1W3SA

The crystal structure of reco from deinococcus radiodurans.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
230
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and DNA-Binding Analysis of Reco from Deinococcus Radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna repair
molecule keywords HYPOTHETICAL PROTEIN DR0819
total genus 53
structure length 230
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1w3sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1w3sA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1w3sA03
4DV0L 2WB1E 4DK3C 1KD1C 1VQ5A 4POGA 3TS2A 3D0FA 4C2MH 5GAGC 5LMUL 4OO1G 4GN4B 4LWCA 4JI4Q 1CUKA 2YV5A 3HOUH 2QA4A 1XTDA 1MKHA 3KJPA 3S1RH 1QVCA 4O2DA 1NTGA 2NVYH 4DV5Q 3CCEA 1BBUA 1BKBA 3CP0A 2ASBA 4GS3A 3HOWG 3PO3G 4DV7L 4LF5Q 2LSSA 1N8RC 1XMOL 1LYLA 4GKJQ 3FKIG 3UDIA 1V43A 2EXDA 2B63G 4UP8A 1QZGA 2VQEL 4BXXH 3PUXA 4LF7L 5IWAQ 3PO2H 3STBC 5HY6A 1RIPA 1VQLA 4LF6Q 3T1YQ 1WJJA 2CWPA 4YY3Q 1GVPA 4QY7A 1SRUA 3J80i 1PH8A 4OWWB 1X9NA 1XJVA 2K4KA 1QUQA 4YWKA 3FP9A 5ELNA 3PUYA 2NN6I 4R1JA 1S40A 2VUMG 3NEMA 1X65A 3KF6A 2VQFQ 1PA6A 1I3QH 4L5SA 1Z47A 3CCSA 1PFSA 1I6HH 5LMNW 5LMUQ 3OTOQ 5M3FH 4A3MG 2UUAL 3HOYG 1Q1BA 4ALPA 2VNUD 1FGUA 4P75A 2HT1A 3PGZA 2F4VQ 2E5LQ 1X56A 1Y1VG 5GAEC 1JMCA 4DV5L 3HOVG 3PUWA 1EFWA 4H02A 3CMAA 4A3EG 4MZ9A 2XGTA 1PH4A 3CD6A 2Q2HA 4A3DH 4LFBQ 2YTYA 5DLQE 2OQ0A 3EIVA 4DV1Q 4JI5Q 1KC8C 5JJLA 2MFIA 1AH9A 1GM5A 1J6QA 4A3BH 3W1GA 4A3JH 2JE6I 4HJ5A 3CCQA 1XPRA 2BH8A 4IFDJ 2UUBL 3BZCA 4O0AA 4YCUA 1MIUA 1P16A 2HIXA 2IHFA 3EBEA 2E2HH 3F2CA 4LF9L 4X65L 3KFUA 4KLKA 1PH2A 1VQCA 1VQ9A 4GLVB 3RR5A 2PI2A 2ID0A 2JQOA 2Z6KC 4GNXA 3AFPA 1JJCB 3JC66 3K81C 1YBYA 1U0LA 2ZM6Q 