4G76A

Structure of paem, a colicin m-like bacteriocin produced by pseudomonas aeruginosa
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
291
structure length
291
Chain Sequence
MDLGTTTIVAGQGDFSAYNYGNNGANWPAPSPAQVGYISKGQRDVAYVNGDWEKPLLALWAQWANWGTTLYGYPSLPFPNYEFIWDIFDLPQADYNQFSLGDDRITAMNRAQNHQYPFPNNEGIPSWDRPKIDTFNGGVYTPAAAFAHYLTGKGKKMNFPIERLNIKPNVKAMPQFIGVLTSSPMGQTTVDFNVPYATAKDSWVAGNTVGEITLRIVGILVKSTSGQWSFRGEIRAYDDLYDFNPSNHRTETAEGMTRLGREVGQKFKDTTPYPIGIPGAIPVNISGRSHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and Structural Characterization of PaeM, a Colicin M-like Bacteriocin Produced by Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Phosphodiesterase
total genus 81
structure length 291
sequence length 291
ec nomenclature
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14859 Colicin_M Colicin M
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.280 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4g76A01
2.40.160.140 Mainly Beta Beta Barrel Porin Porin 4g76A02
2XTQA 4FZNA 4G76A 4FZLA 3DA4A 2XMXA 4N59A 2XTRA 3DA3A 4FZMA 4N58A 4G75A
chains in the Genus database with same CATH superfamily
1YS5A 4KR4A 4RLCA 3QRCA 3AAAB 4GXTA 3AA1B 5ADXK 1IZNB 2M06A 4AKRA 3UITA 2W81C 3PRNA 4LSEA 3NSGA 3FBVA 2XTRA 2OMFA 4AUIA 1P4TA 2F1CX 3POUA 2BL8A 2YPVA 3VZUX 3PQSA 2N2LA 2XE2A 2ZFGA 4AYMC 4U6RA 4HFVA 3T20A 4FSPA 1IZNA 2QZGA 2R4LA 4YZCA 3AA1A 3LK3B 4AYID 5DL5A 2A2DA 5E79O 1H6S1 1MM5A 3DWOX 4FESA 2Y2XA 1T1LA 3SY7A 2XG6A 2KZ7B 3JTYA 2ZLDA 2ODJA 1OSMA 5D5DA 3BRYA 4GCPA 2FEFA 4GCSA 4YZ9A 4AS3A 4FRTA 3SYBA 1TDPA 3LK41 2R4NA 4DWLA 3Q8DA 4C00A 4D5UA 5GV0A 3AA6B 3SZVA 2IP6A 3VZTX 1ZHTA 4LSFA 3RBHA 2KDYA 4O4XA 2AXTO 3PORA 3PGSA 3BS0A 4F4BA 3HOLA 2FUG1 3LJ2A 3FNBA 2WJQA 3KZIO 4AFKA 4AYDC 1T16A 2ZRRA 3FVVA 2JB2A 3PF1A 3VY9X 3LJ0A 2JB1A 1BT9A 5ADXL 2P22B 5B5EO 2E8GA 4O3YA 3POXA 5PRNA 4AKMA 2R8AA 2V6EA 2QTKA 3LK2A 4UB6O 4AZLA 5KAIO 4AYNA 2YFBA 4GHBA 2J4UP 4OAVB 1OPFA 2XE3A 4IL6O 6PRNA 3UAQA 3AA7A 3BRZA 2RLDA 3FYXA 2MJFB 4JCVE 2K0LA 3A2SX 3HOEA 1PRNA 5IYUA 2CAZB 2JAEA 1QJ8A 2F1TA 3AA7B 2RADA 1JQOA 