4G76A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
291
structure length
291
Chain Sequence
b'MDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphodiesterase
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 81
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g76A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g76A02
3DA4A 2XTQA 3DA3A 4FZMA 4G76A 4FZLA 4FZNA 2XTRA 2XMXA 4N59A 4N58A 4G75A
chains in the Genus database with same CATH superfamily
3P23A 3IAS1 2MNHA 4AKMA 3LK42 4GCQA 3Q8DA 1ZHZA 4O3XB 3LK3A 4I1TA 3FBVA 2XE1A 5AFUK 4XNKA 2BL8A 2KC0A 2XE3A 3SYSA 4Z7HA 3LK2B 3UITA 3PGUA 1PHOA 3AA7A 1HXTA 2JB1A 4UB6O 5FVNA 1MPFA 4YZCA 2YNKA 3IAM1 1YS5A 3SZVA 4AUIA 5LNK1 3UU2A 1ZHTA 3AAAB 3DZMA 5HGIA 1GFNA 2Y2XA 2IWWA 3VE1A 3VY9X 5G39A 2Y0KA 1ZHYA 1T1LA 2ZFGA 4O4UA 3AA1B 4AYEC 5D5DA 3FNBA 2R88A 2LHFA 5G38A 2F1CX 5B66O 3BS0A 3LK41 4AFKA 2Y7SA 1GFPA 3JTYA 4FRTA 2QSBA 4PL4A 4JCVE 3NSGA 3WI4A 4G76A 4FESA 4D64A 3F4MA 2IWVA 3PORA 2JBWA 1QJPA 4AZLA 3AAAA 4RLCA 5JDPA 2BL7A 3EMNX 4U6RA 3VY8X 3AAEB 4C4VB 2V6EA 3UPGA 4D5UA 2K0LA 1QJ8A 4AYID 3DWOX 2FEFA 4QQ1A 2YFBA 4FZMA 3T20A 3POQA 2O4VA 4PL5A 4FSPA 2XMXA 3DWNA 1GFOA 2FGRA 5GTIO 5IYUA 3BRYA 2WJQA 3HWBA 2R4PA 4AS2A 4FOZA 2WVPA 4K3CA 5DL7A 2QGMA 3C5OA 2MHLA 2X9KA 2QZGA 3A0BO 3AA7B 4E1TA 4PUXA 2J1NA 2RADA 4FRXA 3QRCA 4N59A 2X27X 4O4XA 2E8GA 2JB2A 1ZHXA 1ORMA 4G75A 1JQOA 1MM5A 4KR8A 3POXA 3VA9A 5AFUL 4O49A 3VZUX 1IZNA 2XTQA 6PRNA 4AS3A 4FZLA 3V8UA 2R89A 3SYBA 2P22B 1Q9GA 3VE2A 4LSEA 4Z7GA 4KR4A 3KP9A 2J4UP 3A2SX 4K3BA 3UAQA 1GFQA 3AA6B 4D65A 2JAEA 5KAIO 4DWLA 2R4NA 4PL3A 4KRAA 2ZLDA 4FT6A 2A2CA 2QTKA 4JFBA 4UB8O 5GTHO 4RJWA 4Q9VA 2JMMA 3K19A 5GV0A 2AXTO 2R8AA 4HEA1 4IL6O 3DA3A 4NV5A 3AJFA 4O1OA 1W3SA 3PGRA 5ADXK 3HOLA 2MJFB 5ADXL 3AA6A 5G3AA 3WI5A 3VZTX 2FUG1 2F1VA 2R4LA 4RL9A 1THQA 1E54A 4RJXA 1PRNA 4Z3TA 3T0SA 1G90A 3SDJA 4FUVA 4LSFA 1BT9A 3A0HO 2KZ7B 5E79O 2XE5A 2W80C 4U9CA 1ZHWA 4FSOA 4BUMX 2LFUA 4N74A 2KKMA 2YFAA 2XG6A 2N2LA 1IZNB 