2PNHA 5IT9c 1YITA 4K0KL 4FDBA 3I4MG 1OXTA 4TVAB 1Y1WH 1YJ9A 4JI3L 5AJ3L 4B3RQ 2ZJQA 4Y52H 3I56A 3I7FA 3U58A 4JBKA 2Q2IA 1JJ2A 4NPSA 1X54A 2RF4A 2HIVA 4DR7Q 4L5RC 2N8NA 4JI5L 4X66Q 1IBKQ 3F1ZA 1X3GA 3HKSA 4J15A 4IPGA 3HKZE 4DV6Q 3RN2A 1XMQL 2OTLA 1EYGA 3BJUA 3PCOB 4L5QA 4LF8L 4X65Q 1QZHA 4LF9Q 1LTLA 1XNRL 1UEBA 4QIWE 4KHPL 1L1OA 3HOXG 4BY7G 2Y0SE 1V1QA 2I5MX 1T9HA 2I0QA 2UXCL 1G291 4DR1L 4DKAC 2NVQH 5C4XH 4UP7A 1K73C 4P73A 2EQSA 4BBRH 4GNXC 3ICEA 4JV5Q 1SROA 3CAMA 1VQBA 3NBHB 4RMFA 3M9BA 3ULPA 1XNQL 4DR2Q 1X6OA 1Q46A 2OQKA 4BBRG 2YTXA 3A74A 2F4VL 3F2DA 1YHAA 2RHSB 3HOXH 3J80c 4HJ8A 5C0XJ 4DUZL 4IPCA 4DV1L 2JA8H 3GTMH 2H5XA 4DPGA 3PUVA 5IP7H 4X66L 3G4SA 3S2HH 3UE1A 2AHOB 1E7ZA 5H1SE 4NB3A 2UXDL 3M4PA 3RN5A 3FKIH 4GOPC 1VQJA 4B3SQ 3M85A 4YCVA 1KHIA 2F52A 4LF8Q 2K5VA 1HNWL 4B3TL 4WJ4A 1K8GA 4A3JG 5FLXc 2R92H 4NXMQ 1K9MC 1N32L 4NXML 1C9OA 1K0RA 4DAYB 3U4ZA 2VQFL 3F8TA 3H15A 2R7FA 1SMXA 3I4MH 2WP8J 4DR4Q 3HOVH 2WFWA 5IYDH 3OTOL 2UUAQ 3I4NG 4EQ5A 1UE6A 4DR2L 5IYBH 2NZHA 5K36G 4JBJA 2KCTA 1VQDA 1OXSC 3BZKA 2V1CC 1CKMA 1L2FA 2WAQG 2BA0A 2D62A 3KOJA 3CCMA 1X55A 2MO0A 4GOPB 4HIMA 4JI6L 3PF4A 1KXLA 3PV0A 4IPDA 4LF4L 1L1OB 3KF8B 2OWOA 4DAMA 4PZ7A 3W1BA 1BVSA 5IY0A 2UUCL 4YWLA 3S15H 1TXYA 2CFMA 2IX0A 1VQMA 1Q7YC 3K7AH 4LFCQ 1EQRA 1FJGQ 2NN6G 3A5ZB 4LFCL 3RLFA 3L2PA 4IFDI 3CF5A 5IP9G 2N49A 4A3DG 3M4OH 2A19A 4DNIA 4EX5A 1IBLL 1Y1VH 1L0WA 3S24A 5C0XI 4HIDA 3J7ZC 4DV0Q 2GVBA 3CPFA 4TQUS 4LUOA 1Q81C 5M5XH 2EIFA 2R7DA 1G51A 4JOIA 3ULJA 4DV2L 1HNXL 2D0PA 1XNQQ 1PVOA 4DV2Q 1HNXQ 3PF5A 2NVTH 4K0KQ 1S72A 2VL6A 4JCVE 2KHJA 2JA7G 2IY5B 4A75A 3S14H 4POFA 5C3EH 4LF5L 1M1KC 1CKNB 5GQOA 3L7ZC 1YIJA 3CC4A 4A3GG 1DGSA 2Z6KA 4JI8Q 1PH5A 4A4IA 1PHJA 