4FSOA 1BXWA 3DO9A 5DL7A 4LSIA 3SZDA 4AS2A 2ZW3A 3PGUA 3PGRA 1PHOA 2KXPB 4FQEA 1QJPA 4XNKA 3JCUO 4GCQA 2FGQX 2R88A 3KVDD 1MM4A 3EMNX 4FT6A 4CTDA 3UU2A 4PL4A 4FZNA 4FRXA 2F1VA 3AA0B 4FZMA 4Q9VA 4C69X 2GE4A 1HXXA 4Z7HA 5KAFO 1QJ9A 4AKRB 4RJWA 2LFUA 2MHLA 2A2CA 2X27X 2YFAA 2V1CC 4N74A 1HXUA 3A0HO 3DA4A 8PRNA 1Q9GA 5FVNA 2FU2A 2MNHA 1GFPA 4JCHA 2KKMA 3VE2A 2JBWA 4NV2A 5TISO 4KR8A 3T0SA 3PQUA 5GTHO 5HGIA 3C5OA 2GSCA 3UPGA 4I1TA 4PL5A 4UB8O 1E54A 1U5KA 3T24A 2IWWA 3DWNA 1ZHYA 2Y7SA 4E1TA 2L1LB 5DL6A 3WI5A 3LK3A 4U9CA 4N59A 4N58A 2LHFA 4B61A 4PL3A 2FGRA 4C4VA 2O4VA 3IAM1 4Z7GA 3O0EA 3LK42 3LK2B 3AA0A 5AFUL 5AFUK 5B66O 4YZDA 4O3ZA 5G39A 1GFOA 3B55A 3I9V1 3IAS1 1GFNA 2X9KA 1ZHXA 1GFMA 2XE5A 4BUMX 2JMMA 5DL8A 1MPFA 3GP6A 4O3WA 4C4VB 3G7GA 4XNLA 2K19A 4D65A 3TZGA 3HW9A 1ORMA 4G76A 2XMXA 4JFBA 2BL7A 4OAUC 3QRAA 2PORA 3DZMA 3VZWX 1S5LO 5G38A 1GFQA 4NV5A 4RJXA 1ZHWA 4O4UA 5G26A 1BH3A 2M07A 5GTIO 2N2MA 2RIOA 1ZHZA 2W80C 3WU2O 3KP9A 2R89A 4PUXA 1YO7A 1THQA 5EE2A 2XE1A 2ERVA 4FUVA 2HGKA 3AAEB 3VA9A 3K19A 2XTQA 3A0BO 4N75A 4RL9A 4O1PA 1G90A 2KC0A 2PRNA 3JSBA 1Q9FA 2ETDA 4G75A 5JDPA 4RLBA 1HXTA 3POQA 4K3BA 2JQYA 3P23A 3HWBA 3AAEA 4O3XB 2IWVA 4KRAA 3AAAA 3SDJA 4HEA1 2QSBA 4LSHA 3DA3A 2R4OA 2JB3A 3SYSA 4FOZA 2Y0HA 3NJTA 3VE1A 5LNK1 3LJ1A 3SY9A 4GF4A 5G3AA 4FMSA 2WJRA 4AYEC 3L0IA 2Y0LA 3V8UA 3AA6A 5T5FA 4Z3TA 2YNKA 3WI4A 2J1NA 4O49A 2KXPA 3VY8X 1SJ8A 1W3SA 5H2FO 3F4MA 4QQ1A 4FZLA 2F6MB 4K3CA 4PJ0O 2KZ7A 2R4PA 4PR7A 2QGMA 7PRNA 3AJFA 2WVPA 4E1SA 2F66B 2Y0KA 4O1OA 4D64A 2K4TA
chains in the Genus database with same CATH topology
1BH3A 2P22B 4NV2A 2E8GA 1YS5A 2M07A 2N2MA 2RIOA 4KR4A 3POXA 4O3YA 4KR8A 5EE2A 4RLCA 3QRCA 1ZHZA 2W80C 4GXTA 3AA1B 3AAAB 3KP9A 3PQUA 3T0SA 4AKMA 1IZNB 5ADXK 2M06A 5HGIA 3C5OA 4AKRA 4PUXA 1YO7A 3UITA 2V6EA 1THQA 3UPGA 2W81C 4I1TA 3PRNA 4PL5A 3NSGA 3FBVA 2QTKA 2XE1A 3LK2A 4LSEA 2XTRA 2ERVA 1E54A 1U5KA 3T24A 2OMFA 4AZLA 3VE2A 4AYNA 4AUIA 2YFBA 4GHBA 2J4UP 4OAVB 4FUVA 1P4TA 1ZHYA 1OPFA 2XE3A 3AAEB 2Y7SA 3POUA 6PRNA 3VA9A 4E1TA 2YPVA 3VZUX 3K19A 2L1LB 3UAQA 2XTQA 3PQSA 5DL6A 3AA7A 4RL9A 2N2LA 