2F66B

Structure of the escrt-i endosomal trafficking complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
b'SQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFADTYNITASNAITRLERGIPITAEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 39
structure length 111
sequence length 111
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.200 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2f66B00
2CAZB 2F66B 2F6MB 2P22B
chains in the Genus database with same CATH superfamily
3IAM1 2IP6A 2RLDA 2JB2A 2V6EA 2BL8A 4YZCA 2L1LB 4PL3A 3IAS1 3AJFA 3LJ0A 3I9V1 3L0IA 2XTQA 2ZW3A 4Q9VA 2JBWA 3DO9A 3LJ1A 1JQOA 4G75A 4YZDA 2FEFA 3DA4A 4OAUC 2RADA 3FVVA 2CAZB 1SJ8A 4Z7GA 4YZ9A 3KP9A 4G76A 2F6MB 2XTRA 4NV5A 4O1OA 2FU2A 3VA9A 3DA3A 4DWLA 4O1PA 4HFVA 2K19A 1W3SA 3P23A 4HEA1 2E8GA 2QZGA 3UITA 5HGIA 5LNK1 2A2DA 2JB3A 2YFBA 2QSBA 2F66B 1U5KA 2FUG1 1YO7A 4U6RA 2ETDA 2HGKA 2RIOA 4JCVE 4AS2A 2ZRRA 3SDJA 2GSCA 1TDPA 2BL7A 4NV2A 3B55A 3Q8DA 3JSBA 4GXTA 2KKMA 2JAEA 2V1CC 3FNBA 4OAVB 2A2CA 2XMXA 2QGMA 2P22B 3LJ2A 4Z7HA 2YFAA 4AS3A 3FBVA 4PL4A 4PL5A 3F4MA 4I1TA 2JB1A 2MJFB
chains in the Genus database with same CATH topology
3IAM1 2IP6A 2JB2A 2V6EA 4YZCA 2L1LB 4PL3A 3IAS1 3AJFA 3LJ0A 3I9V1 3L0IA 2XTQA 4Q9VA 3DO9A 3LJ1A 4G75A 4YZDA 3DA4A 4OAUC 2CAZB 1SJ8A 4Z7GA 4YZ9A 3KP9A 4G76A 2F6MB 2XTRA 4NV5A 4O1OA 3VA9A 3DA3A 4DWLA 4O1PA 4HFVA 2K19A 1W3SA 3P23A 4HEA1 2E8GA 3UITA 5HGIA 5LNK1 2A2DA 2JB3A 2YFBA 2F66B 1U5KA 2FUG1 4U6RA 1YO7A 4AS2A 2RIOA 4JCVE 2ZRRA 3SDJA 4NV2A 3Q8DA 3JSBA 4GXTA 2KKMA 2JAEA 2V1CC 4OAVB 2A2CA 2XMXA 2P22B 3LJ2A 4Z7HA 2YFAA 4AS3A 3FBVA 4PL4A 4PL5A 3F4MA 4I1TA 2JB1A 2MJFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAZ B;  2F66 B;  2F6M B;  2P22 B; 
#chains in the Genus database with same CATH topology
 3IAM 1;  2IP6 A;  2RLD A;  2JB2 A;  2V6E A;  2BL8 A;  4YZC A;  2L1L B;  4PL3 A;  3IAS 1;  3AJF A;  3LJ0 A;  3I9V 1;  3L0I A;  2XTQ A;  2ZW3 A;  4Q9V A;  2JBW A;  3DO9 A;  3LJ1 A;  1JQO A;  4G75 A;  4YZD A;  2FEF A;  3DA4 A;  4OAU C;  2RAD A;  3FVV A;  2CAZ B;  1SJ8 A;  4Z7G A;  4YZ9 A;  3KP9 A;  4G76 A;  2F6M B;  2XTR A;  4NV5 A;  4O1O A;  2FU2 A;  3VA9 A;  3DA3 A;  4DWL A;  4O1P A;  4HFV A;  2K19 A;  1W3S A;  3P23 A;  4HEA 1;  2E8G A;  2QZG A;  3UIT A;  5HGI A;  5LNK 1;  2A2D A;  2JB3 A;  2YFB A;  2QSB A;  2F66 B;  1U5K A;  2FUG 1;  1YO7 A;  4U6R A;  2ETD A;  2HGK A;  2RIO A;  4JCV E;  4AS2 A;  2ZRR A;  3SDJ A;  2GSC A;  1TDP A;  2BL7 A;  4NV2 A;  3B55 A;  3Q8D A;  3JSB A;  4GXT A;  2KKM A;  2JAE A;  2V1C C;  3FNB A;  4OAV B;  2A2C A;  2XMX A;  2QGM A;  2P22 B;  3LJ2 A;  4Z7H A;  2YFA A;  4AS3 A;  3FBV A;  4PL4 A;  4PL5 A;  3F4M A;  4I1T A;  2JB1 A;  2MJF B; 
#chains in the Genus database with same CATH homology
 3IAM 1;  2IP6 A;  2JB2 A;  2V6E A;  4YZC A;  2L1L B;  4PL3 A;  3IAS 1;  3AJF A;  3LJ0 A;  3I9V 1;  3L0I A;  2XTQ A;  4Q9V A;  3DO9 A;  3LJ1 A;  4G75 A;  4YZD A;  3DA4 A;  4OAU C;  2CAZ B;  1SJ8 A;  4Z7G A;  4YZ9 A;  3KP9 A;  4G76 A;  2F6M B;  2XTR A;  4NV5 A;  4O1O A;  3VA9 A;  3DA3 A;  4DWL A;  4O1P A;  4HFV A;  2K19 A;  1W3S A;  3P23 A;  4HEA 1;  2E8G A;  3UIT A;  5HGI A;  5LNK 1;  2A2D A;  2JB3 A;  2YFB A;  2F66 B;  1U5K A;  2FUG 1;  4U6R A;  1YO7 A;  4AS2 A;  2RIO A;  4JCV E;  2ZRR A;  3SDJ A;  4NV2 A;  3Q8D A;  3JSB A;  4GXT A;  2KKM A;  2JAE A;  2V1C C;  4OAV B;  2A2C A;  2XMX A;  2P22 B;  3LJ2 A;  4Z7H A;  2YFA A;  4AS3 A;  3FBV A;  4PL4 A;  4PL5 A;  3F4M A;  4I1T A;  2JB1 A;  2MJF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...