4R4QA 1YJNA 3L0OA 1VQ7A 1CSPA 4OX9Q 2RCNA 1FJGL 4YCWA 4YY3L 3FHWA 1IBKL 1XNRQ 5C4JH 3T1YL 4BA2I 2KBNA 4C3HH 3S16H 5BR8L 1D7QA 3HOWH 4DV6L 4QJFA 2UU9L 4A3BG 1KRSA 4YHHQ 2I5HA 2QGQA 4A3FG 4A3IG 3HFZB 3TS0A 3ER0A 4A3CG 2PQAA 3GTKH 5C3EG 2YYZA 3I4NH 1YEZA 4JBWA 3CCRA 1YZ6A 3ULLA 4A3EH 2IT1A 4DR6L 3CC7A 2Q2UA 3TRZA 2AWOA 3M7NA 4A3CH 4UPAA 4A3IH 1VQAA 3KF6B 5AJ3Q 1X3FA 4JV5L 1Q82C 4HIKA 3T1HQ 1VQGA 3BU2A 3GD7A 3CCVA 3KDFB 2BH2A 2KHIA 4DR3Q 4B3ML 1VQFA 1KL9A 4IOCA 1N34L 4HJ7A 3AEVA 5FLMH 1SN8A 1VQ4A 3A5UA 1OXUA 2NZOA 4HIOA 1W2BA 1HZAA 3E9IA 3AQQA 2UXDQ 4JI1Q 4GN5A 4OWTB 4RG1A 1KIXA 4BY1G 2ZTDA 3DM3A 3EN2A 4B3TQ 1EOVA 3I55A 3HOZH 1N33L 1XPUA 1Q1EA 1IZ6A 1TWFH 1IBML 1IBLQ 3HOYH 3NENA 2MQHA 4DUYL 3CQZH 1HNZL 2Q2TA 2PMZE 1QVFA 4PZ6A 1HZBA 1AE2A 1HR0Q 4AQYL 4P74A 5C4XG 1W3SA 4ME3A 3U50C 3GTGH 4P71A 5J3BA 1HZ9A 4A3KG 1A0IA 3GTPH 4YWMA 1WFQA 5IYDG 3CCUA 4R4IA 1VQ8A 1D8LA 1PV4A 4AH6A 2BA1A 4PMWA 4IPHA 3UDGA 1TWAH 1VQOA 5IP9H 2B29A 5EAYA 1KRTA 4JOIC 3PIPA 1JB7A 3ERSX 1VCIA 1HZCA 1N36L 2ZJPA 2KENA 5LMNQ 1GD7A 2R7ZH 4PG3A 3GTJH 5GROA 2MNAA 3CCLA 5FJ8G 1R9TH 3GTLH 5JEAG 1WCMH 2JA5G 2UXBL 2UXBQ 5HGQA 3PIOA 2F3IA 4PZ8A 1XMQQ 3G6EA 3S2DH 1IBMQ 4A3GH 1K8AC 4YHHL 4OXPA 2AWNA 1Q12A 3E9HA 1HR0L 1VQKA 2JEAI 3HKZG 1FVIA 1I50H 3K80C 1SR3A 1JJGA 3AFQA 1A63A 2JA6H 1SLJA 1YJWA 1E3PA 2R92G 4NXNL 4JI6Q 4A93H 2Z0SA 4R4CA 1N9WA 2CWAA 3RNUA 1Q86C 4A3LH 2CQOA 2PI2E 3OYYA 4KI0A 2CCZA 1OTCA 4R4TA 3JAMc 1ASZA 1Y14B 1O7IA 3LGJA 2E2JH 4P72A 1E24A 3MXNB 4BY7H 1N34Q 4OWXB 5M5YH 1YVCA 3NELA 4LW1A 4IOAA 1B7YB 4GKJL 5IP7G 1NJIC 2D0OA 2E8GA 4LNQA 2JA8G 3PSIA 4IO9A 1EIFA 1RL2A 5C44G 2ATWA 1IXRA 1CKOA 1GKHA 1LUZA 2JA9A 3W5OA 1YI2A 4KHPQ 1HR0W 1A62A 1VQPA 4GOPA 