4G76A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
291
structure length
291
Chain Sequence
MDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphodiesterase
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 81
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g76A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g76A02
4G75A 4G76A 4FZMA 2XMXA 3DA3A 4FZLA 4N59A 4FZNA 2XTRA 2XTQA 3DA4A 4N58A
chains in the Genus database with same CATH superfamily
1BT9A 3PGRA 1ZHWA 4K3BA 2Y2XA 5AFUK 3VZWX 5JDPA 2KDYA 5D5DA 1YO7A 3PRNA 4AS2A 1IZNA 2YNKA 2XE3A 4G76A 1QJ8A 5KAIO 2IWVA 2XE5A 4KR8A 1Q9GA 2Y7SA 2W80C 4RL9A 2F6MB 3WI4A 3A2SX 3UITA 1IZNB 2KKMA 2X9KA 2F66B 8PRNA 4O3XB 4XNLA 3T0SA 2JB1A 5TISO 3AAEB 3C5OA 2GE4A 1BH3A 3O0EA 3TZGA 2ETDA 4U9CA 4O3WA 5PRNA 3FBVA 4HFVA 4FOZA 2V1CC 2Y0HA 2A2CA 4F4BA 1T1LA 5IYUA 1H6S1 3KZIO 2R89A 2L1LB 3FNBA 3VY8X 1GFQA 2ERVA 3RBHA 4Z3TA 4G75A 3UAQA 4XNKA 4GF4A 3DA3A 3AA1B 2F1CX 3WU2O 2OMFA 4OAVB 2RLDA 1ZHXA 1U5KA 3DWNA 4LSHA 4B61A 5KAFO 5FVNA 4K3CA 3AAAA 2R4OA 3PGSA 4GCQA 2WJQA 3SZDA 5AFUL 1QJPA 4RJXA 4GHBA 2XE2A 5E79O 3AAAB 1GFOA 5G26A 7PRNA 3PQUA 4RJWA 2CAZB 4PL5A 2YFAA 4RLBA 3LK2A 4YZ9A 2K0LA 3SY9A 1Q9FA 1S5LO 3QRCA 4AKRB 2Y0LA 4E1SA 2YPVA 4O3YA 4JCVE 3KVDD 4IL6O 2M06A 2M07A 1OSMA 1JQOA 1ZHYA 2R8AA 1P4TA 3VY9X 4N74A 4OAUC 3JSBA 3VA9A 2R4LA 5G3AA 4FZMA 4FSOA 3L0IA 2ZLDA 4PL4A 1E54A 4D5UA 2WJRA 3AAEA 2HGKA 3AA7B 5HGIA 2ZW3A 2MNHA 4FESA 5B5EO 1HXXA 2PORA 4D65A 3IAM1 3FYXA 3HW9A 2XTQA 4O1PA 1MPFA 5G38A 4N59A 3K19A 3Q8DA 2IWWA 2P22B 1MM5A 1HXTA 3POQA 2PRNA 3I9V1 2W81C 2XG6A 3P23A 3PORA 1MM4A 3AA1A 4D64A 2O4VA 3AA6B 2N2LA 4O3ZA 2KXPA 3DWOX 2ODJA 5EE2A 3UPGA 2N2MA 3T24A 3FVVA 4FZNA 1G90A 3A0HO 5ADXK 3HOEA 2KXPB 4NV2A 5B66O 4GCPA 4YZCA 4FT6A 2MHLA 4AYDC 5DL5A 4AS3A 4FRTA 4C4VA 3F4MA 2JB2A 3DO9A 3POUA 4C00A 4UB8O 4C4VB 5DL6A 2QZGA 4KRAA 5GV0A 1ZHZA 3PF1A 2KC0A 4AKRA 3SY7A 2E8GA 4FZLA 5DL8A 1ORMA 3T20A 3B55A 3LK3B 4FSPA 2K4TA 2LHFA 3SZVA 1PHOA 3BS0A 1T16A 