3WI5A 2XE2A 2ZFGA 4O1PA 3LK3A 4U9CA 3FYXA 4N59A 1G90A 2KC0A 4N58A 2LHFA 2PRNA 4B61A 2MJFB 4JCVE 2K0LA 4PL3A 3TZGA 4AYMC 3JSBA 4U6RA 2FGRA 3A2SX 4HFVA 3T20A 3HOEA 4FSPA 1IZNA 1PRNA 1Q9FA 5IYUA 4G75A 4YZCA 2CAZB 2O4VA 3AA1A 2JAEA 3IAM1 4Z7GA 1QJ8A 3LK3B 3O0EA 2F1TA 4AYID 5JDPA 3AA7B 1HXTA 3LK42 3POQA 3LK2B 4RLBA 4FSOA 3AA0A 5DL5A 2A2DA 5AFUL 3P23A 1BXWA 1H6S1 3HWBA 1MM5A 3DO9A 3AAEA 4FESA 4O3XB 2Y2XA 4KRAA 3AAAA 3SDJA 4HEA1 5DL7A 5AFUK 5PRNA 4LSIA 4YZDA 3SZDA 3VZTX 4AS2A 3SY7A 2XG6A 4O3ZA 4LSHA 3DA3A 2KZ7B 3JTYA 2ZLDA 1PHOA 2ODJA 2JB3A 2KXPB 3SYSA 1GFOA 1QJPA 1OSMA 4FOZA 5D5DA 2Y0HA 4XNKA 3VE1A 5LNK1 4GCPA 3LJ1A 2FGQX 3I9V1 4GCSA 4GCQA 4GF4A 3SY9A 3IAS1 4YZ9A 4AS3A 4FRTA 3KVDD 1GFNA 1MM4A 3SYBA 4FMSA 1ZHXA 1GFMA 2XE5A 3EMNX 3LK41 4FT6A 4AYEC 4BUMX 3L0IA 4DWLA 3Q8DA 2JMMA 5DL8A 2Y0LA 3UU2A 1MPFA 3V8UA 4D64A 4PL4A 4D5UA 3GP6A 3AA6A 5GV0A 3AA6B 4O3WA 3G7GA 4FZNA 4XNLA 2IP6A 2K19A 3SZVA 4D65A 4FRXA 5T5FA 2F1VA 4Z3TA 2YNKA 3WI4A 3AA0B 3HW9A 2J1NA 4FZMA 4O49A 1ORMA 1ZHTA 4Q9VA 2KXPA 1SJ8A 4LSFA 3RBHA 3VY8X 4G76A 2KDYA 2GE4A 4C69X 2XMXA 1HXXA 4O4XA 4Z7HA 4JFBA 3PORA 1W3SA 3F4MA 4OAUC 1QJ9A 4FZLA 4QQ1A 4AKRB 3QRAA 2PORA 4F4BA 2F6MB 3HOLA 4RJWA 2LFUA 3VZWX 8PRNA 2MHLA 2A2CA 2FUG1 2KZ7A 3LJ2A 2X27X 2YFAA 1GFQA 7PRNA 2V1CC 3AJFA 4E1SA 4AFKA 4AYDC 4NV5A 2F66B 1HXUA 2Y0KA 2ZRRA 3DA4A 4O1OA 4RJXA 2JB2A 1Q9GA 5FVNA 2MNHA 1ZHWA 3VY9X 4O4UA 1GFPA 3LJ0A 4JCHA 5G26A 2KKMA 2JB1A 1BT9A 2K4TA 5ADXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTQ A;  4FZN A;  4G76 A;  4FZL A;  3DA4 A;  2XMX A;  4N59 A;  2XTR A;  3DA3 A;  4FZM A;  4N58 A;  4G75 A; 
#chains in the Genus database with same CATH topology
 1YS5 A;  4KR4 A;  4RLC A;  3QRC A;  3AAA B;  4GXT A;  3AA1 B;  5ADX K;  1IZN B;  2M06 A;  4AKR A;  3UIT A;  2W81 C;  3PRN A;  4LSE A;  3NSG A;  3FBV A;  2XTR A;  2OMF A;  4AUI A;  1P4T A;  2F1C X;  3POU A;  2BL8 A;  2YPV A;  3VZU X;  3PQS A;  2N2L A;  2XE2 A;  2ZFG A;  4AYM C;  4U6R A;  4HFV A;  3T20 A;  4FSP A;  1IZN A;  2QZG A;  2R4L A;  4YZC A;  3AA1 A;  3LK3 B;  4AYI D;  5DL5 A;  2A2D A;  5E79 O;  1H6S 1;  1MM5 