A 3NMVA 4N3EA 4LG5A 4N41A 2NS9A 3ELIA 4A86A 1E09A 4E6FA 4NCBA 2RESA 3NMPA 3HXMA 1KCMA 1XDFA 2PCSA 3H3TA 3P51A 5E4DA 4BK6A 4Z3LA 3F73A 2QPVA 2LAFA 3NEGA 3NMTA 2GKDA 2FLHA 3QN1A 4IH0A 4A85A 4XRTA 2K7HA 2LAKA 3KLXA 2YH6A 3KB0A 4REHA 4A8GA 1TW0A 1LLTA 3GTSA 2E3NA 2RERA 5BRLA 1Z94A 3NJ1A 1VJHA 2KF2A 3Q63A 3W9KA 4BK7A 3JRSA 1XFSA 4JDAA 4DSCA 2R55A 3KDHA 3GB4A 2KEWA 3NJOA 4WVOA 3HM9A 3TGOC 3UJLA 4MAPA 3HO1A 2Z9ZA 3HVRA 4REJA 2A1LA 4N0GC 1EM2A 3TFZA 3P0LA 3UIDA 3CNWA 4QCKA 3RT0C 3FO5A 2LGHA 4N47A 4Q0KA 5JO2A 2WQLA 2MOUA 4IGYA 4A80A 3E85A 4Y31A 4A84A 3NS2A 4KPYA 3F08A 3DLBA 2QIMA 1T27A 4XRWA 4C9IA 3H3SA 5I8FA 2NN5A 4DSBA 1ZXFA 4BKCA 3HK2A 1X53A 5C9YA 2L9PA 4JDLA 4FPWA 4A83A 1H2OA 3KB3A 1IFVA 3KDIA 3TVQA 5JO1A 1BTVA 1JSSA 3K3KA 2KCZA 3NMNA 3OQUA 4NCAA 2E3SA
chains in the Genus database with same CATH topology
3GOBA 3OTLA 2BK0A 2N4BA 4LGBA 2LPXA 4A87A 4QDCA 3R6PA 5EKQC 4IHRA 3NR4A 4A81A 2LE1A 3NMHA 3P9VA 4OICA 4A8UA 4LA7A 4M9BA 2M47A 3TVRA 4BTZA 3GTEA 3TL1A 5AMWA 2LF2A 3GKEA 4GY9A 4M9WA 2D4RA 4IH2A 3W9RA 2K5GA 3NEFA 2EJXA 1ICXA 3Q6AA 4BKDA 3NJ0A 4JHYA 2E3OA 4IGVA 3KAZA 3Q64A 4RYVA 4C9CA 2Q3QA 3GGNA 2PSOA 4B9RA 2LCGA 3UQHA 2IL5A 3PU2A 1XUVA 1LN1A 2VNEA 3IE5A 3OJIA 3PUTA 3IJTA 2Z9YA 4LGAA 4PSBA 4R7KA 2I9YA 4MNSA 2REZA 1UW5A 3OH8A 3QSZA 5I9JA 3H3RA 4N76A 2ZYLA 4IGXA 4JHHA 2N4AA 3RT2A 3HJFA 2VQ5A 5E4MA 1QMRA 2FFSA 3KDJA 4QDFB 1BV1A 4QDFA 5JNNA 3C0VA 4C94A 2LIOA 3KAYA 4MA6A 1T17A 2LEQA 1LN3A 2E3PA 2KTEA 2E3RA 4DS8A 3NI8A 4JHGA 3GL0A 2E3QA 2LUZA 1FSKA 2LDKA 3KL1A 1LN2A 3JRQB 2E3MA 5E46A 2L8OA 3DLHA 3K90A 4A8VA 4IGWA 4A88A 3WG8A 2M89A 1FM4A 1XN5A 3GL2A 3H3QA 3RD6A 4REIA 5E4BA 1TXCA 3NQNA 3ZVUA 4JHIA 1B6FA 4QDDA 4QIPA 2L65A 1XN6A 3NMVA 4N3EA 4LG5A 4N41A 2NS9A 3ELIA 4A86A 1E09A 4E6FA 4NCBA 2RESA 3NMPA 3HXMA 1KCMA 1XDFA 2PCSA 3H3TA 3P51A 5E4DA 4BK6A 4Z3LA 3F73A 2QPVA 2LAFA 3NEGA 3NMTA 2GKDA 2FLHA 3QN1A 4IH0A 4A85A 4XRTA 2K7HA 2LAKA 3KLXA 2YH6A 3KB0A 4REHA 4A8GA 1TW0A 1LLTA 