4G76A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
291
structure length
291
Chain Sequence
MDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Phosphodiesterase
total genus 81
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g76A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g76A02
2XTRA 4FZNA 4N59A 3DA4A 3DA3A 4N58A 4G76A 4FZMA 2XMXA 2XTQA 4FZLA 4G75A
chains in the Genus database with same CATH superfamily
3UITA 1H6S1 2R8AA 3IAS1 2KDYA 4FSPA 4O3WA 5H2FO 8PRNA 4HFVA 4FUVA 3I9V1 2JAEA 5AFUL 5DL8A 4AYEC 3AA6A 3AAAB 3WI5A 1OSMA 5G39A 4N59A 4AKRA 3T20A 3K19A 3L0IA 2KXPB 2WJRA 3A0HO 5T5FA 4Z7GA 3LK41 1IZNA 1IZNB 3DWNA 3AA7B 3AA1A 4FZNA 3HOLA 3SZDA 2RLDA 4FMSA 4Z7HA 5B5EO 2GSCA 5B66O 4C4VB 2X9KA 3VY9X 5GTHO 3PF1A 3AAEB 4FZLA 1TDPA 4NV5A 4AFKA 4AS2A 3SYBA 4G75A 3BS0A 2JBWA 4LSHA 4YZCA 3WU2O 1ZHWA 3FNBA 5DL7A 3GP6A 4FQEA 3VE1A 2FU2A 5D5DA 1E54A 1P4TA 3NSGA 4O4UA 4AKRB 3HW9A 3SY7A 2LFUA 2ZFGA 3KZIO 3AAAA 4E1SA 4F4BA 4AZLA 5G3AA 2F6MB 4AYID 2R4NA 2IP6A 5FVNA 2R4OA 3PQSA 2XTRA 4GHBA 2ETDA 4HEA1 4Q9VA 4O3XB 2ZLDA 5AFUK 1GFNA 4FRXA 4KR4A 3PGSA 3LJ0A 5HGIA 1OPFA 4JCHA 1U5KA 3JSBA 4XNLA 3AA6B 4PJ0O 2JB3A 4NV2A 3A0BO 2A2CA 1HXTA 2MJFB 2J4UP 4D5UA 4UB6O 4K3CA 3VZTX 2KKMA 4FESA 4FZMA 2JQYA 3LK42 4O49A 4PL4A 1MM5A 2R4LA 5KAIO 3PQUA 1ZHYA 1W3SA 4N75A 4PR7A 4Z3TA 2JMMA 2P22B 3AA1B 2M06A 2A2DA 1QJ8A 5ADXL 1ZHXA 3SY9A 2BL8A 2XE1A 4O1OA 1QJ9A 2KZ7A 2R88A 2PRNA 3C5OA 3F4MA 2CAZB 4FOZA 3HWBA 3O0EA 2FGRA 2R89A 2X27X 3FBVA 1GFMA 4U6RA 3SDJA 4U9CA 4O1PA 2ERVA 4O3ZA 4B61A 4OAUC 2LHFA 1Q9GA 2XE3A 4RLBA 5G26A 3WI4A 3FYXA 1PRNA 2F1TA 4AYNA 4AKMA 3VE2A 2KXPA 7PRNA 3G7GA 3V8UA 3VA9A 2YNKA 2Y0LA 4YZDA 5LNK1 1HXXA 2KZ7B 3AJFA 4IL6O 4PUXA 5DL5A 3DA3A 5TISO 4XNKA 2N2MA 4AUIA 4BUMX 4JFBA 2WVPA 3LK3A 3T0SA 5IYUA 3LJ2A 5EE2A 1YO7A 4GXTA 4K3BA 3POQA 2ZRRA 2XE2A 2QZGA 3KVDD 2E8GA 2JB2A 2RADA 4UB8O 3LK2B 4JCVE 4D65A 3POXA 2K0LA 3PGUA 4N58A 4G76A 5GTIO 2N2LA 3UAQA 4RJWA 3KP9A 4C69X 4RL9A 4RLCA 2WJQA 