2RIOA 5GTHO 4UB6O 4LSFA 3EMNX 3SYSA 2XMXA 2FGRA 2QSBA 4Q9VA 4FQEA 4GCSA 2BL7A 3POXA 4Z7GA 4N75A 3KP9A 2FGQX 3AA7A 4Z7HA 3AA0B 2R4NA 3DA4A 2JAEA 2X27X 2KZ7A 2XE1A 1PRNA 3WI5A 2YFBA 4FMSA 4FUVA 1GFPA 5GTIO 3V8UA 4AYID 4N58A 4AYNA 1SJ8A 2KZ7B 4PUXA 5ADXL 2RADA 2QGMA 2JQYA 4LSEA 4FRXA 2FEFA 2JBWA 4O4UA 4GXTA 4BUMX 5H2FO 2FUG1 2GSCA 2R4PA 1YS5A 1BXWA 2K19A 2F1TA 1OPFA 4U6RA 2BL8A 3AA6A 3VZTX 2MJFB 4O49A 3VZUX 2JB3A 5T5FA 4O4XA 1W3SA 3NSGA 3BRYA 4JFBA 4O1OA 3LJ0A 2F1VA 4KR4A 4AYMC 4AUIA 4PR7A 2V6EA 1QJ9A 2QTKA 2ZRRA 3DZMA 3PGUA 2IP6A 3HOLA 1GFNA 2Y0KA 4RLCA 3VE1A 4CTDA 2JMMA 4AYEC 3SYBA 1TDPA 3SDJA 4I1TA 2LFUA 2A2DA 2J1NA 4LSIA 4PL3A 4NV5A 3LJ2A 1HXUA 6PRNA 4JCHA 3GP6A 4AKMA 2WVPA 3NJTA 2ZFGA 3JTYA 3LK3A 3LK42 5G39A 3A0BO 3LK41 4AFKA 4C69X 3QRAA 3IAS1 3BRZA 3JCUO 2R88A 4AZLA 3PQSA 3HWBA 3G7GA 4PJ0O 2J4UP 3LJ1A 4YZDA 4E1TA 3UU2A 1THQA 1ZHTA 3AJFA 3AA0A 5LNK1 5DL7A 1GFMA 2AXTO 2FU2A 3VE2A 3LK2B 2XTRA 4DWLA 4QQ1A 4HEA1
chains in the Genus database with same CATH topology
1BT9A 1ZHWA 2Y2XA 5AFUK 3VZWX 5JDPA 2KDYA 5D5DA 1YO7A 3PRNA 4AS2A 1IZNA 2YNKA 2XE3A 4G76A 1QJ8A 2XE5A 4KR8A 1Q9GA 2Y7SA 2W80C 4RL9A 2F6MB 3WI4A 3A2SX 3UITA 1IZNB 2KKMA 2F66B 8PRNA 4O3XB 4XNLA 3T0SA 2JB1A 3AAEB 3C5OA 2GE4A 1BH3A 3O0EA 3TZGA 4U9CA 4O3WA 5PRNA 3FBVA 4HFVA 4FOZA 2V1CC 2Y0HA 2A2CA 4F4BA 5IYUA 1H6S1 2L1LB 3VY8X 1GFQA 2ERVA 3RBHA 4Z3TA 4G75A 3UAQA 4XNKA 4GF4A 3DA3A 3AA1B 2OMFA 4OAVB 1ZHXA 1U5KA 4LSHA 4B61A 5FVNA 3AAAA 4GCQA 3SZDA 5AFUL 1QJPA 4RJXA 4GHBA 2XE2A 3AAAB 1GFOA 5G26A 7PRNA 3PQUA 4RJWA 2CAZB 4PL5A 2YFAA 4RLBA 3LK2A 4YZ9A 2K0LA 3SY9A 1Q9FA 3QRCA 4AKRB 2Y0LA 4E1SA 2YPVA 4O3YA 4JCVE 3KVDD 2M06A 2M07A 1OSMA 1ZHYA 1P4TA 3VY9X 4OAUC 3JSBA 3VA9A 4FZMA 4FSOA 3L0IA 2ZLDA 4PL4A 1E54A 4D5UA 3AAEA 3AA7B 5HGIA 2MNHA 4FESA 1HXXA 2PORA 4D65A 3IAM1 3FYXA 3HW9A 2XTQA 4O1PA 1MPFA 4N59A 3K19A 3Q8DA 2P22B 1MM5A 1HXTA 3POQA 2PRNA 3I9V1 2W81C 2XG6A 3P23A 3PORA 1MM4A 3AA1A 4D64A 2O4VA 3AA6B 2N2LA 4O3ZA 2KXPA 2ODJA 5EE2A 3UPGA 