3O0EA 4C00A 3L0IA 3B55A 1QJ9A 2WJRA 2K19A 2V1CC 4FMSA 2A2DA 1HXXA 2XE2A 2R4OA 3TZGA 4O1PA 4GHBA 2ERVA 3JCUO 2Y0LA 2M07A 3FYXA 3PRNA 4GCSA 2KZ7A 2CAZB 4AYMC 2PRNA 3PQSA 2RLDA 1YO7A 7PRNA 4B61A 5TISO 5B5EO 3AA0A 3PGSA 2XTRA 3GP6A 1T16A 4O3ZA 2F1TA 4O3YA 4HFVA 4OAUC 4O3WA 2GE4A 4LSIA 5EE2A 4YZ9A 4FQEA 1P4TA 1BXWA 1GFMA 2OMFA 2GSCA 2ZW3A 5DL8A 4JCHA 3SY9A 4C69X 3HOEA 3LJ0A 4AKRB 2JQYA 3NJTA 4AYDC 4XNLA 4GF4A 3LJ1A 4GXTA 2N2MA 4PR7A 1Q9FA 5DL6A 3LJ2A 3HW9A 4F4BA 1SJ8A 2JB3A 4E1SA 4NV2A 2PORA 2YPVA 4N58A 2Y0HA 2IP6A 5KAFO 3VZWX 4GCPA 5G26A 2W81C 1MM4A 3LK2A 3KZIO 2HGKA 4AKRA 2F66B 4OAVB 2KXPB 2ODJA 1BH3A 1S5LO 2F6MB 1OSMA 2L1LB 5H2FO 3KVDD 4N75A 3DO9A 2FGQX 1TDPA 3PF1A 5DL5A 4PJ0O 3AA1A 3SZDA 3QRAA 1OPFA 3G7GA 3AA0B 3POUA 1HXUA 3DA4A 2KXPA 2ZRRA 4YZDA 3RBHA 4FZNA 3LK3B 4AYNA 3SY7A 3BRZA 2ETDA 3FVVA 1H6S1 1U5KA 4CTDA 3WU2O 2M06A 3JSBA 8PRNA 4LSHA 2K4TA 5PRNA 3I9V1 4RLBA 5T5FA 2KDYA 2FU2A 3AAEA 3PQUA 3T24A 4C4VA 2RIOA
chains in the Genus database with same CATH topology
3P23A 3IAS1 2MNHA 4AKMA 3LK42 4GCQA 3Q8DA 1ZHZA 4O3XB 3LK3A 4I1TA 3FBVA 2XE1A 5AFUK 4XNKA 2KC0A 2XE3A 3SYSA 4Z7HA 3LK2B 3UITA 1PHOA 3AA7A 1HXTA 2JB1A 5FVNA 1MPFA 4YZCA 2YNKA 3IAM1 1YS5A 3SZVA 4AUIA 5LNK1 3UU2A 1ZHTA 3AAAB 5HGIA 1GFNA 2Y2XA 3VE1A 3VY9X 2Y0KA 1ZHYA 2ZFGA 4O4UA 3AA1B 4AYEC 5D5DA 2LHFA 3LK41 4AFKA 2Y7SA 1GFPA 3JTYA 4FRTA 4PL4A 4JCVE 3NSGA 3WI4A 4G76A 4FESA 4D64A 3F4MA 3PORA 1QJPA 4AZLA 3AAAA 4RLCA 5JDPA 3EMNX 4U6RA 3VY8X 3AAEB 2V6EA 3UPGA 4D5UA 2K0LA 1QJ8A 4AYID 4QQ1A 2YFBA 4FZMA 3T20A 3POQA 2O4VA 4PL5A 4FSPA 2XMXA 1GFOA 2FGRA 5IYUA 3HWBA 4AS2A 4FOZA 5DL7A 3C5OA 2MHLA 3AA7B 4E1TA 4PUXA 2J1NA 4FRXA 3QRCA 4N59A 2X27X 4O4XA 2E8GA 2JB2A 1ZHXA 1ORMA 4G75A 1MM5A 4KR8A 3POXA 3VA9A 5AFUL 4O49A 3VZUX 1IZNA 2XTQA 6PRNA 4AS3A 4FZLA 3V8UA 3SYBA 2P22B 1Q9GA 3VE2A 4LSEA 4Z7GA 4KR4A 3KP9A 2J4UP 3A2SX 3UAQA 1GFQA 3AA6B 4D65A 2JAEA 4DWLA 4KRAA 4PL3A 2ZLDA 4FT6A 2A2CA 2QTKA 4JFBA 4RJWA 4Q9VA 2JMMA 3K19A 5GV0A 4HEA1 3DA3A 4NV5A 