3GTSA 2E3NA 2RERA 5BRLA 1Z94A 3NJ1A 1VJHA 2KF2A 3Q63A 3W9KA 4BK7A 3JRSA 1XFSA 4JDAA 4DSCA 2R55A 3KDHA 3GB4A 2KEWA 3NJOA 4WVOA 3HM9A 3TGOC 3UJLA 4MAPA 3HO1A 2Z9ZA 3HVRA 4REJA 2A1LA 4N0GC 1EM2A 3TFZA 3P0LA 3UIDA 3CNWA 4QCKA 3RT0C 3FO5A 2LGHA 4N47A 4Q0KA 5JO2A 2WQLA 2MOUA 4IGYA 4A80A 3E85A 4Y31A 4A84A 3NS2A 4KPYA 3F08A 3DLBA 2QIMA 1T27A 4XRWA 4C9IA 3H3SA 5I8FA 2NN5A 4DSBA 1ZXFA 4BKCA 3HK2A 1X53A 5C9YA 2L9PA 4JDLA 4FPWA 4A83A 1H2OA 3KB3A 1IFVA 3KDIA 3TVQA 5JO1A 1BTVA 1JSSA 3K3KA 2KCZA 3NMNA 3OQUA 4NCAA 2E3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTL A;  2BK0 A;  2N4B A;  4LGB A;  2LPX A;  4A87 A;  3R6P A;  4IHR A;  3NR4 A;  4A81 A;  2LE1 A;  3NMH A;  3P9V A;  4OIC A;  4A8U A;  4LA7 A;  4M9B A;  2M47 A;  3TVR A;  4BTZ A;  3TL1 A;  5AMW A;  2LF2 A;  3W9R A;  4GY9 A;  4M9W A;  2D4R A;  4IH2 A;  2K5G A;  3NEF A;  2EJX A;  1ICX A;  3Q6A A;  4BKD A;  3NJ0 A;  2E3O A;  4IGV A;  3KAZ A;  3Q64 A;  4RYV A;  4C9C A;  2Q3Q A;  3GGN A;  2PSO A;  4B9R A;  2LCG A;  3UQH A;  2IL5 A;  3PU2 A;  1XUV A;  1LN1 A;  2VNE A;  3IE5 A;  3OJI A;  3PUT A;  3IJT A;  2Z9Y A;  4LGA A;  4PSB A;  4R7K A;  2I9Y A;  4MNS A;  2REZ A;  1UW5 A;  3OH8 A;  3QSZ A;  5I9J A;  3H3R A;  4IGX A;  4JHH A;  2N4A A;  3RT2 A;  2VQ5 A;  5E4M A;  1QMR A;  2FFS A;  3KDJ A;  1BV1 A;  5JNN A;  3C0V A;  4C94 A;  2LIO A;  3KAY A;  4MA6 A;  1T17 A;  2LEQ A;  1LN3 A;  2E3P A;  2KTE A;  2E3R A;  4DS8 A;  3NI8 A;  4JHG A;  2E3Q A;  2LUZ A;  1FSK A;  2LDK A;  3KL1 A;  1LN2 A;  3JRQ B;  2E3M A;  5E46 A;  2L8O A;  3K90 A;  4A8V A;  4IGW A;  4A88 A;  3WG8 A;  2M89 A;  1FM4 A;  1XN5 A;  3H3Q A;  3RD6 A;  4REI A;  5E4B A;  1TXC A;  3ZVU A;  4JHI A;  1B6F A;  4QIP A;  2L65 A;  1XN6 A;  3NMV A;  4N3E A;  4LG5 A;  2NS9 A;  3ELI A;  4A86 A;  1E09 A;  2RES A;  3NMP A;  1KCM A;  1XDF A;  2PCS A;  3H3T A;  3P51 A;  5E4D A;  4BK6 A;  4Z3L A;  2QPV A;  3NEG A;  3NMT A;  2GKD A;  2FLH A;  3QN1 A;  4IH0 A;  4A85 A;  