2N2MA 3T24A 4FZNA 1G90A 5ADXK 3HOEA 2KXPB 4NV2A 4GCPA 4YZCA 4FT6A 2MHLA 4AYDC 5DL5A 4AS3A 4FRTA 3F4MA 2JB2A 3DO9A 3POUA 5DL6A 4KRAA 5GV0A 1ZHZA 2KC0A 4AKRA 3SY7A 2E8GA 4FZLA 5DL8A 1ORMA 3T20A 3LK3B 4FSPA 2K4TA 2LHFA 3SZVA 1PHOA 2RIOA 4LSFA 3EMNX 3SYSA 2XMXA 2FGRA 4Q9VA 4GCSA 3POXA 4Z7GA 3KP9A 2FGQX 3AA7A 4Z7HA 3AA0B 3DA4A 2JAEA 2X27X 2KZ7A 2XE1A 1PRNA 3WI5A 2YFBA 4FMSA 4FUVA 1GFPA 3V8UA 4AYID 4N58A 4AYNA 1SJ8A 2KZ7B 4PUXA 5ADXL 4LSEA 4FRXA 4O4UA 4GXTA 4BUMX 2FUG1 1YS5A 1BXWA 2K19A 2F1TA 1OPFA 4U6RA 3AA6A 3VZTX 2MJFB 4O49A 3VZUX 2JB3A 5T5FA 4O4XA 1W3SA 3NSGA 4JFBA 4O1OA 3LJ0A 2F1VA 4KR4A 4AYMC 4AUIA 2V6EA 1QJ9A 2QTKA 2ZRRA 2IP6A 3HOLA 1GFNA 2Y0KA 4RLCA 3VE1A 2JMMA 4AYEC 3SYBA 3SDJA 4I1TA 2LFUA 2A2DA 2J1NA 4LSIA 4PL3A 4NV5A 3LJ2A 1HXUA 6PRNA 4JCHA 3GP6A 4AKMA 2ZFGA 3JTYA 3LK3A 3LK42 3LK41 4AFKA 4C69X 3QRAA 3IAS1 4AZLA 3PQSA 3HWBA 3G7GA 2J4UP 3LJ1A 4YZDA 4E1TA 3UU2A 1THQA 1ZHTA 3AJFA 3AA0A 5LNK1 5DL7A 1GFMA 3VE2A 3LK2B 2XTRA 4DWLA 4QQ1A 4HEA1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G75 A;  4G76 A;  4FZM A;  2XMX A;  3DA3 A;  4FZL A;  4N59 A;  4FZN A;  2XTR A;  2XTQ A;  3DA4 A;  4N58 A; 
#chains in the Genus database with same CATH topology
 1BT9 A;  3PGR A;  1ZHW A;  4K3B A;  2Y2X A;  5AFU K;  3VZW X;  5JDP A;  2KDY A;  5D5D A;  1YO7 A;  3PRN A;  4AS2 A;  1IZN A;  2YNK A;  2XE3 A;  4G76 A;  1QJ8 A;  5KAI O;  2IWV A;  2XE5 A;  4KR8 A;  1Q9G A;  2Y7S A;  2W80 C;  4RL9 A;  2F6M B;  3WI4 A;  3A2S X;  3UIT A;  1IZN B;  2KKM A;  2X9K A;  2F66 B;  8PRN A;  4O3X B;  4XNL A;  3T0S A;  2JB1 A;  5TIS O;  3AAE B;  3C5O A;  2GE4 A;  1BH3 A;  3O0E A;  3TZG A;  2ETD A;  4U9C A;  4O3W A;  5PRN A;  3FBV A;  4HFV A;  4FOZ A;  2V1C C;  2Y0H A;  2A2C A;  4F4B A;  1T1L A;  5IYU A;  1H6S 1;  3KZI O;  2R89 A;  2L1L B;  3FNB A;  3VY8 X;  1GFQ A;  2ERV A;  3RBH A;  4Z3T A;  4G75 A;  3UAQ A;  4XNK A;  4GF4 A;  3DA3 A;  3AA1 B;  2F1C X;  3WU2 O;  2OMF A;  4OAV B;  2RLD A;  1ZHX A;  1U5K A;  3DWN A;  4LSH