A;  3DWO X;  4FES A;  2Y2X A;  1T1L A;  3SY7 A;  2XG6 A;  2KZ7 B;  3JTY A;  2ZLD A;  2ODJ A;  1OSM A;  5D5D A;  3BRY A;  4GCP A;  2FEF A;  4GCS A;  4YZ9 A;  4AS3 A;  4FRT A;  3SYB A;  1TDP A;  3LK4 1;  2R4N A;  4DWL A;  3Q8D A;  4C00 A;  4D5U A;  5GV0 A;  3AA6 B;  3SZV A;  2IP6 A;  3VZT X;  1ZHT A;  4LSF A;  3RBH A;  2KDY A;  4O4X A;  2AXT O;  3POR A;  3PGS A;  3BS0 A;  4F4B A;  3HOL A;  2FUG 1;  3LJ2 A;  3FNB A;  2WJQ A;  3KZI O;  4AFK A;  4AYD C;  1T16 A;  2ZRR A;  3FVV A;  2JB2 A;  3PF1 A;  3VY9 X;  3LJ0 A;  2JB1 A;  1BT9 A;  5ADX L;  2P22 B;  5B5E O;  2E8G A;  4O3Y A;  3POX A;  5PRN A;  4AKM A;  2R8A A;  2V6E A;  2QTK A;  3LK2 A;  4UB6 O;  4AZL A;  5KAI O;  4AYN A;  2YFB A;  4GHB A;  2J4U P;  4OAV B;  1OPF A;  2XE3 A;  4IL6 O;  6PRN A;  3UAQ A;  3AA7 A;  3BRZ A;  2RLD A;  3FYX A;  2MJF B;  4JCV E;  2K0L A;  3A2S X;  3HOE A;  1PRN A;  5IYU A;  2CAZ B;  2JAE A;  1QJ8 A;  2F1T A;  3AA7 B;  2RAD A;  1JQO A;  4FSO A;  1BXW A;  3DO9 A;  5DL7 A;  4LSI A;  3SZD A;  4AS2 A;  2ZW3 A;  3PGU A;  3PGR A;  1PHO A;  2KXP B;  4FQE A;  1QJP A;  4XNK A;  3JCU O;  4GCQ A;  2FGQ X;  2R88 A;  3KVD D;  1MM4 A;  3EMN X;  4FT6 A;  4CTD A;  3UU2 A;  4PL4 A;  4FZN A;  4FRX A;  2F1V A;  3AA0 B;  4FZM A;  4Q9V A;  4C69 X;  2GE4 A;  1HXX A;  4Z7H A;  5KAF O;  1QJ9 A;  4AKR B;  4RJW A;  2LFU A;  2MHL A;  2A2C A;  2X27 X;  2YFA A;  2V1C C;  4N74 A;  1HXU A;  3A0H O;  3DA4 A;  8PRN A;  1Q9G A;  5FVN A;  2FU2 A;  2MNH A;  1GFP A;  4JCH A;  2KKM A;  3VE2 A;  2JBW A;  4NV2 A;  5TIS O;  4KR8 A;  3T0S A;  3PQU A;  5GTH O;  5HGI A;  3C5O A;  2GSC A;  3UPG A;  4I1T A;  4PL5 A;  4UB8 O;  1E54 A;  1U5K A;  3T24 A;  2IWW A;  3DWN A;  1ZHY A;  2Y7S A;  4E1T A;  2L1L B;  5DL6 A;  3WI5 A;  3LK3 A;  4U9C A;  4N59 A;  4N58 A;  2LHF A;  4B61 A;  4PL3 A;  2FGR A;  4C4V A;  2O4V A;  3IAM 1;  4Z7G A;  3O0E A;  3LK4 2;  3LK2 B;  3AA0 A;  5AFU L;  5AFU K;  5B66 O;  4YZD A;  4O3Z A;  5G39 A;  1GFO A;  3B55 A;  3I9V 1;  3IAS 1;  1GFN A;  2X9K A;  1ZHX A;  1GFM A;  2XE5 A;  4BUM X;  2JMM A;  5DL8 A;  1MPF A;  3GP6 A;  4O3W A;  4C4V B;  3G7G