4G76A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
291
structure length
291
Chain Sequence
MDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphodiesterase
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 81
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g76A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g76A02
4G76A 4N59A 2XMXA 2XTRA 4N58A 4FZMA 3DA4A 2XTQA 4FZLA 4G75A 4FZNA 3DA3A
chains in the Genus database with same CATH superfamily
5ADXL 4K3CA 5G26A 2FGRA 5G3AA 3QRAA 2GSCA 4Z7GA 4FESA 2F66B 4N74A 3K19A 3SYBA 2JQYA 2R4OA 3KVDD 5KAFO 4GHBA 2RADA 3AAEB 4KRAA 4Q9VA 2ZLDA 2W80C 3POQA 3TZGA 3PQSA 4PL5A 1BXWA 1QJ8A 3PF1A 5HGIA 1MPFA 3DA4A 3WI5A 4N75A 1BH3A 5EE2A 4O3ZA 2F1VA 4AZLA 1ZHWA 3VZTX 2MJFB 4AS2A 4FRTA 4LSHA 2Y0KA 3FYXA 3DA3A 4PUXA 4AKRA 3JTYA 3AA6A 1S5LO 2XE1A 2XMXA 4OAUC 3AA7B 2KC0A 4PJ0O 4O4XA 3FBVA 4FUVA 2F1CX 3AA1B 2FU2A 4HEA1 1G90A 3SZDA 2OMFA 2XE3A 4IL6O 1GFMA 2P22B 1QJPA 1T1LA 4GF4A 2XTRA 3NSGA 3RBHA 1YO7A 4C00A 4LSIA 3HW9A 3SDJA 4RLBA 2IP6A 4AFKA 2KZ7B 3F4MA 2WJRA 3AA0A 1ZHZA 2YPVA 1PHOA 2KXPB 2Y7SA 5B5EO 2IWVA 1GFOA 2HGKA 2WVPA 4FMSA 4Z3TA 3UITA 2A2CA 2PRNA 1HXTA 4E1SA 5KAIO 3IAM1 5IYUA 4C4VB 3BS0A 1ZHTA 3VY9X 3WU2O 1Q9GA 4FSPA 5ADXK 2V1CC 3VZWX 4AUIA 1JQOA 4PL3A 4AYDC 2YNKA 3DWOX 1QJ9A 4AYNA 2K19A 3O0EA 3A0HO 2J1NA 3BRZA 1BT9A 3C5OA 3T0SA 2W81C 3QRCA 3LK3B 5G38A 3AAEA 4Z7HA 4AS3A 1E54A 5AFUK 4JCHA 3AAAB 5JDPA 5AFUL 5DL8A 1GFNA 4AYEC 5E79O 4O3YA 2M06A 4D5UA 3P23A 2XE2A 3VA9A 4U6RA 2A2DA 2RIOA 4NV5A 4E1TA 4D65A 3UU2A 1SJ8A 3V8UA 4O1OA 2R4LA 4XNKA 1ORMA 1YS5A 2MNHA 3AA7A 3SY7A 4JFBA 2ETDA 4RLCA 3PQUA 5DL7A 2F1TA 3LK2B 2J4UP 4JCVE 3NJTA 2KDYA 2R4NA 1W3SA 3AA1A 1GFPA 3VZUX 4HFVA 3G7GA 4YZDA 3POUA 2BL7A 5GV0A 3PGSA 1TDPA 7PRNA 2Y2XA 2JAEA 4O3WA 2KZ7A 4N59A 4PR7A 1IZNB 5TISO 2QSBA 5PRNA 2AXTO 4QQ1A 2KXPA 2QZGA 1HXXA 4RJWA 3A0BO 1ZHXA 4AKMA 3VE1A 5LNK1 2QGMA 3T20A 2IWWA 2ODJA 4CTDA 3UPGA 4C4VA 3WI4A 3HOLA 3SZVA 4O3XB 3A2SX 2F6MB 4UB8O 4FQEA 2X27X 