A;  4B61 A;  5KAF O;  5FVN A;  4K3C A;  3AAA A;  2R4O A;  3PGS A;  4GCQ A;  2WJQ A;  3SZD A;  5AFU L;  1QJP A;  4RJX A;  4GHB A;  2XE2 A;  5E79 O;  3AAA B;  1GFO A;  5G26 A;  7PRN A;  3PQU A;  4RJW A;  2CAZ B;  4PL5 A;  2YFA A;  4RLB A;  3LK2 A;  4YZ9 A;  2K0L A;  3SY9 A;  1Q9F A;  1S5L O;  3QRC A;  4AKR B;  2Y0L A;  4E1S A;  2YPV A;  4O3Y A;  4JCV E;  3KVD D;  4IL6 O;  2M06 A;  2M07 A;  1OSM A;  1JQO A;  1ZHY A;  2R8A A;  1P4T A;  3VY9 X;  4N74 A;  4OAU C;  3JSB A;  3VA9 A;  2R4L A;  5G3A A;  4FZM A;  4FSO A;  3L0I A;  2ZLD A;  4PL4 A;  1E54 A;  4D5U A;  2WJR A;  3AAE A;  2HGK A;  3AA7 B;  5HGI A;  2ZW3 A;  2MNH A;  4FES A;  5B5E O;  1HXX A;  2POR A;  4D65 A;  3IAM 1;  3FYX A;  3HW9 A;  2XTQ A;  4O1P A;  1MPF A;  5G38 A;  4N59 A;  3K19 A;  3Q8D A;  2IWW A;  2P22 B;  1MM5 A;  1HXT A;  3POQ A;  2PRN A;  3I9V 1;  2W81 C;  2XG6 A;  3P23 A;  3POR A;  1MM4 A;  3AA1 A;  4D64 A;  2O4V A;  3AA6 B;  2N2L A;  4O3Z A;  2KXP A;  3DWO X;  2ODJ A;  5EE2 A;  3UPG A;  2N2M A;  3T24 A;  3FVV A;  4FZN A;  1G90 A;  3A0H O;  5ADX K;  3HOE A;  2KXP B;  4NV2 A;  5B66 O;  4GCP A;  4YZC A;  4FT6 A;  2MHL A;  4AYD C;  5DL5 A;  4AS3 A;  4FRT A;  4C4V A;  3F4M A;  2JB2 A;  3DO9 A;  3POU A;  4C00 A;  4UB8 O;  4C4V B;  5DL6 A;  2QZG A;  4KRA A;  5GV0 A;  1ZHZ A;  3PF1 A;  2KC0 A;  4AKR A;  3SY7 A;  2E8G A;  4FZL A;  5DL8 A;  1ORM A;  3T20 A;  3B55 A;  3LK3 B;  4FSP A;  2K4T A;  2LHF A;  3SZV A;  1PHO A;  3BS0 A;  1T16 A;  2RIO A;  5GTH O;  4UB6 O;  4LSF A;  3EMN X;  3SYS A;  2XMX A;  2FGR A;  2QSB A;  4Q9V A;  4FQE A;  4GCS A;  2BL7 A;  3POX A;  4Z7G A;  4N75 A;  3KP9 A;  2FGQ X;  3AA7 A;  4Z7H A;  3AA0 B;  2R4N A;  3DA4 A;  2JAE A;  2X27 X;  2KZ7 A;  2XE1 A;  1PRN A;  3WI5 A;  2YFB A;  4FMS A;  4FUV A;  1GFP A;  5GTI O;  3V8U A;  4AYI D;  4N58 A;  4AYN A;  1SJ8 A;  2KZ7 B;  4PUX A;  5ADX L;  2RAD A;  2QGM A;  2JQY A;  4LSE A;  4FRX A;  2FEF A;  2JBW A;  4O4U A;  4GXT A;  4BUM X;  5H2F O;  2FUG 1;  2GSC A;  