2W80C 2XMXA 3T24A 2Y2XA 3SZVA 2IWVA 3B55A 5G38A 4AS3A 2ODJA 3NJTA 2W81C 3VY8X 2MHLA 2XE5A 2Y0HA 2GE4A 4O4XA 4AYMC 3AA0A 3A2SX 2FGQX 2K19A 1GFOA 2O4VA 1T16A 4DWLA 4GCSA 4GF4A 1HXUA 2MNHA 3BRZA 3LK2A 1BH3A 1SJ8A 1GFPA 2BL7A 3JCUO 3PRNA 4PL3A 2YFBA 3PORA 3UU2A 4RJXA 3PGRA 3QRAA 1PHOA 1JQOA 3BRYA 4KRAA 4GCQA 1QJPA 5E79O 2YFAA 4LSEA 2IWWA 4E1TA 5ADXK 2KC0A 2K4TA 3P23A 3DWOX 3DZMA 2L1LB 4C4VA 3TZGA 1YS5A 2F1VA 3LK3B 4AYDC 1THQA 2JB1A 3SYSA 1T1LA 2XG6A 2F66B 2QGMA 2RIOA 2AXTO 3AA7A 2XTQA 4LSFA 1ZHTA 4I1TA 1ORMA 2FUG1 1MM4A 4FT6A 2Y0KA 2YPVA 1MPFA 5DL6A 3VZWX 3RBHA 4QQ1A 6PRNA 2QTKA 3AA0B 1ZHZA 2PORA 3JTYA 2R4PA 3DO9A 1BT9A 2M07A 2FEFA 3DA4A 4KR8A 1Q9FA 3POUA 2HGKA 1G90A 3IAM1 3HOEA 1S5LO 4FSOA 2J1NA 4C00A 4PL5A 4YZ9A 4FRTA 3FVVA 4OAVB 3AAEA 3LJ1A 5JDPA 3VZUX 3Q8DA 5GV0A 3EMNX 2V1CC 4LSIA 4GCPA 2Y7SA 2ZW3A 2OMFA 1BXWA 4CTDA 5KAFO 2V6EA 5PRNA 3UPGA 2F1CX 2QSBA 1GFQA 4D64A 4O3YA 4N74A 3QRCA
chains in the Genus database with same CATH topology
3UITA 1H6S1 3AJFA 4GCQA 1QJPA 2ZLDA 4O3XB 2YFAA 3IAS1 2KDYA 1GFNA 4LSEA 4AKRB 4FSPA 5AFUK 4FRXA 4KR4A 4O3WA 3LJ0A 4PUXA 5HGIA 4E1TA 5DL5A 5ADXK 3DA3A 1OPFA 2KC0A 4JCHA 2K4TA 1U5KA 4XNKA 3JSBA 3P23A 2N2MA 4XNLA 4AUIA 4BUMX 2L1LB 4JFBA 3AA6B 4HFVA 3LK3A 3TZGA 8PRNA 2JB3A 4FUVA 3T0SA 3I9V1 4NV2A 5IYUA 3LJ2A 2JAEA 2A2CA 1YS5A 5DL8A 2F1VA 4AYEC 3AA6A 1HXTA 3AAAB 1YO7A 2MJFB 4GXTA 3LK3B 5EE2A 3WI5A 4AYDC 3POQA 1THQA 4D5UA 2J4UP 2ZRRA 2JB1A 3VZTX 2XE2A 3SYSA 1OSMA 3KVDD 2E8GA 2KKMA 2F66B 2JB2A 2XG6A 4FESA 3LK2B 4FZMA 3K19A 2RIOA 3AA7A 3L0IA 4AKRA 3LK42 2XTQA 4LSFA 4O49A 4PL4A 4JCVE 1MM5A 1ZHTA 4D65A 2KXPB 4I1TA 1ORMA 3POXA 2FUG1 1MM4A 3PQUA 5T5FA 1ZHYA 4Z7GA 2K0LA 3LK41 1IZNA 1IZNB 1W3SA 2Y0KA 4FT6A 3AA7B 3AA1A 4FZNA 3HOLA 3SZDA 4N58A 4G76A 2N2LA 2YPVA 4Z3TA 2JMMA 3UAQA 4RJWA 1MPFA 3KP9A 4C69X 4FMSA 4RL9A 4RLCA 5DL6A 2P22B 4Z7HA 2W80C 3AA1B 2XMXA 2M06A 3T20A 2A2DA 3T24A 3VZWX 1QJ8A 3RBHA 1ZHXA 2Y2XA 5ADXL 3SY9A 3SZVA 2XE1A 3VY9X 4O1OA 4AS3A 1QJ9A 2KZ7A 