4N58A 4U9CA 3FVVA 3KP9A 3JSBA 4GXTA 3Q8DA 4GCSA 2JB2A 4I1TA 3KZIO 4O4UA 4FOZA 2LHFA 2N2LA 2E8GA 5FVNA 4KR8A 2L1LB 2R88A 4FZMA 4DWLA 2JMMA 3DZMA 4FT6A 5T5FA 2K4TA 3LK3A 1MM5A 4UB6O 4O49A 4B61A 4FZLA 3LJ2A 3AAAA 5GTIO 3FNBA 3GP6A 4O1PA 3PGRA 3VY8X 2X9KA 3DWNA 2ZFGA 4GCQA 2YFBA 2V6EA 3VE2A 8PRNA 1OPFA 3LK42 4RJXA 3HWBA 3LK41 2GE4A 4PL4A 3JCUO 4YZCA 3SYSA 1THQA 6PRNA 4KR4A 4F4BA 2WJQA 2LFUA 3PRNA 4AYMC 2R8AA 2FUG1 1U5KA 3T24A 1MM4A 3AJFA 2M07A 3IAS1 3LK2A 3POXA 4GCPA 2R89A 4C69X 4G76A 5B66O 4LSFA 2PORA 1H6S1 3LJ0A 1PRNA 4AKRB 4BUMX 5DL6A 1ZHYA 3AA6B 4FRXA 4D64A 1OSMA 2Y0LA 2JBWA 1P4TA 2XG6A 3HOEA 2Y0HA 1IZNA 3UAQA 4XNLA 4K3BA 1T16A 2R4PA 2O4VA 4YZ9A 4OAVB 2JB1A 1HXUA 4G75A 1Q9FA 5G39A 5D5DA 2ERVA 2FGQX 5H2FO 4NV2A 4RL9A 3I9V1 2QTKA 3BRYA 4FSOA 2FEFA 2N2MA 2MHLA 4LSEA 5GTHO 3L0IA 3DO9A 2CAZB 3AA0B 3B55A 2KKMA 2JB3A 3SY9A 3EMNX 4AYID 3PORA 4FZNA 3PGUA 2BL8A 2ZRRA 1GFQA 3LJ1A 5DL5A 2XTQA 2RLDA 2ZW3A 2K0LA 2YFAA 2XE5A
chains in the Genus database with same CATH topology
5ADXL 2FGRA 3QRAA 4Z7GA 4FESA 2F66B 3K19A 3SYBA 3KVDD 4GHBA 3AAEB 4KRAA 4Q9VA 2ZLDA 2W80C 3POQA 3TZGA 3PQSA 4PL5A 1BXWA 1QJ8A 5HGIA 1MPFA 3DA4A 3WI5A 1BH3A 5EE2A 4O3ZA 2F1VA 4AZLA 1ZHWA 3VZTX 2MJFB 4AS2A 4FRTA 4LSHA 2Y0KA 3FYXA 3DA3A 4PUXA 4AKRA 3JTYA 3AA6A 2XE1A 2XMXA 4OAUC 3AA7B 2KC0A 4O4XA 3FBVA 4FUVA 3AA1B 4HEA1 1G90A 3SZDA 2OMFA 2XE3A 1GFMA 2P22B 1QJPA 4GF4A 2XTRA 3NSGA 3RBHA 1YO7A 4LSIA 3HW9A 3SDJA 4RLBA 2IP6A 4AFKA 2KZ7B 3F4MA 3AA0A 1ZHZA 2YPVA 1PHOA 2KXPB 2Y7SA 1GFOA 4FMSA 4Z3TA 3UITA 2A2CA 2PRNA 1HXTA 4E1SA 3IAM1 5IYUA 1ZHTA 3VY9X 1Q9GA 4FSPA 5ADXK 2V1CC 3VZWX 4AUIA 4PL3A 4AYDC 2YNKA 1QJ9A 4AYNA 2K19A 3O0EA 2J1NA 1BT9A 3C5OA 3T0SA 2W81C 3QRCA 3LK3B 3AAEA 4Z7HA 4AS3A 1E54A 5AFUK 4JCHA 3AAAB 5JDPA 5AFUL 5DL8A 1GFNA 4AYEC 4O3YA 2M06A 4D5UA 3P23A 2XE2A 3VA9A 4U6RA 2A2DA 2RIOA 4NV5A 4E1TA 4D65A 3UU2A 1SJ8A 3V8UA 4O1OA 4XNKA 1ORMA 1YS5A 2MNHA 3AA7A 3SY7A 4JFBA 4RLCA 3PQUA 5DL7A 2F1TA 3LK2B 2J4UP 4JCVE 2KDYA 1W3SA 3AA1A 