A;  4XNL A;  2K19 A;  4D65 A;  3TZG A;  3HW9 A;  1ORM A;  4G76 A;  2XMX A;  4JFB A;  2BL7 A;  4OAU C;  3QRA A;  2POR A;  3DZM A;  3VZW X;  1S5L O;  5G38 A;  1GFQ A;  4NV5 A;  4RJX A;  1ZHW A;  4O4U A;  5G26 A;  1BH3 A;  2M07 A;  5GTI O;  2N2M A;  2RIO A;  1ZHZ A;  2W80 C;  3WU2 O;  3KP9 A;  2R89 A;  4PUX A;  1YO7 A;  1THQ A;  5EE2 A;  2XE1 A;  2ERV A;  4FUV A;  2HGK A;  3AAE B;  3VA9 A;  3K19 A;  2XTQ A;  3A0B O;  4N75 A;  4RL9 A;  4O1P A;  1G90 A;  2KC0 A;  2PRN A;  3JSB A;  1Q9F A;  2ETD A;  4G75 A;  5JDP A;  4RLB A;  1HXT A;  3POQ A;  4K3B A;  2JQY A;  3P23 A;  3HWB A;  3AAE A;  4O3X B;  2IWV A;  4KRA A;  3AAA A;  3SDJ A;  4HEA 1;  2QSB A;  4LSH A;  3DA3 A;  2R4O A;  2JB3 A;  3SYS A;  4FOZ A;  2Y0H A;  3NJT A;  3VE1 A;  5LNK 1;  3LJ1 A;  3SY9 A;  4GF4 A;  5G3A A;  4FMS A;  2WJR A;  4AYE C;  3L0I A;  2Y0L A;  3V8U A;  3AA6 A;  5T5F A;  4Z3T A;  2YNK A;  3WI4 A;  2J1N A;  4O49 A;  2KXP A;  3VY8 X;  1SJ8 A;  1W3S A;  5H2F O;  3F4M A;  4QQ1 A;  4FZL A;  2F6M B;  4K3C A;  4PJ0 O;  2KZ7 A;  2R4P A;  4PR7 A;  2QGM A;  7PRN A;  3AJF A;  2WVP A;  4E1S A;  2F66 B;  2Y0K A;  4O1O A;  4D64 A;  2K4T A; 
#chains in the Genus database with same CATH homology
 1BH3 A;  2P22 B;  4NV2 A;  2E8G A;  1YS5 A;  2M07 A;  2N2M A;  2RIO A;  4KR4 A;  3POX A;  4O3Y A;  4KR8 A;  5EE2 A;  4RLC A;  3QRC A;  1ZHZ A;  2W80 C;  4GXT A;  3AA1 B;  3AAA B;  3KP9 A;  3PQU A;  3T0S A;  4AKM A;  1IZN B;  5ADX K;  2M06 A;  5HGI A;  3C5O A;  4AKR A;  4PUX A;  1YO7 A;  3UIT A;  2V6E A;  1THQ A;  3UPG A;  2W81 C;  4I1T A;  3PRN A;  4PL5 A;  3NSG A;  3FBV A;  2QTK A;  2XE1 A;  3LK2 A;  4LSE A;  2XTR A;  2ERV A;  1E54 A;  1U5K A;  3T24 A;  2OMF A;  4AZL A;  3VE2 A;  4AYN A;  4AUI A;  2YFB A;  4GHB A;  2J4U P;  4OAV B;  4FUV A;  1P4T A;  1ZHY A;  1OPF A;  2XE3 A;  3AAE B;  2Y7S A;  3POU A;  6PRN A;  3VA9 A;  4E1T A;  2YPV A;  3VZU X;  3K19 A;  2L1L B;  3UAQ A;  2XTQ A;  3PQS A;  5DL6 A;  3AA7 A;  4RL9 A;  2N2L A;  3WI5 A;  2XE2 A;  2ZFG A;  4O1P A;  3LK3 A;  4U9C A;  3FYX A;  4N59 A;  1G90 A;  2KC0 A;  4N58 A;  2LHF A;  2PRN A;  4B61 