3AJFA 4O1OA 1W3SA 5ADXK 3HOLA 2MJFB 5ADXL 3AA6A 3WI5A 3VZTX 2FUG1 2F1VA 4RL9A 1THQA 1E54A 4RJXA 1PRNA 4Z3TA 3T0SA 1G90A 3SDJA 4FUVA 4LSFA 1BT9A 2KZ7B 2XE5A 2W80C 4U9CA 1ZHWA 4FSOA 4BUMX 2LFUA 2KKMA 2YFAA 2XG6A 2N2LA 1IZNB 3O0EA 3L0IA 1QJ9A 2K19A 2V1CC 4FMSA 2A2DA 1HXXA 2XE2A 3TZGA 4O1PA 4GHBA 2ERVA 2Y0LA 2M07A 3FYXA 3PRNA 4GCSA 2KZ7A 2CAZB 4AYMC 2PRNA 3PQSA 7PRNA 1YO7A 4B61A 3AA0A 2XTRA 3GP6A 4O3ZA 2F1TA 4O3YA 4HFVA 4OAUC 4O3WA 2GE4A 4LSIA 5EE2A 4YZ9A 1P4TA 1BXWA 1GFMA 2OMFA 5DL8A 4JCHA 3SY9A 4C69X 3HOEA 3LJ0A 4AKRB 4AYDC 4XNLA 4GF4A 3LJ1A 4GXTA 2N2MA 1Q9FA 5DL6A 3LJ2A 3HW9A 4F4BA 1SJ8A 2JB3A 4E1SA 4NV2A 2PORA 2YPVA 4N58A 2Y0HA 2IP6A 3VZWX 4GCPA 5G26A 2W81C 1MM4A 3LK2A 4AKRA 2F66B 4OAVB 2KXPB 2ODJA 1BH3A 2F6MB 1OSMA 2L1LB 3KVDD 3DO9A 2FGQX 5DL5A 3AA1A 3SZDA 3QRAA 1OPFA 3G7GA 3AA0B 3POUA 1HXUA 3DA4A 2KXPA 2ZRRA 4YZDA 3RBHA 4FZNA 3LK3B 4AYNA 3SY7A 1H6S1 1U5KA 2M06A 3JSBA 8PRNA 4LSHA 2K4TA 5PRNA 3I9V1 4RLBA 5T5FA 2KDYA 3AAEA 3PQUA 3T24A 2RIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DA4 A;  2XTQ A;  3DA3 A;  4FZM A;  4G76 A;  4FZL A;  4FZN A;  2XTR A;  2XMX A;  4N59 A;  4N58 A;  4G75 A; 
#chains in the Genus database with same CATH topology
 3P23 A;  3IAS 1;  2MNH A;  4AKM A;  3LK4 2;  4GCQ A;  3Q8D A;  1ZHZ A;  4O3X B;  3LK3 A;  4I1T A;  3FBV A;  2XE1 A;  5AFU K;  4XNK A;  2BL8 A;  2KC0 A;  2XE3 A;  3SYS A;  4Z7H A;  3LK2 B;  3UIT A;  3PGU A;  1PHO A;  3AA7 A;  1HXT A;  2JB1 A;  4UB6 O;  5FVN A;  1MPF A;  4YZC A;  2YNK A;  3IAM 1;  1YS5 A;  3SZV A;  4AUI A;  5LNK 1;  3UU2 A;  1ZHT A;  3AAA B;  3DZM A;  5HGI A;  1GFN A;  2Y2X A;  2IWW A;  3VE1 A;  3VY9 X;  5G39 A;  2Y0K A;  1ZHY A;  1T1L A;  2ZFG A;  4O4U A;  3AA1 B;  4AYE C;  5D5D A;  3FNB A;  2R88 A;  2LHF A;  5G38 A;  2F1C X;  5B66 O;  3BS0 A;  3LK4 1;  4AFK A;  2Y7S A;  1GFP A;  3JTY A;  4FRT A;  2QSB A;  4PL4 A;  4JCV E;  3NSG A;  3WI4 A;  4G76 A;  4FES A;  4D64 A;  3F4M A;  2IWV A;  3POR A;  2JBW A;  1QJP A;  4AZL A;  