1GFPA 3VZUX 4HFVA 3G7GA 4YZDA 3POUA 5GV0A 7PRNA 2Y2XA 2JAEA 4O3WA 2KZ7A 4N59A 1IZNB 5PRNA 4QQ1A 2KXPA 1HXXA 4RJWA 1ZHXA 4AKMA 3VE1A 5LNK1 3T20A 2ODJA 3UPGA 3WI4A 3HOLA 3SZVA 4O3XB 3A2SX 2F6MB 2X27X 4N58A 4U9CA 3KP9A 3JSBA 4GXTA 3Q8DA 4GCSA 2JB2A 4I1TA 4O4UA 4FOZA 2LHFA 2N2LA 2E8GA 5FVNA 4KR8A 2XE5A 2L1LB 4FZMA 4DWLA 2JMMA 4FT6A 5T5FA 2K4TA 3LK3A 1MM5A 4O49A 4B61A 4FZLA 3LJ2A 3AAAA 3GP6A 4O1PA 3VY8X 2ZFGA 4GCQA 2YFBA 2V6EA 3VE2A 8PRNA 1OPFA 3LK42 4RJXA 3HWBA 3LK41 2GE4A 4PL4A 4YZCA 3SYSA 1THQA 6PRNA 4KR4A 4F4BA 2LFUA 3PRNA 4AYMC 2FUG1 1U5KA 3T24A 1MM4A 3AJFA 2M07A 3IAS1 3LK2A 3POXA 4GCPA 4C69X 4G76A 4LSFA 2PORA 1H6S1 3LJ0A 1PRNA 4AKRB 4BUMX 5DL6A 1ZHYA 3AA6B 4FRXA 4D64A 1OSMA 2Y0LA 1P4TA 2XG6A 3HOEA 2Y0HA 1IZNA 3UAQA 4XNLA 2O4VA 4YZ9A 4OAVB 2JB1A 1HXUA 4G75A 1Q9FA 5D5DA 2ERVA 2FGQX 4NV2A 4RL9A 3I9V1 2QTKA 4FSOA 4LSEA 2N2MA 2MHLA 3L0IA 3DO9A 2CAZB 3AA0B 2KKMA 2JB3A 3SY9A 3EMNX 4AYID 3PORA 4FZNA 2ZRRA 1GFQA 3LJ1A 5DL5A 2XTQA 2K0LA 2YFAA 5G26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G76 A;  4N59 A;  2XMX A;  2XTR A;  4N58 A;  4FZM A;  3DA4 A;  2XTQ A;  4FZL A;  4G75 A;  4FZN A;  3DA3 A; 
#chains in the Genus database with same CATH topology
 5ADX L;  4K3C A;  5G26 A;  2FGR A;  5G3A A;  3QRA A;  2GSC A;  4Z7G A;  4FES A;  2F66 B;  4N74 A;  3K19 A;  3SYB A;  2JQY A;  2R4O A;  3KVD D;  5KAF O;  4GHB A;  2RAD A;  3AAE B;  4KRA A;  4Q9V A;  2ZLD A;  2W80 C;  3POQ A;  3TZG A;  3PQS A;  4PL5 A;  1BXW A;  1QJ8 A;  3PF1 A;  5HGI A;  1MPF A;  3DA4 A;  3WI5 A;  4N75 A;  1BH3 A;  5EE2 A;  4O3Z A;  2F1V A;  4AZL A;  1ZHW A;  3VZT X;  2MJF B;  4AS2 A;  4FRT A;  4LSH A;  2Y0K A;  3FYX A;  3DA3 A;  4PUX A;  4AKR A;  3JTY A;  3AA6 A;  1S5L O;  2XE1 A;  2XMX A;  4OAU C;  3AA7 B;  2KC0 A;  4PJ0 O;  4O4X A;  3FBV A;  4FUV A;  2F1C X;  3AA1 B;  2FU2 A;  4HEA 1;  1G90 A;  3SZD A;  2OMF A;  2XE3 A;  4IL6 O;  1GFM A;  2P22 B;  1QJP A;  1T1L A;  4GF4 A;  2XTR A;  3NSG A;  3RBH A;  1YO7 A;  4C00 A;  4LSI