4XRT A;  2K7H A;  2LAK A;  3KLX A;  3KB0 A;  4REH A;  4A8G A;  1TW0 A;  1LLT A;  2E3N A;  2RER A;  5BRL A;  1Z94 A;  3NJ1 A;  1VJH A;  2KF2 A;  3Q63 A;  3W9K A;  4BK7 A;  3JRS A;  1XFS A;  4JDA A;  4DSC A;  2R55 A;  3KDH A;  3NJO A;  2KEW A;  4WVO A;  3UJL A;  4MAP A;  2Z9Z A;  4REJ A;  2A1L A;  4N0G C;  1EM2 A;  3TFZ A;  3P0L A;  3UID A;  3CNW A;  3RT0 C;  3FO5 A;  2LGH A;  4Q0K A;  5JO2 A;  2WQL A;  2MOU A;  4IGY A;  4A80 A;  3E85 A;  4Y31 A;  4A84 A;  3NS2 A;  3F08 A;  2QIM A;  1T27 A;  4XRW A;  4C9I A;  3H3S A;  5I8F A;  2NN5 A;  4DSB A;  1ZXF A;  4BKC A;  1X53 A;  5C9Y A;  2L9P A;  4JDL A;  4FPW A;  4A83 A;  1H2O A;  3KB3 A;  1IFV A;  3KDI A;  3TVQ A;  5JO1 A;  1BTV A;  1JSS A;  3K3K A;  2KCZ A;  3NMN A;  3OQU A;  2E3S A; 
#chains in the Genus database with same CATH topology
 3GOB A;  3OTL A;  2BK0 A;  2N4B A;  4LGB A;  2LPX A;  4A87 A;  4QDC A;  3R6P A;  5EKQ C;  4IHR A;  3NR4 A;  4A81 A;  2LE1 A;  3NMH A;  3P9V A;  4OIC A;  4A8U A;  4LA7 A;  4M9B A;  2M47 A;  3TVR A;  4BTZ A;  3GTE A;  3TL1 A;  5AMW A;  2LF2 A;  3GKE A;  4GY9 A;  4M9W A;  2D4R A;  4IH2 A;  3W9R A;  2K5G A;  3NEF A;  2EJX A;  1ICX A;  3Q6A A;  4BKD A;  3NJ0 A;  4JHY A;  2E3O A;  4IGV A;  3KAZ A;  3Q64 A;  4RYV A;  4C9C A;  2Q3Q A;  3GGN A;  2PSO A;  4B9R A;  2LCG A;  3UQH A;  2IL5 A;  3PU2 A;  1XUV A;  1LN1 A;  2VNE A;  3IE5 A;  3OJI A;  3PUT A;  3IJT A;  2Z9Y A;  4LGA A;  4PSB A;  4R7K A;  2I9Y A;  4MNS A;  2REZ A;  1UW5 A;  3OH8 A;  3QSZ A;  5I9J A;  3H3R A;  4N76 A;  2ZYL A;  4IGX A;  4JHH A;  2N4A A;  3RT2 A;  3HJF A;  2VQ5 A;  5E4M A;  1QMR A;  2FFS A;  3KDJ A;  4QDF B;  1BV1 A;  4QDF A;  5JNN A;  3C0V A;  4C94 A;  2LIO A;  3KAY A;  4MA6 A;  1T17 A;  2LEQ A;  1LN3 A;  2E3P A;  2KTE A;  2E3R A;  4DS8 A;  3NI8 A;  4JHG A;  3GL0 A;  2E3Q A;  2LUZ A;  1FSK A;  2LDK A;  3KL1 A;  1LN2 A;  3JRQ B;  2E3M A;  5E46 A;  2L8O A;  3DLH A;  3K90 A;  4A8V A;  4IGW A;  4A88 A;  3WG8 A;  