2ODJA 2QTKA 4QQ1A 6PRNA 2W81C 3VY8X 3AAEB 4FZLA 2PRNA 3AA0B 3F4MA 3C5OA 1ZHZA 4NV5A 2MHLA 4AFKA 4AS2A 2XE5A 2CAZB 2Y0HA 4FOZA 2PORA 3HWBA 3SYBA 3O0EA 3JTYA 3DO9A 2FGRA 2GE4A 4G75A 2X27X 1BT9A 4LSHA 2M07A 4O4XA 3DA4A 3FBVA 4KR8A 4AYMC 3AA0A 4YZCA 1GFMA 1Q9FA 1ZHWA 3POUA 1G90A 4U6RA 3SDJA 3IAM1 3A2SX 4U9CA 5DL7A 4O1PA 2ERVA 3GP6A 3HOEA 4FSOA 4N59A 2FGQX 4O3ZA 4B61A 2J1NA 3VE1A 4OAUC 2K19A 1GFOA 2O4VA 2LHFA 4DWLA 4GCSA 4GF4A 1HXUA 5D5DA 1E54A 1P4TA 2MNHA 4PL5A 3NSGA 1Q9GA 2XE3A 4YZ9A 3LK2A 3HW9A 4FRTA 3FYXA 4O4UA 4RLBA 5G26A 3WI4A 3SY7A 1PRNA 4OAVB 1BH3A 2F1TA 2LFUA 3AAEA 2ZFGA 4AYNA 3LJ1A 4AKMA 1SJ8A 3VE2A 5JDPA 3VZUX 3Q8DA 3AAAA 3EMNX 4E1SA 1GFPA 4F4BA 5GV0A 2KXPA 2V1CC 3PRNA 4AZLA 5AFUL 3G7GA 7PRNA 4PL3A 2F6MB 2YFBA 3VA9A 4LSIA 3V8UA 4GCPA 3PORA 4AYID 3UU2A 2Y7SA 2YNKA 2OMFA 4RJXA 3QRAA 2Y0LA 1BXWA 2IP6A 4YZDA 5FVNA 1PHOA 3PQSA 2V6EA 4KRAA 2XTRA 5PRNA 3UPGA 4GHBA 5LNK1 1HXXA 1GFQA 4D64A 4O3YA 2KZ7B 4HEA1 4Q9VA 3QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTR A;  4FZN A;  4N59 A;  3DA4 A;  3DA3 A;  4N58 A;  4G76 A;  4FZM A;  2XMX A;  2XTQ A;  4FZL A;  4G75 A; 
#chains in the Genus database with same CATH topology
 3UIT A;  1H6S 1;  2R8A A;  3IAS 1;  2KDY A;  4FSP A;  4O3W A;  5H2F O;  8PRN A;  4HFV A;  4FUV A;  3I9V 1;  2JAE A;  5AFU L;  5DL8 A;  4AYE C;  3AA6 A;  3AAA B;  3WI5 A;  1OSM A;  5G39 A;  4N59 A;  4AKR A;  3T20 A;  3K19 A;  3L0I A;  2KXP B;  2WJR A;  3A0H O;  5T5F A;  4Z7G A;  3LK4 1;  1IZN A;  1IZN B;  3DWN A;  3AA7 B;  3AA1 A;  4FZN A;  3HOL A;  3SZD A;  2RLD A;  4FMS A;  4Z7H A;  5B5E O;  2GSC A;  5B66 O;  4C4V B;  2X9K A;  3VY9 X;  5GTH O;  3PF1 A;  3AAE B;  4FZL A;  1TDP A;  4NV5 A;  4AFK A;  4AS2 A;  3SYB A;  4G75 A;  3BS0 A;  2JBW A;  4LSH A;  4YZC A;  3WU2 O;  1ZHW A;  3FNB A;  5DL7 A;  3GP6 A;  4FQE A;  3VE1 A;  2FU2 A;  5D5D A;  1E54 A;  1P4T A;  3NSG A;  4O4U A;  4AKR B;  3HW9 A;  3SY7 A;  2LFU A;  2ZFG A;  3KZI O;  3AAA A;  4E1S A;  4F4B A;  4AZL