3AAA A;  4RLC A;  5JDP A;  2BL7 A;  3EMN X;  4U6R A;  3VY8 X;  3AAE B;  4C4V B;  2V6E A;  3UPG A;  4D5U A;  2K0L A;  1QJ8 A;  4AYI D;  3DWO X;  2FEF A;  4QQ1 A;  2YFB A;  4FZM A;  3T20 A;  3POQ A;  2O4V A;  4PL5 A;  4FSP A;  2XMX A;  3DWN A;  1GFO A;  2FGR A;  5GTI O;  5IYU A;  3BRY A;  2WJQ A;  3HWB A;  2R4P A;  4AS2 A;  4FOZ A;  2WVP A;  4K3C A;  5DL7 A;  2QGM A;  3C5O A;  2MHL A;  2X9K A;  2QZG A;  3A0B O;  3AA7 B;  4E1T A;  4PUX A;  2J1N A;  2RAD A;  4FRX A;  3QRC A;  4N59 A;  2X27 X;  4O4X A;  2E8G A;  2JB2 A;  1ZHX A;  1ORM A;  4G75 A;  1JQO A;  1MM5 A;  4KR8 A;  3POX A;  3VA9 A;  5AFU L;  4O49 A;  3VZU X;  1IZN A;  2XTQ A;  6PRN A;  4AS3 A;  4FZL A;  3V8U A;  2R89 A;  3SYB A;  2P22 B;  1Q9G A;  3VE2 A;  4LSE A;  4Z7G A;  4KR4 A;  3KP9 A;  2J4U P;  3A2S X;  4K3B A;  3UAQ A;  1GFQ A;  3AA6 B;  4D65 A;  2JAE A;  5KAI O;  4DWL A;  2R4N A;  4PL3 A;  4KRA A;  2ZLD A;  4FT6 A;  2A2C A;  2QTK A;  4JFB A;  4UB8 O;  5GTH O;  4RJW A;  4Q9V A;  2JMM A;  3K19 A;  5GV0 A;  2AXT O;  2R8A A;  4HEA 1;  4IL6 O;  3DA3 A;  4NV5 A;  3AJF A;  4O1O A;  1W3S A;  3PGR A;  5ADX K;  3HOL A;  2MJF B;  5ADX L;  3AA6 A;  5G3A A;  3WI5 A;  3VZT X;  2FUG 1;  2F1V A;  2R4L A;  4RL9 A;  1THQ A;  1E54 A;  4RJX A;  1PRN A;  4Z3T A;  3T0S A;  1G90 A;  3SDJ A;  4FUV A;  4LSF A;  1BT9 A;  3A0H O;  2KZ7 B;  5E79 O;  2XE5 A;  2W80 C;  4U9C A;  1ZHW A;  4FSO A;  4BUM X;  2LFU A;  4N74 A;  2KKM A;  2YFA A;  2XG6 A;  2N2L A;  1IZN B;  3O0E A;  4C00 A;  3L0I A;  3B55 A;  1QJ9 A;  2WJR A;  2K19 A;  2V1C C;  4FMS A;  2A2D A;  1HXX A;  2XE2 A;  2R4O A;  3TZG A;  4O1P A;  4GHB A;  2ERV A;  3JCU O;  2Y0L A;  2M07 A;  3FYX A;  3PRN A;  4GCS A;  2KZ7 A;  2CAZ B;  4AYM C;  2PRN A;  3PQS A;  2RLD A;  1YO7 A;  7PRN A;  4B61 A;  5TIS O;  5B5E O;  3AA0 A;  3PGS A;  2XTR A;  3GP6 A;  1T16 A;  4O3Z A;  2F1T A;  4O3Y A;  4HFV A;  4OAU C;  4O3W A;  2GE4 A;  4LSI A;  5EE2 A;  4YZ9 A;  4FQE A;  1P4T A;  1BXW A;  1GFM A;  2OMF A;  2GSC A;  