A;  3HW9 A;  3SDJ A;  4RLB A;  2IP6 A;  4AFK A;  2KZ7 B;  3F4M A;  2WJR A;  3AA0 A;  1ZHZ A;  2YPV A;  1PHO A;  2KXP B;  2Y7S A;  5B5E O;  2IWV A;  1GFO A;  2HGK A;  2WVP A;  4FMS A;  4Z3T A;  3UIT A;  2A2C A;  2PRN A;  1HXT A;  4E1S A;  5KAI O;  3IAM 1;  5IYU A;  4C4V B;  3BS0 A;  1ZHT A;  3VY9 X;  3WU2 O;  1Q9G A;  4FSP A;  5ADX K;  2V1C C;  3VZW X;  4AUI A;  1JQO A;  4PL3 A;  4AYD C;  2YNK A;  3DWO X;  1QJ9 A;  4AYN A;  2K19 A;  3O0E A;  3A0H O;  2J1N A;  3BRZ A;  1BT9 A;  3C5O A;  3T0S A;  2W81 C;  3QRC A;  3LK3 B;  5G38 A;  3AAE A;  4Z7H A;  4AS3 A;  1E54 A;  5AFU K;  4JCH A;  3AAA B;  5JDP A;  5AFU L;  5DL8 A;  1GFN A;  4AYE C;  5E79 O;  4O3Y A;  2M06 A;  4D5U A;  3P23 A;  2XE2 A;  3VA9 A;  4U6R A;  2A2D A;  2RIO A;  4NV5 A;  4E1T A;  4D65 A;  3UU2 A;  1SJ8 A;  3V8U A;  4O1O A;  2R4L A;  4XNK A;  1ORM A;  1YS5 A;  2MNH A;  3AA7 A;  3SY7 A;  4JFB A;  2ETD A;  4RLC A;  3PQU A;  5DL7 A;  2F1T A;  3LK2 B;  2J4U P;  4JCV E;  3NJT A;  2KDY A;  2R4N A;  1W3S A;  3AA1 A;  1GFP A;  3VZU X;  4HFV A;  3G7G A;  4YZD A;  3POU A;  2BL7 A;  5GV0 A;  3PGS A;  1TDP A;  7PRN A;  2Y2X A;  2JAE A;  4O3W A;  2KZ7 A;  4N59 A;  4PR7 A;  1IZN B;  5TIS O;  2QSB A;  5PRN A;  2AXT O;  4QQ1 A;  2KXP A;  2QZG A;  1HXX A;  4RJW A;  3A0B O;  1ZHX A;  4AKM A;  3VE1 A;  5LNK 1;  2QGM A;  3T20 A;  2IWW A;  2ODJ A;  4CTD A;  3UPG A;  4C4V A;  3WI4 A;  3HOL A;  3SZV A;  4O3X B;  3A2S X;  2F6M B;  4UB8 O;  4FQE A;  2X27 X;  4N58 A;  4U9C A;  3FVV A;  3KP9 A;  3JSB A;  4GXT A;  3Q8D A;  4GCS A;  2JB2 A;  4I1T A;  3KZI O;  4O4U A;  4FOZ A;  2LHF A;  2N2L A;  2E8G A;  5FVN A;  4KR8 A;  2L1L B;  2R88 A;  4FZM A;  4DWL A;  2JMM A;  3DZM A;  4FT6 A;  5T5F A;  2K4T A;  3LK3 A;  1MM5 A;  4UB6 O;  4O49 A;  4B61 A;  4FZL A;  3LJ2 A;  3AAA A;  5GTI O;  3FNB A;  3GP6 A;  4O1P A;  3PGR A;  3VY8 X;  2X9K A;  3DWN A;  2ZFG A;  4GCQ A;  2YFB A;  2V6E A;  3VE2 A;  8PRN A;  1OPF A;  3LK4 2;  4RJX A;  3HWB A;  3LK4 1;  2GE4 A;  