2R4P A;  1YS5 A;  1BXW A;  2K19 A;  2F1T A;  1OPF A;  4U6R A;  2BL8 A;  3AA6 A;  3VZT X;  2MJF B;  4O49 A;  3VZU X;  2JB3 A;  5T5F A;  4O4X A;  1W3S A;  3NSG A;  3BRY A;  4JFB A;  4O1O A;  3LJ0 A;  2F1V A;  4KR4 A;  4AYM C;  4AUI A;  4PR7 A;  2V6E A;  1QJ9 A;  2QTK A;  2ZRR A;  3DZM A;  3PGU A;  2IP6 A;  3HOL A;  1GFN A;  2Y0K A;  4RLC A;  3VE1 A;  4CTD A;  2JMM A;  4AYE C;  3SYB A;  1TDP A;  3SDJ A;  4I1T A;  2LFU A;  2A2D A;  2J1N A;  4LSI A;  4PL3 A;  4NV5 A;  3LJ2 A;  1HXU A;  6PRN A;  4JCH A;  3GP6 A;  4AKM A;  2WVP A;  3NJT A;  2ZFG A;  3JTY A;  3LK3 A;  3LK4 2;  5G39 A;  3A0B O;  3LK4 1;  4AFK A;  4C69 X;  3QRA A;  3IAS 1;  3BRZ A;  3JCU O;  2R88 A;  4AZL A;  3PQS A;  3HWB A;  3G7G A;  4PJ0 O;  2J4U P;  3LJ1 A;  4YZD A;  4E1T A;  3UU2 A;  1THQ A;  1ZHT A;  3AJF A;  3AA0 A;  5LNK 1;  5DL7 A;  1GFM A;  2AXT O;  2FU2 A;  3VE2 A;  3LK2 B;  2XTR A;  4DWL A;  4QQ1 A;  4HEA 1; 
#chains in the Genus database with same CATH homology
 1BT9 A;  1ZHW A;  2Y2X A;  5AFU K;  3VZW X;  5JDP A;  2KDY A;  5D5D A;  1YO7 A;  3PRN A;  4AS2 A;  1IZN A;  2YNK A;  2XE3 A;  4G76 A;  1QJ8 A;  2XE5 A;  4KR8 A;  1Q9G A;  2Y7S A;  2W80 C;  4RL9 A;  2F6M B;  3WI4 A;  3A2S X;  3UIT A;  1IZN B;  2KKM A;  2F66 B;  8PRN A;  4O3X B;  4XNL A;  3T0S A;  2JB1 A;  3AAE B;  3C5O A;  2GE4 A;  1BH3 A;  3O0E A;  3TZG A;  4U9C A;  4O3W A;  5PRN A;  3FBV A;  4HFV A;  4FOZ A;  2V1C C;  2Y0H A;  2A2C A;  4F4B A;  5IYU A;  1H6S 1;  2L1L B;  3VY8 X;  1GFQ A;  2ERV A;  3RBH A;  4Z3T A;  4G75 A;  3UAQ A;  4XNK A;  4GF4 A;  3DA3 A;  3AA1 B;  2OMF A;  4OAV B;  1ZHX A;  1U5K A;  4LSH A;  4B61 A;  5FVN A;  3AAA A;  4GCQ A;  3SZD A;  5AFU L;  1QJP A;  4RJX A;  4GHB A;  2XE2 A;  3AAA B;  1GFO A;  5G26 A;  7PRN A;  3PQU A;  4RJW A;  2CAZ B;  4PL5 A;  2YFA A;  4RLB A;  3LK2 A;  4YZ9 A;  2K0L A;  3SY9 A;  1Q9F A;  3QRC A;  4AKR B;  2Y0L A;  4E1S A;  2YPV A;  4O3Y A;  4JCV E;  3KVD D;  2M06 A;  2M07 A;  1OSM A;  1ZHY A;  1P4T A;  3VY9 X;  