2M89 A;  1FM4 A;  1XN5 A;  3GL2 A;  3H3Q A;  3RD6 A;  4REI A;  5E4B A;  1TXC A;  3NQN A;  3ZVU A;  4JHI A;  1B6F A;  4QDD A;  4QIP A;  2L65 A;  1XN6 A;  3NMV A;  4N3E A;  4LG5 A;  4N41 A;  2NS9 A;  3ELI A;  4A86 A;  1E09 A;  4E6F A;  4NCB A;  2RES A;  3NMP A;  3HXM A;  1KCM A;  1XDF A;  2PCS A;  3H3T A;  3P51 A;  5E4D A;  4BK6 A;  4Z3L A;  3F73 A;  2QPV A;  2LAF A;  3NEG A;  3NMT A;  2GKD A;  2FLH A;  3QN1 A;  4IH0 A;  4A85 A;  4XRT A;  2K7H A;  2LAK A;  3KLX A;  2YH6 A;  3KB0 A;  4REH A;  4A8G A;  1TW0 A;  1LLT A;  3GTS A;  2E3N A;  2RER A;  5BRL A;  1Z94 A;  3NJ1 A;  1VJH A;  2KF2 A;  3Q63 A;  3W9K A;  4BK7 A;  3JRS A;  1XFS A;  4JDA A;  4DSC A;  2R55 A;  3KDH A;  3GB4 A;  2KEW A;  3NJO A;  4WVO A;  3HM9 A;  3TGO C;  3UJL A;  4MAP A;  3HO1 A;  2Z9Z A;  3HVR A;  4REJ A;  2A1L A;  4N0G C;  1EM2 A;  3TFZ A;  3P0L A;  3UID A;  3CNW A;  4QCK A;  3RT0 C;  3FO5 A;  2LGH A;  4N47 A;  4Q0K A;  5JO2 A;  2WQL A;  2MOU A;  4IGY A;  4A80 A;  3E85 A;  4Y31 A;  4A84 A;  3NS2 A;  4KPY A;  3F08 A;  3DLB A;  2QIM A;  1T27 A;  4XRW A;  4C9I A;  3H3S A;  5I8F A;  2NN5 A;  4DSB A;  1ZXF A;  4BKC A;  3HK2 A;  1X53 A;  5C9Y A;  2L9P A;  4JDL A;  4FPW A;  4A83 A;  1H2O A;  3KB3 A;  1IFV A;  3KDI A;  3TVQ A;  5JO1 A;  1BTV A;  1JSS A;  3K3K A;  2KCZ A;  3NMN A;  3OQU A;  4NCA A;  2E3S A; 
#chains in the Genus database with same CATH homology
 3GOB A;  3OTL A;  2BK0 A;  2N4B A;  4LGB A;  2LPX A;  4A87 A;  4QDC A;  3R6P A;  5EKQ C;  4IHR A;  3NR4 A;  4A81 A;  2LE1 A;  3NMH A;  3P9V A;  4OIC A;  4A8U A;  4LA7 A;  4M9B A;  2M47 A;  3TVR A;  4BTZ A;  3GTE A;  3TL1 A;  5AMW A;  2LF2 A;  3GKE A;  4GY9 A;  4M9W A;  2D4R A;  4IH2 A;  3W9R A;  2K5G A;  3NEF A;  2EJX A;  1ICX A;  3Q6A A;  4BKD A;  3NJ0 A;  4JHY A;  2E3O A;  4IGV A;  3KAZ A;  3Q64 A;  4RYV A;  4C9C A;  2Q3Q A;  3GGN A;  2PSO A;  4B9R A;  2LCG A;  3UQH A;  2IL5 A;  3PU2 A;  1XUV A;  1LN1 A;  2VNE A;  3IE5 A;  3OJI A;  3PUT