2ZW3 A;  5DL8 A;  4JCH A;  3SY9 A;  4C69 X;  3HOE A;  3LJ0 A;  4AKR B;  2JQY A;  3NJT A;  4AYD C;  4XNL A;  4GF4 A;  3LJ1 A;  4GXT A;  2N2M A;  4PR7 A;  1Q9F A;  5DL6 A;  3LJ2 A;  3HW9 A;  4F4B A;  1SJ8 A;  2JB3 A;  4E1S A;  4NV2 A;  2POR A;  2YPV A;  4N58 A;  2Y0H A;  2IP6 A;  5KAF O;  3VZW X;  4GCP A;  5G26 A;  2W81 C;  1MM4 A;  3LK2 A;  3KZI O;  2HGK A;  4AKR A;  2F66 B;  4OAV B;  2KXP B;  2ODJ A;  1BH3 A;  1S5L O;  2F6M B;  1OSM A;  2L1L B;  5H2F O;  3KVD D;  4N75 A;  3DO9 A;  2FGQ X;  1TDP A;  3PF1 A;  5DL5 A;  4PJ0 O;  3AA1 A;  3SZD A;  3QRA A;  1OPF A;  3G7G A;  3AA0 B;  3POU A;  1HXU A;  3DA4 A;  2KXP A;  2ZRR A;  4YZD A;  3RBH A;  4FZN A;  3LK3 B;  4AYN A;  3SY7 A;  3BRZ A;  2ETD A;  3FVV A;  1H6S 1;  1U5K A;  4CTD A;  3WU2 O;  2M06 A;  3JSB A;  8PRN A;  4LSH A;  2K4T A;  5PRN A;  3I9V 1;  4RLB A;  5T5F A;  2KDY A;  2FU2 A;  3AAE A;  3PQU A;  3T24 A;  4C4V A;  2RIO A; 
#chains in the Genus database with same CATH homology
 3P23 A;  3IAS 1;  2MNH A;  4AKM A;  3LK4 2;  4GCQ A;  3Q8D A;  1ZHZ A;  4O3X B;  3LK3 A;  4I1T A;  3FBV A;  2XE1 A;  5AFU K;  4XNK A;  2KC0 A;  2XE3 A;  3SYS A;  4Z7H A;  3LK2 B;  3UIT A;  1PHO A;  3AA7 A;  1HXT A;  2JB1 A;  5FVN A;  1MPF A;  4YZC A;  2YNK A;  3IAM 1;  1YS5 A;  3SZV A;  4AUI A;  5LNK 1;  3UU2 A;  1ZHT A;  3AAA B;  5HGI A;  1GFN A;  2Y2X A;  3VE1 A;  3VY9 X;  2Y0K A;  1ZHY A;  2ZFG A;  4O4U A;  3AA1 B;  4AYE C;  5D5D A;  2LHF A;  3LK4 1;  4AFK A;  2Y7S A;  1GFP A;  3JTY A;  4FRT A;  4PL4 A;  4JCV E;  3NSG A;  3WI4 A;  4G76 A;  4FES A;  4D64 A;  3F4M A;  3POR A;  1QJP A;  4AZL A;  3AAA A;  4RLC A;  5JDP A;  3EMN X;  4U6R A;  3VY8 X;  3AAE B;  2V6E A;  3UPG A;  4D5U A;  2K0L A;  1QJ8 A;  4AYI D;  4QQ1 A;  2YFB A;  4FZM A;  3T20 A;  3POQ A;  2O4V A;  4PL5 A;  4FSP A;  2XMX A;  1GFO A;  2FGR A;  5IYU A;  3HWB A;  4AS2 A;  4FOZ A;  5DL7 A;  3C5O A;  2MHL A;  3AA7 B;  4E1T A;  4PUX A;  2J1N A;  4FRX A;  3QRC A;  4N59 A;  2X27 X;  4O4X A;  2E8G