4OAU C;  3JSB A;  3VA9 A;  4FZM A;  4FSO A;  3L0I A;  2ZLD A;  4PL4 A;  1E54 A;  4D5U A;  3AAE A;  3AA7 B;  5HGI A;  2MNH A;  4FES A;  1HXX A;  2POR A;  4D65 A;  3IAM 1;  3FYX A;  3HW9 A;  2XTQ A;  4O1P A;  1MPF A;  4N59 A;  3K19 A;  3Q8D A;  2P22 B;  1MM5 A;  1HXT A;  3POQ A;  2PRN A;  3I9V 1;  2W81 C;  2XG6 A;  3P23 A;  3POR A;  1MM4 A;  3AA1 A;  4D64 A;  2O4V A;  3AA6 B;  2N2L A;  4O3Z A;  2KXP A;  2ODJ A;  5EE2 A;  3UPG A;  2N2M A;  3T24 A;  4FZN A;  1G90 A;  5ADX K;  3HOE A;  2KXP B;  4NV2 A;  4GCP A;  4YZC A;  4FT6 A;  2MHL A;  4AYD C;  5DL5 A;  4AS3 A;  4FRT A;  3F4M A;  2JB2 A;  3DO9 A;  3POU A;  5DL6 A;  4KRA A;  5GV0 A;  1ZHZ A;  2KC0 A;  4AKR A;  3SY7 A;  2E8G A;  4FZL A;  5DL8 A;  1ORM A;  3T20 A;  3LK3 B;  4FSP A;  2K4T A;  2LHF A;  3SZV A;  1PHO A;  2RIO A;  4LSF A;  3EMN X;  3SYS A;  2XMX A;  2FGR A;  4Q9V A;  4GCS A;  3POX A;  4Z7G A;  3KP9 A;  2FGQ X;  3AA7 A;  4Z7H A;  3AA0 B;  3DA4 A;  2JAE A;  2X27 X;  2KZ7 A;  2XE1 A;  1PRN A;  3WI5 A;  2YFB A;  4FMS A;  4FUV A;  1GFP A;  3V8U A;  4AYI D;  4N58 A;  4AYN A;  1SJ8 A;  2KZ7 B;  4PUX A;  5ADX L;  4LSE A;  4FRX A;  4O4U A;  4GXT A;  4BUM X;  2FUG 1;  1YS5 A;  1BXW A;  2K19 A;  2F1T A;  1OPF A;  4U6R A;  3AA6 A;  3VZT X;  2MJF B;  4O49 A;  3VZU X;  2JB3 A;  5T5F A;  4O4X A;  1W3S A;  3NSG A;  4JFB A;  4O1O A;  3LJ0 A;  2F1V A;  4KR4 A;  4AYM C;  4AUI A;  2V6E A;  1QJ9 A;  2QTK A;  2ZRR A;  2IP6 A;  3HOL A;  1GFN A;  2Y0K A;  4RLC A;  3VE1 A;  2JMM A;  4AYE C;  3SYB A;  3SDJ A;  4I1T A;  2LFU A;  2A2D A;  2J1N A;  4LSI A;  4PL3 A;  4NV5 A;  3LJ2 A;  1HXU A;  6PRN A;  4JCH A;  3GP6 A;  4AKM A;  2ZFG A;  3JTY A;  3LK3 A;  3LK4 2;  3LK4 1;  4AFK A;  4C69 X;  3QRA A;  3IAS 1;  4AZL A;  3PQS A;  3HWB A;  3G7G A;  2J4U P;  3LJ1 A;  4YZD A;  4E1T A;  3UU2 A;  1THQ A;  1ZHT A;  3AJF A;  3AA0 A;  5LNK 1;  5DL7 A;  1GFM A;  3VE2 A;  3LK2 B;  2XTR A;  4DWL A;  4QQ1 A;  4HEA 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...