4PL4 A;  3JCU O;  4YZC A;  3SYS A;  1THQ A;  6PRN A;  4KR4 A;  4F4B A;  2WJQ A;  2LFU A;  3PRN A;  4AYM C;  2R8A A;  2FUG 1;  1U5K A;  3T24 A;  1MM4 A;  3AJF A;  2M07 A;  3IAS 1;  3LK2 A;  3POX A;  4GCP A;  2R89 A;  4C69 X;  4G76 A;  5B66 O;  4LSF A;  2POR A;  1H6S 1;  3LJ0 A;  1PRN A;  4AKR B;  4BUM X;  5DL6 A;  1ZHY A;  3AA6 B;  4FRX A;  4D64 A;  1OSM A;  2Y0L A;  2JBW A;  1P4T A;  2XG6 A;  3HOE A;  2Y0H A;  1IZN A;  3UAQ A;  4XNL A;  4K3B A;  1T16 A;  2R4P A;  2O4V A;  4YZ9 A;  4OAV B;  2JB1 A;  1HXU A;  4G75 A;  1Q9F A;  5G39 A;  5D5D A;  2ERV A;  2FGQ X;  5H2F O;  4NV2 A;  4RL9 A;  3I9V 1;  2QTK A;  3BRY A;  4FSO A;  2FEF A;  2N2M A;  2MHL A;  4LSE A;  5GTH O;  3L0I A;  3DO9 A;  2CAZ B;  3AA0 B;  3B55 A;  2KKM A;  2JB3 A;  3SY9 A;  3EMN X;  4AYI D;  3POR A;  4FZN A;  3PGU A;  2BL8 A;  2ZRR A;  1GFQ A;  3LJ1 A;  5DL5 A;  2XTQ A;  2RLD A;  2ZW3 A;  2K0L A;  2YFA A;  2XE5 A; 
#chains in the Genus database with same CATH homology
 5ADX L;  2FGR A;  3QRA A;  4Z7G A;  4FES A;  2F66 B;  3K19 A;  3SYB A;  3KVD D;  4GHB A;  3AAE B;  4KRA A;  4Q9V A;  2ZLD A;  2W80 C;  3POQ A;  3TZG A;  3PQS A;  4PL5 A;  1BXW A;  1QJ8 A;  5HGI A;  1MPF A;  3DA4 A;  3WI5 A;  1BH3 A;  5EE2 A;  4O3Z A;  2F1V A;  4AZL A;  1ZHW A;  3VZT X;  2MJF B;  4AS2 A;  4FRT A;  4LSH A;  2Y0K A;  3FYX A;  3DA3 A;  4PUX A;  4AKR A;  3JTY A;  3AA6 A;  2XE1 A;  2XMX A;  4OAU C;  3AA7 B;  2KC0 A;  4O4X A;  3FBV A;  4FUV A;  3AA1 B;  4HEA 1;  1G90 A;  3SZD A;  2OMF A;  2XE3 A;  1GFM A;  2P22 B;  1QJP A;  4GF4 A;  2XTR A;  3NSG A;  3RBH A;  1YO7 A;  4LSI A;  3HW9 A;  3SDJ A;  4RLB A;  2IP6 A;  4AFK A;  2KZ7 B;  3F4M A;  3AA0 A;  1ZHZ A;  2YPV A;  1PHO A;  2KXP B;  2Y7S A;  1GFO A;  4FMS A;  4Z3T A;  3UIT A;  2A2C A;  2PRN A;  1HXT A;  4E1S A;  3IAM 1;  5IYU A;  1ZHT A;  3VY9 X;  1Q9G A;  4FSP A;  5ADX K;  2V1C C;  3VZW X;  4AUI A;  4PL3 A;  4AYD C;  2YNK A;  1QJ9 A;  4AYN A;  2K19 A;  3O0E A;  2J1N A;  1BT9 A;  3C5O A;  3T0S A;  