A;  5G3A A;  2F6M B;  4AYI D;  2R4N A;  2IP6 A;  5FVN A;  2R4O A;  3PQS A;  2XTR A;  4GHB A;  2ETD A;  4HEA 1;  4Q9V A;  4O3X B;  2ZLD A;  5AFU K;  1GFN A;  4FRX A;  4KR4 A;  3PGS A;  3LJ0 A;  5HGI A;  1OPF A;  4JCH A;  1U5K A;  3JSB A;  4XNL A;  3AA6 B;  4PJ0 O;  2JB3 A;  4NV2 A;  3A0B O;  2A2C A;  1HXT A;  2MJF B;  2J4U P;  4D5U A;  4UB6 O;  4K3C A;  3VZT X;  2KKM A;  4FES A;  4FZM A;  2JQY A;  3LK4 2;  4O49 A;  4PL4 A;  1MM5 A;  2R4L A;  5KAI O;  3PQU A;  1ZHY A;  1W3S A;  4N75 A;  4PR7 A;  4Z3T A;  2JMM A;  2P22 B;  3AA1 B;  2M06 A;  2A2D A;  1QJ8 A;  5ADX L;  1ZHX A;  3SY9 A;  2BL8 A;  2XE1 A;  4O1O A;  1QJ9 A;  2KZ7 A;  2R88 A;  2PRN A;  3C5O A;  3F4M A;  2CAZ B;  4FOZ A;  3HWB A;  3O0E A;  2FGR A;  2R89 A;  2X27 X;  3FBV A;  1GFM A;  4U6R A;  3SDJ A;  4U9C A;  4O1P A;  2ERV A;  4O3Z A;  4B61 A;  4OAU C;  2LHF A;  1Q9G A;  2XE3 A;  4RLB A;  5G26 A;  3WI4 A;  3FYX A;  1PRN A;  2F1T A;  4AYN A;  4AKM A;  3VE2 A;  2KXP A;  7PRN A;  3G7G A;  3V8U A;  3VA9 A;  2YNK A;  2Y0L A;  4YZD A;  5LNK 1;  1HXX A;  2KZ7 B;  3AJF A;  4IL6 O;  4PUX A;  5DL5 A;  3DA3 A;  5TIS O;  4XNK A;  2N2M A;  4AUI A;  4BUM X;  4JFB A;  2WVP A;  3LK3 A;  3T0S A;  5IYU A;  3LJ2 A;  5EE2 A;  1YO7 A;  4GXT A;  4K3B A;  3POQ A;  2ZRR A;  2XE2 A;  2QZG A;  3KVD D;  2E8G A;  2JB2 A;  2RAD A;  4UB8 O;  3LK2 B;  4JCV E;  4D65 A;  3POX A;  2K0L A;  3PGU A;  4N58 A;  4G76 A;  5GTI O;  2N2L A;  3UAQ A;  4RJW A;  3KP9 A;  4C69 X;  4RL9 A;  4RLC A;  2WJQ A;  2W80 C;  2XMX A;  3T24 A;  2Y2X A;  3SZV A;  2IWV A;  3B55 A;  5G38 A;  4AS3 A;  2ODJ A;  3NJT A;  2W81 C;  3VY8 X;  2MHL A;  2XE5 A;  2Y0H A;  2GE4 A;  4O4X A;  4AYM C;  3AA0 A;  3A2S X;  2FGQ X;  2K19 A;  1GFO A;  2O4V A;  1T16 A;  4DWL A;  4GCS A;  4GF4 A;  1HXU A;  2MNH A;  3BRZ A;  3LK2 A;  1BH3 A;  1SJ8 A;  1GFP A;  2BL7 A;  3JCU O;  3PRN A;  4PL3 A;  2YFB A;  3POR A;  3UU2 A;  4RJX A;  3PGR A;  3QRA A;  1PHO A;  1JQO A;  3BRY A;  4KRA A;  4GCQ A;  1QJP