2UUBQ 3G71A 2NVXH 3CC2A 4BBSH 4AYBG 4DUYQ 4A3LG 1VS0A 1PH6A 3TEHB 1NY4A 1HH2P 4Y7NH 1WYDA 3D31A 2VS1A 1GO3E 4XIGS 1EQQA 1EUJA 4JI7L 3MEFA 3IRBA 5JEAJ 4X62L 3F2BA 5IYCH 2DUDA 5IYBG 1M90C 4JI7Q 1VQ6A 2E5LL 3H3VH 4WJ3M 3J81c 1A8VA 4HJAA 3TREA 1KAWA 1QUQB 3CPWA 4DR3L 2Y0SG 4B3MQ 3M3YH 1Q8KA 4KHZA 2L15A 4QQBX 1J5EL 1U5KA 1N36Q 1J5EQ 2B63H 4BBSG 1HJPA 1E1OA 2AKWB 2N3SA 1L1OC 3KDFA 4AIMA 5GADC 2UU9Q 1OXVA 4JI0L 1YNXA 1NMGA 2JEBI 2IX1A 5BR8Q 5M3MH 3KYHC 1B8AA 4B3SL 1HNWQ 3RZOH 2GN5A 4LFAQ 2A1AA 1P8LA 1TWCH 2HHHL 1N33Q 2OTJA 4APVA 4DV4L 1XPOA 4DV4Q 2UXCQ 4IJLA 5IYCG 2R93H 4X6AH 2K52A 3WWVA 4OONA 1Z9FA 5GAHC 2K75A 1TWGH 1NE3A 3STBD 3K8AA 3GTOH 3PUZA 1SE8A 4JI4L 2QEXA 4L5TA 4JI3Q 1V9PA 2JA6G 2A8VA 4DUZQ 2LXKA 1UE5A 2AMCB 4GKKQ 2R93G 2HQLA 2I5LX 1NMFA 1PH9A 3GO5A 3RZDH 2VQEQ 2GVAA 1JT8A 4DR7L 1SFOH 2VZAA 3RLNA 2WB1G 4JC0A 4XTCS 4OX9L 2FXQA 5E7NA 4JYAQ 2IHEA 3SGIA 4BA1I 4C3JH 5M3MG 2VY3A 4X64L 4GLAC 1PH3A 2JA5H 3J7A5 3K0XA 1UWVA 2LXJA 4DR1Q 1N32Q 3H0GG 1I94Q 2CKZB 2E2IH 2HHHQ 4UY8C 3VDYA 4JI2Q 2JJQA 5M5WH 1EWIA 3E0EA 5ELOA 3ZJYC 4DR4L 4A93G 5IE8A 3JAMi 1K3RA 5M3FG 3G48A 4A3MH 1CKNA 1UE7A 4QL5A 4DK6C 3CMEA 4DV3Q 4DV3L 3H3VI 2K50A 3M4QA 3S1QH 1Y1WG 3CXCA 2MO1A 3S17H 4IFDG 3S1MH 4A76A 2PQAB 4LUZA 4MNOA 4NXNQ 4JBMA 3T1HL 4UP9A 4A3FH 3A0JA 2R6GA 1WI5A 2K5NA 1QVGA 4GLXA 4GNXB 5JJIA 2ZTCA 2YU9H 3I4OA 2K14A 4LFBL 1WCMG 3UDXA 5LMNL 4AYBE 3B6YA 3OW2A 1YHQA 1B70B 1X3EA 4R4OA 2WAQE 5FJ8H 1PH1A 1CSQA 2ALYB 4JI1L 4JG2A 4X64Q 1VQIA 5IWAL 4JYAL 2R7ZG 4LF7Q 1YHBA 3K7UC 1MJCA 3J81i 4BY1H 5C0XG 4LUVA 5C44H 4JI2L 3HOUG 1HNZQ 1I94L 1AE3A 4DR5Q 1EIYB 5FLMG 1VQHA 2JA7H 1VQNA 3GDEA 3I2ZA 3AYHB 4A3KH 1C7YA 1S3OA 3UDFA 1C0AA 2N78A 4B3RL 1ASYA 3TQYA 