A;  3IJT A;  2Z9Y A;  4LGA A;  4PSB A;  4R7K A;  2I9Y A;  4MNS A;  2REZ A;  1UW5 A;  3OH8 A;  3QSZ A;  5I9J A;  3H3R A;  4N76 A;  2ZYL A;  4IGX A;  4JHH A;  2N4A A;  3RT2 A;  3HJF A;  2VQ5 A;  5E4M A;  1QMR A;  2FFS A;  3KDJ A;  4QDF B;  1BV1 A;  4QDF A;  5JNN A;  3C0V A;  4C94 A;  2LIO A;  3KAY A;  4MA6 A;  1T17 A;  2LEQ A;  1LN3 A;  2E3P A;  2KTE A;  2E3R A;  4DS8 A;  3NI8 A;  4JHG A;  3GL0 A;  2E3Q A;  2LUZ A;  1FSK A;  2LDK A;  3KL1 A;  1LN2 A;  3JRQ B;  2E3M A;  5E46 A;  2L8O A;  3DLH A;  3K90 A;  4A8V A;  4IGW A;  4A88 A;  3WG8 A;  2M89 A;  1FM4 A;  1XN5 A;  3GL2 A;  3H3Q A;  3RD6 A;  4REI A;  5E4B A;  1TXC A;  3NQN A;  3ZVU A;  4JHI A;  1B6F A;  4QDD A;  4QIP A;  2L65 A;  1XN6 A;  3NMV A;  4N3E A;  4LG5 A;  4N41 A;  2NS9 A;  3ELI A;  4A86 A;  1E09 A;  4E6F A;  4NCB A;  2RES A;  3NMP A;  3HXM A;  1KCM A;  1XDF A;  2PCS A;  3H3T A;  3P51 A;  5E4D A;  4BK6 A;  4Z3L A;  3F73 A;  2QPV A;  2LAF A;  3NEG A;  3NMT A;  2GKD A;  2FLH A;  3QN1 A;  4IH0 A;  4A85 A;  4XRT A;  2K7H A;  2LAK A;  3KLX A;  2YH6 A;  3KB0 A;  4REH A;  4A8G A;  1TW0 A;  1LLT A;  3GTS A;  2E3N A;  2RER A;  5BRL A;  1Z94 A;  3NJ1 A;  1VJH A;  2KF2 A;  3Q63 A;  3W9K A;  4BK7 A;  3JRS A;  1XFS A;  4JDA A;  4DSC A;  2R55 A;  3KDH A;  3GB4 A;  2KEW A;  3NJO A;  4WVO A;  3HM9 A;  3TGO C;  3UJL A;  4MAP A;  3HO1 A;  2Z9Z A;  3HVR A;  4REJ A;  2A1L A;  4N0G C;  1EM2 A;  3TFZ A;  3P0L A;  3UID A;  3CNW A;  4QCK A;  3RT0 C;  3FO5 A;  2LGH A;  4N47 A;  4Q0K A;  5JO2 A;  2WQL A;  2MOU A;  4IGY A;  4A80 A;  3E85 A;  4Y31 A;  4A84 A;  3NS2 A;  4KPY A;  3F08 A;  3DLB A;  2QIM A;  1T27 A;  4XRW A;  4C9I A;  3H3S A;  5I8F A;  2NN5 A;  4DSB A;  1ZXF A;  4BKC A;  3HK2 A;  1X53 A;  5C9Y A;  2L9P A;  4JDL A;  4FPW A;  4A83 A;  1H2O A;  3KB3 A;  1IFV A;  3KDI A;  3TVQ A;  5JO1 A;  1BTV A;  1JSS A;  3K3K A;  2KCZ A;  3NMN A;  3OQU A;  4NCA A;  2E3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...