A;  5E79 O;  2YFA A;  4LSE A;  2IWW A;  4E1T A;  5ADX K;  2KC0 A;  2K4T A;  3P23 A;  3DWO X;  3DZM A;  2L1L B;  4C4V A;  3TZG A;  1YS5 A;  2F1V A;  3LK3 B;  4AYD C;  1THQ A;  2JB1 A;  3SYS A;  1T1L A;  2XG6 A;  2F66 B;  2QGM A;  2RIO A;  2AXT O;  3AA7 A;  2XTQ A;  4LSF A;  1ZHT A;  4I1T A;  1ORM A;  2FUG 1;  1MM4 A;  4FT6 A;  2Y0K A;  2YPV A;  1MPF A;  5DL6 A;  3VZW X;  3RBH A;  4QQ1 A;  6PRN A;  2QTK A;  3AA0 B;  1ZHZ A;  2POR A;  3JTY A;  2R4P A;  3DO9 A;  1BT9 A;  2M07 A;  2FEF A;  3DA4 A;  4KR8 A;  1Q9F A;  3POU A;  2HGK A;  1G90 A;  3IAM 1;  3HOE A;  1S5L O;  4FSO A;  2J1N A;  4C00 A;  4PL5 A;  4YZ9 A;  4FRT A;  3FVV A;  4OAV B;  3AAE A;  3LJ1 A;  5JDP A;  3VZU X;  3Q8D A;  5GV0 A;  3EMN X;  2V1C C;  4LSI A;  4GCP A;  2Y7S A;  2ZW3 A;  2OMF A;  1BXW A;  4CTD A;  5KAF O;  2V6E A;  5PRN A;  3UPG A;  2F1C X;  2QSB A;  1GFQ A;  4D64 A;  4O3Y A;  4N74 A;  3QRC A; 
#chains in the Genus database with same CATH homology
 3UIT A;  1H6S 1;  3AJF A;  4GCQ A;  1QJP A;  2ZLD A;  4O3X B;  2YFA A;  3IAS 1;  2KDY A;  1GFN A;  4LSE A;  4AKR B;  4FSP A;  5AFU K;  4FRX A;  4KR4 A;  4O3W A;  3LJ0 A;  4PUX A;  5HGI A;  4E1T A;  5DL5 A;  5ADX K;  3DA3 A;  1OPF A;  2KC0 A;  4JCH A;  2K4T A;  1U5K A;  4XNK A;  3JSB A;  3P23 A;  2N2M A;  4XNL A;  4AUI A;  4BUM X;  2L1L B;  4JFB A;  3AA6 B;  4HFV A;  3LK3 A;  3TZG A;  8PRN A;  2JB3 A;  4FUV A;  3T0S A;  3I9V 1;  4NV2 A;  5IYU A;  3LJ2 A;  2JAE A;  2A2C A;  1YS5 A;  5DL8 A;  2F1V A;  4AYE C;  3AA6 A;  1HXT A;  3AAA B;  1YO7 A;  2MJF B;  4GXT A;  3LK3 B;  5EE2 A;  3WI5 A;  4AYD C;  3POQ A;  1THQ A;  4D5U A;  2J4U P;  2ZRR A;  2JB1 A;  3VZT X;  2XE2 A;  3SYS A;  1OSM A;  3KVD D;  2E8G A;  2KKM A;  2F66 B;  2JB2 A;  2XG6 A;  4FES A;  3LK2 B;  4FZM A;  3K19 A;  2RIO A;  3AA7 A;  3L0I A;  4AKR A;  3LK4 2;  2XTQ A;  4LSF A;  4O49 A;  4PL4 A;  4JCV E;  1MM5 A;  1ZHT A;  4D65 A;  2KXP B;  4I1T A;  1ORM A;  3POX A;  2FUG 1;  1MM4 A;  3PQU A;  5T5F A;  1ZHY