A;  2MJF B;  4JCV E;  2K0L A;  4PL3 A;  3TZG A;  4AYM C;  3JSB A;  4U6R A;  2FGR A;  3A2S X;  4HFV A;  3T20 A;  3HOE A;  4FSP A;  1IZN A;  1PRN A;  1Q9F A;  5IYU A;  4G75 A;  4YZC A;  2CAZ B;  2O4V A;  3AA1 A;  2JAE A;  3IAM 1;  4Z7G A;  1QJ8 A;  3LK3 B;  3O0E A;  2F1T A;  4AYI D;  5JDP A;  3AA7 B;  1HXT A;  3LK4 2;  3POQ A;  3LK2 B;  4RLB A;  4FSO A;  3AA0 A;  5DL5 A;  2A2D A;  5AFU L;  3P23 A;  1BXW A;  1H6S 1;  3HWB A;  1MM5 A;  3DO9 A;  3AAE A;  4FES A;  4O3X B;  2Y2X A;  4KRA A;  3AAA A;  3SDJ A;  4HEA 1;  5DL7 A;  5AFU K;  5PRN A;  4LSI A;  4YZD A;  3SZD A;  3VZT X;  4AS2 A;  3SY7 A;  2XG6 A;  4O3Z A;  4LSH A;  3DA3 A;  2KZ7 B;  3JTY A;  2ZLD A;  1PHO A;  2ODJ A;  2JB3 A;  2KXP B;  3SYS A;  1GFO A;  1QJP A;  1OSM A;  4FOZ A;  5D5D A;  2Y0H A;  4XNK A;  3VE1 A;  5LNK 1;  4GCP A;  3LJ1 A;  2FGQ X;  3I9V 1;  4GCS A;  4GCQ A;  4GF4 A;  3SY9 A;  3IAS 1;  4YZ9 A;  4AS3 A;  4FRT A;  3KVD D;  1GFN A;  1MM4 A;  3SYB A;  4FMS A;  1ZHX A;  1GFM A;  2XE5 A;  3EMN X;  3LK4 1;  4FT6 A;  4AYE C;  4BUM X;  3L0I A;  4DWL A;  3Q8D A;  2JMM A;  5DL8 A;  2Y0L A;  3UU2 A;  1MPF A;  3V8U A;  4D64 A;  4PL4 A;  4D5U A;  3GP6 A;  3AA6 A;  5GV0 A;  3AA6 B;  4O3W A;  3G7G A;  4FZN A;  4XNL A;  2IP6 A;  2K19 A;  3SZV A;  4D65 A;  4FRX A;  5T5F A;  2F1V A;  4Z3T A;  2YNK A;  3WI4 A;  3AA0 B;  3HW9 A;  2J1N A;  4FZM A;  4O49 A;  1ORM A;  1ZHT A;  4Q9V A;  2KXP A;  1SJ8 A;  4LSF A;  3RBH A;  3VY8 X;  4G76 A;  2KDY A;  2GE4 A;  4C69 X;  2XMX A;  1HXX A;  4O4X A;  4Z7H A;  4JFB A;  3POR A;  1W3S A;  3F4M A;  4OAU C;  1QJ9 A;  4FZL A;  4QQ1 A;  4AKR B;  3QRA A;  2POR A;  4F4B A;  2F6M B;  3HOL A;  4RJW A;  2LFU A;  3VZW X;  8PRN A;  2MHL A;  2A2C A;  2FUG 1;  2KZ7 A;  3LJ2 A;  2X27 X;  2YFA A;  1GFQ A;  7PRN A;  2V1C C;  3AJF A;  4E1S A;  4AFK A;  4AYD C;  4NV5 A;  2F66 B;  1HXU A;  2Y0K A;  2ZRR A;  3DA4 A;  4O1O A;  4RJX A;  2JB2 A;  1Q9G A;  5FVN A;  2MNH A;  1ZHW A;  3VY9 X;  4O4U A;  1GFP A;  3LJ0 A;  4JCH A;  5G26 A;  2KKM A;  2JB1 A;  1BT9 A;  2K4T A;  5ADX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...