2F66B

Structure of the escrt-i endosomal trafficking complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
SQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFADTYNITASNAITRLERGIPITAEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional organization of the ESCRT-I trafficking complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords Suppressor protein STP22 of temperature-sensitive alpha-fact
total genus 39
structure length 111
sequence length 111
chains with identical sequence E
ec nomenclature
pdb deposition date 2005-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.200 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2f66B00
2F66B 2CAZB 2F6MB 2P22B
chains in the Genus database with same CATH superfamily
3DA3A 1JQOA 2IP6A 4YZDA 2F66B 2XTQA 2BL8A 2FEFA 3LJ2A 4HFVA 4HEA1 2V6EA 4PL5A 2RADA 3UITA 2JB1A 2KKMA 3DO9A 4NV2A 2BL7A 2QZGA 3B55A 4U6RA 3LJ0A 2FU2A 2MJFB 4O1PA 2XMXA 4AS3A 4O1OA 2A2CA 3VA9A 4G76A 4Z7GA 4DWLA 2A2DA 5LNK1 3KP9A 4PL4A 2QGMA 2JB3A 3FNBA 2RIOA 2ETDA 3IAS1 4Q9VA 1U5KA 2JB2A 4PL3A 1TDPA 2F6MB 4JCVE 4YZ9A 2QSBA 3DA4A 2RLDA 2ZRRA 4G75A 4NV5A 2V1CC 4OAVB 2ZW3A 2GSCA 2YFAA 3Q8DA 2YFBA 1W3SA 2E8GA 3FVVA 3SDJA 2XTRA 2JAEA 3AJFA 3L0IA 3JSBA 1YO7A 2HGKA 4Z7HA 2JBWA 2K19A 3P23A 2P22B 3FBVA 3IAM1 3LJ1A 2CAZB 3F4MA 2FUG1 3I9V1 4GXTA 1SJ8A 2L1LB 4OAUC 4I1TA 4YZCA 5HGIA 4AS2A
chains in the Genus database with same CATH topology
1U5KA 1YO7A 2JB1A 2JB2A 2KKMA 3DA3A 3DO9A 4NV2A 4PL3A 2IP6A 4YZDA 4Z7HA 2F6MB 4JCVE 2K19A 4U6RA 3LJ0A 3P23A 4YZ9A 2P22B 3DA4A 2MJFB 2F66B 4O1PA 3FBVA 2ZRRA 2XMXA 2XTQA 4G75A 3LJ2A 4NV5A 5HGIA 4AS3A 2V1CC 4O1OA 2A2CA 3VA9A 4HFVA 4G76A 3IAM1 3LJ1A 4Z7GA 2CAZB 3F4MA 2YFAA 4OAVB 4DWLA 3Q8DA 2YFBA 2A2DA 5LNK1 1W3SA 2E8GA 2FUG1 4HEA1 3I9V1 3KP9A 4PL4A 2V6EA 4GXTA 3SDJA 1SJ8A 2JB3A 2L1LB 2XTRA 4PL5A 4OAUC 2JAEA 4I1TA 2RIOA 3AJFA 3IAS1 3L0IA 4YZCA 4Q9VA 3JSBA 3UITA 4AS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F66 B;  2CAZ B;  2F6M B;  2P22 B; 
#chains in the Genus database with same CATH topology
 3DA3 A;  1JQO A;  2IP6 A;  4YZD A;  2F66 B;  2XTQ A;  2BL8 A;  2FEF A;  3LJ2 A;  4HFV A;  4HEA 1;  2V6E A;  4PL5 A;  2RAD A;  3UIT A;  2JB1 A;  2KKM A;  3DO9 A;  4NV2 A;  2BL7 A;  2QZG A;  3B55 A;  4U6R A;  3LJ0 A;  2FU2 A;  2MJF B;  4O1P A;  2XMX A;  4AS3 A;  4O1O A;  2A2C A;  3VA9 A;  4G76 A;  4Z7G A;  4DWL A;  2A2D A;  5LNK 1;  3KP9 A;  4PL4 A;  2QGM A;  2JB3 A;  3FNB A;  2RIO A;  2ETD A;  3IAS 1;  4Q9V A;  1U5K A;  2JB2 A;  4PL3 A;  1TDP A;  2F6M B;  4JCV E;  4YZ9 A;  2QSB A;  3DA4 A;  2RLD A;  2ZRR A;  4G75 A;  4NV5 A;  2V1C C;  4OAV B;  2ZW3 A;  2GSC A;  2YFA A;  3Q8D A;  2YFB A;  1W3S A;  2E8G A;  3FVV A;  3SDJ A;  2XTR A;  2JAE A;  3AJF A;  3L0I A;  3JSB A;  1YO7 A;  2HGK A;  4Z7H A;  2JBW A;  2K19 A;  3P23 A;  2P22 B;  3FBV A;  3IAM 1;  3LJ1 A;  2CAZ B;  3F4M A;  2FUG 1;  3I9V 1;  4GXT A;  1SJ8 A;  2L1L B;  4OAU C;  4I1T A;  4YZC A;  5HGI A;  4AS2 A; 
#chains in the Genus database with same CATH homology
 1U5K A;  1YO7 A;  2JB1 A;  2JB2 A;  2KKM A;  3DA3 A;  3DO9 A;  4NV2 A;  4PL3 A;  2IP6 A;  4YZD A;  4Z7H A;  2F6M B;  4JCV E;  2K19 A;  4U6R A;  3LJ0 A;  3P23 A;  4YZ9 A;  2P22 B;  3DA4 A;  2MJF B;  2F66 B;  4O1P A;  3FBV A;  2ZRR A;  2XMX A;  2XTQ A;  4G75 A;  3LJ2 A;  4NV5 A;  5HGI A;  4AS3 A;  2V1C C;  4O1O A;  2A2C A;  3VA9 A;  4HFV A;  4G76 A;  3IAM 1;  3LJ1 A;  4Z7G A;  2CAZ B;  3F4M A;  2YFA A;  4OAV B;  4DWL A;  3Q8D A;  2YFB A;  2A2D A;  5LNK 1;  1W3S A;  2E8G A;  2FUG 1;  4HEA 1;  3I9V 1;  3KP9 A;  4PL4 A;  2V6E A;  4GXT A;  3SDJ A;  1SJ8 A;  2JB3 A;  2L1L B;  2XTR A;  4PL5 A;  4OAU C;  2JAE A;  4I1T A;  2RIO A;  3AJF A;  3IAS 1;  3L0I A;  4YZC A;  4Q9V A;  3JSB A;  3UIT A;  4AS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...