2W81 C;  3QRC A;  3LK3 B;  3AAE A;  4Z7H A;  4AS3 A;  1E54 A;  5AFU K;  4JCH A;  3AAA B;  5JDP A;  5AFU L;  5DL8 A;  1GFN A;  4AYE C;  4O3Y A;  2M06 A;  4D5U A;  3P23 A;  2XE2 A;  3VA9 A;  4U6R A;  2A2D A;  2RIO A;  4NV5 A;  4E1T A;  4D65 A;  3UU2 A;  1SJ8 A;  3V8U A;  4O1O A;  4XNK A;  1ORM A;  1YS5 A;  2MNH A;  3AA7 A;  3SY7 A;  4JFB A;  4RLC A;  3PQU A;  5DL7 A;  2F1T A;  3LK2 B;  2J4U P;  4JCV E;  2KDY A;  1W3S A;  3AA1 A;  1GFP A;  3VZU X;  4HFV A;  3G7G A;  4YZD A;  3POU A;  5GV0 A;  7PRN A;  2Y2X A;  2JAE A;  4O3W A;  2KZ7 A;  4N59 A;  1IZN B;  5PRN A;  4QQ1 A;  2KXP A;  1HXX A;  4RJW A;  1ZHX A;  4AKM A;  3VE1 A;  5LNK 1;  3T20 A;  2ODJ A;  3UPG A;  3WI4 A;  3HOL A;  3SZV A;  4O3X B;  3A2S X;  2F6M B;  2X27 X;  4N58 A;  4U9C A;  3KP9 A;  3JSB A;  4GXT A;  3Q8D A;  4GCS A;  2JB2 A;  4I1T A;  4O4U A;  4FOZ A;  2LHF A;  2N2L A;  2E8G A;  5FVN A;  4KR8 A;  2XE5 A;  2L1L B;  4FZM A;  4DWL A;  2JMM A;  4FT6 A;  5T5F A;  2K4T A;  3LK3 A;  1MM5 A;  4O49 A;  4B61 A;  4FZL A;  3LJ2 A;  3AAA A;  3GP6 A;  4O1P A;  3VY8 X;  2ZFG A;  4GCQ A;  2YFB A;  2V6E A;  3VE2 A;  8PRN A;  1OPF A;  3LK4 2;  4RJX A;  3HWB A;  3LK4 1;  2GE4 A;  4PL4 A;  4YZC A;  3SYS A;  1THQ A;  6PRN A;  4KR4 A;  4F4B A;  2LFU A;  3PRN A;  4AYM C;  2FUG 1;  1U5K A;  3T24 A;  1MM4 A;  3AJF A;  2M07 A;  3IAS 1;  3LK2 A;  3POX A;  4GCP A;  4C69 X;  4G76 A;  4LSF A;  2POR A;  1H6S 1;  3LJ0 A;  1PRN A;  4AKR B;  4BUM X;  5DL6 A;  1ZHY A;  3AA6 B;  4FRX A;  4D64 A;  1OSM A;  2Y0L A;  1P4T A;  2XG6 A;  3HOE A;  2Y0H A;  1IZN A;  3UAQ A;  4XNL A;  2O4V A;  4YZ9 A;  4OAV B;  2JB1 A;  1HXU A;  4G75 A;  1Q9F A;  5D5D A;  2ERV A;  2FGQ X;  4NV2 A;  4RL9 A;  3I9V 1;  2QTK A;  4FSO A;  4LSE A;  2N2M A;  2MHL A;  3L0I A;  3DO9 A;  2CAZ B;  3AA0 B;  2KKM A;  2JB3 A;  3SY9 A;  3EMN X;  4AYI D;  3POR A;  4FZN A;  2ZRR A;  1GFQ A;  3LJ1 A;  5DL5 A;  2XTQ A;  2K0L A;  2YFA A;  5G26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...