A;  2JB2 A;  1ZHX A;  1ORM A;  4G75 A;  1MM5 A;  4KR8 A;  3POX A;  3VA9 A;  5AFU L;  4O49 A;  3VZU X;  1IZN A;  2XTQ A;  6PRN A;  4AS3 A;  4FZL A;  3V8U A;  3SYB A;  2P22 B;  1Q9G A;  3VE2 A;  4LSE A;  4Z7G A;  4KR4 A;  3KP9 A;  2J4U P;  3A2S X;  3UAQ A;  1GFQ A;  3AA6 B;  4D65 A;  2JAE A;  4DWL A;  4KRA A;  4PL3 A;  2ZLD A;  4FT6 A;  2A2C A;  2QTK A;  4JFB A;  4RJW A;  4Q9V A;  2JMM A;  3K19 A;  5GV0 A;  4HEA 1;  3DA3 A;  4NV5 A;  3AJF A;  4O1O A;  1W3S A;  5ADX K;  3HOL A;  2MJF B;  5ADX L;  3AA6 A;  3WI5 A;  3VZT X;  2FUG 1;  2F1V A;  4RL9 A;  1THQ A;  1E54 A;  4RJX A;  1PRN A;  4Z3T A;  3T0S A;  1G90 A;  3SDJ A;  4FUV A;  4LSF A;  1BT9 A;  2KZ7 B;  2XE5 A;  2W80 C;  4U9C A;  1ZHW A;  4FSO A;  4BUM X;  2LFU A;  2KKM A;  2YFA A;  2XG6 A;  2N2L A;  1IZN B;  3O0E A;  3L0I A;  1QJ9 A;  2K19 A;  2V1C C;  4FMS A;  2A2D A;  1HXX A;  2XE2 A;  3TZG A;  4O1P A;  4GHB A;  2ERV A;  2Y0L A;  2M07 A;  3FYX A;  3PRN A;  4GCS A;  2KZ7 A;  2CAZ B;  4AYM C;  2PRN A;  3PQS A;  7PRN A;  1YO7 A;  4B61 A;  3AA0 A;  2XTR A;  3GP6 A;  4O3Z A;  2F1T A;  4O3Y A;  4HFV A;  4OAU C;  4O3W A;  2GE4 A;  4LSI A;  5EE2 A;  4YZ9 A;  1P4T A;  1BXW A;  1GFM A;  2OMF A;  5DL8 A;  4JCH A;  3SY9 A;  4C69 X;  3HOE A;  3LJ0 A;  4AKR B;  4AYD C;  4XNL A;  4GF4 A;  3LJ1 A;  4GXT A;  2N2M A;  1Q9F A;  5DL6 A;  3LJ2 A;  3HW9 A;  4F4B A;  1SJ8 A;  2JB3 A;  4E1S A;  4NV2 A;  2POR A;  2YPV A;  4N58 A;  2Y0H A;  2IP6 A;  3VZW X;  4GCP A;  5G26 A;  2W81 C;  1MM4 A;  3LK2 A;  4AKR A;  2F66 B;  4OAV B;  2KXP B;  2ODJ A;  1BH3 A;  2F6M B;  1OSM A;  2L1L B;  3KVD D;  3DO9 A;  2FGQ X;  5DL5 A;  3AA1 A;  3SZD A;  3QRA A;  1OPF A;  3G7G A;  3AA0 B;  3POU A;  1HXU A;  3DA4 A;  2KXP A;  2ZRR A;  4YZD A;  3RBH A;  4FZN A;  3LK3 B;  4AYN A;  3SY7 A;  1H6S 1;  1U5K A;  2M06 A;  3JSB A;  8PRN A;  4LSH A;  2K4T A;  5PRN A;  3I9V 1;  4RLB A;  5T5F A;  2KDY A;  3AAE A;  3PQU A;  3T24 A;  2RIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...