A;  4Z7G A;  2K0L A;  3LK4 1;  1IZN A;  1IZN B;  1W3S A;  2Y0K A;  4FT6 A;  3AA7 B;  3AA1 A;  4FZN A;  3HOL A;  3SZD A;  4N58 A;  4G76 A;  2N2L A;  2YPV A;  4Z3T A;  2JMM A;  3UAQ A;  4RJW A;  1MPF A;  3KP9 A;  4C69 X;  4FMS A;  4RL9 A;  4RLC A;  5DL6 A;  2P22 B;  4Z7H A;  2W80 C;  3AA1 B;  2XMX A;  2M06 A;  3T20 A;  2A2D A;  3T24 A;  3VZW X;  1QJ8 A;  3RBH A;  1ZHX A;  2Y2X A;  5ADX L;  3SY9 A;  3SZV A;  2XE1 A;  3VY9 X;  4O1O A;  4AS3 A;  1QJ9 A;  2KZ7 A;  2ODJ A;  2QTK A;  4QQ1 A;  6PRN A;  2W81 C;  3VY8 X;  3AAE B;  4FZL A;  2PRN A;  3AA0 B;  3F4M A;  3C5O A;  1ZHZ A;  4NV5 A;  2MHL A;  4AFK A;  4AS2 A;  2XE5 A;  2CAZ B;  2Y0H A;  4FOZ A;  2POR A;  3HWB A;  3SYB A;  3O0E A;  3JTY A;  3DO9 A;  2FGR A;  2GE4 A;  4G75 A;  2X27 X;  1BT9 A;  4LSH A;  2M07 A;  4O4X A;  3DA4 A;  3FBV A;  4KR8 A;  4AYM C;  3AA0 A;  4YZC A;  1GFM A;  1Q9F A;  1ZHW A;  3POU A;  1G90 A;  4U6R A;  3SDJ A;  3IAM 1;  3A2S X;  4U9C A;  5DL7 A;  4O1P A;  2ERV A;  3GP6 A;  3HOE A;  4FSO A;  4N59 A;  2FGQ X;  4O3Z A;  4B61 A;  2J1N A;  3VE1 A;  4OAU C;  2K19 A;  1GFO A;  2O4V A;  2LHF A;  4DWL A;  4GCS A;  4GF4 A;  1HXU A;  5D5D A;  1E54 A;  1P4T A;  2MNH A;  4PL5 A;  3NSG A;  1Q9G A;  2XE3 A;  4YZ9 A;  3LK2 A;  3HW9 A;  4FRT A;  3FYX A;  4O4U A;  4RLB A;  5G26 A;  3WI4 A;  3SY7 A;  1PRN A;  4OAV B;  1BH3 A;  2F1T A;  2LFU A;  3AAE A;  2ZFG A;  4AYN A;  3LJ1 A;  4AKM A;  1SJ8 A;  3VE2 A;  5JDP A;  3VZU X;  3Q8D A;  3AAA A;  3EMN X;  4E1S A;  1GFP A;  4F4B A;  5GV0 A;  2KXP A;  2V1C C;  3PRN A;  4AZL A;  5AFU L;  3G7G A;  7PRN A;  4PL3 A;  2F6M B;  2YFB A;  3VA9 A;  4LSI A;  3V8U A;  4GCP A;  3POR A;  4AYI D;  3UU2 A;  2Y7S A;  2YNK A;  2OMF A;  4RJX A;  3QRA A;  2Y0L A;  1BXW A;  2IP6 A;  4YZD A;  5FVN A;  1PHO A;  3PQS A;  2V6E A;  4KRA A;  2XTR A;  5PRN A;  3UPG A;  4GHB A;  5LNK 1;  1HXX A;  1GFQ A;  4D64 A;  4O3Y A;  2KZ7 B;  4HEA 1;  4Q9V A;  3QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...