4X62Q 1H95A 1BBWA 1NBWA 1E1TA 3KJOA 2ZM6L 2ES2A 1WOCA 2C35B 4IJHA 3S1NH 1G6PA 1MJEA 3UE0A 1IYJB 1E22A 2RHQB 3H0GH 3DLLA 3CCJA 2VUMH 4C3IH 2DGYA 1OXXK 1UE1A 2JK8A 4QGUA 3GTQH 4GKKL 4LF4Q 1TWHH 3J81j 3HOZG 4JI8L 4OO1I 1XMOQ 4HJ9A 4DV7Q 2KCMA 3CW2C 1PYSB 1KQSA 2UUCQ 4JI0Q 1LM0A 2ZTEA 3PO2G 4BXXG 1PH7A 1FL0A 1VQEA 1IL2A 4GN3B 2VW9A 1JE5A 4LF6L 3KLWA 1PYBA 2K5HA 4LFAL 1K83H 2OCEA 4DR5L 3PO3H 4MTNA 1I5FA 4AQYQ 5JJKA 3U4VA 4DR6Q 2XTIA 2B3GA 3Q8DA 2YTVA 3RLOA 2ZJRA
chains in the Genus database with same CATH superfamily
3DUZA 2MGSA 2WGCA 1SJ8A 5DNFA 1UUPA 1OYVI 3HOUH 2QA4A 1MKHA 1TY2A 2SNMA 4O2DA 1QCBD 1I4QA 1BKBA 4DV7L 1F9PA 1N8RC 2Z4HA 3EQLC 4O42A 4RKBA 1JWMD 5G3LF 2X3TA 2KCXA 1QZGA 4B6DA 3PUXA 2QF7A 2JN4A 3PO2H 5BN4A 3SEKC 2EJMA 2CWPA 1RF2D 1SMYD 1PH8A 4FO2A 1X9NA 4YWKA 4R1JA 1EY6A 3E0JA 2F03A 4I1TA 1EU4A 1NR4A 1PJUA 5LMUQ 1JORA 3N52A 2VNUD 4WJWA 2F4VQ 2O5IC 1X56A 4DV5L 3CMAA 4A3EG 1DYQA 4A3DH 2Q2HA 5CORA 2YTYA 3OXGA 1GM5A 1Y1WB 3S1RB 1LTID 3MEHA 3CCQA 3BZCA 4O0AA 2XIWA 2JA7B 1TY0A 2GKTI 2DN8A 1PRTD 1DONA 4GLVB 3GOXA 4M8AA 2ID0A 3JC66 1YBYA 5JPNC 1TBNA 2W0TA 2PNHA 5IT9c 1YITA 1IW4A 3TOBA 3D6WA 5IODA 2UVOA 2ZJQA 1MSGA 3I56A 4Y52H 4NPSA 1X54A 2HIVA 2RSOA 2E2JB 3HKZB 2Y0MA 3A8IE 1S4ZA 3QAHA 1PTOD 4C3IB 5JVH3 1IYUA 2MJ8A 4QIWB 1RFHA 1XMQL 1EYGA 3PCOB 1QZHA 2IP6A 1LTLA 3TBIB 3VR6A 2EXZA 4BY7G 1V1QA 1KLUD 1T9HA 3D00A 4DR1L 4DKAC 1PRTB 2Z6BA 1IW7C 2EQSA 3NBHB 4QMGA 1X6OA 2OQKA 4BY1B 3FSYA 4RGOS 3S15B 1YTPA 1WGTA 5C0XJ 4R8IA 3IFTA 4DV1L 2L1LB 1MI2A 2EY6A 2H5XA 4DPGA 5IP7H 3G4SA 3BYTB 4RGMA 5EBDA 3K58A 1LTGD 1E7ZA 2EOTA 1JOQA 3B4VC 2UXDL 2CW0C 2VXWA 3H94A 3M85A 4YCVA 1KHIA 3L0IA 2X6LA 3IAM1 4P2CB 3NWSA 3I70A 5FLXc 1KNEA 4K8JA 5C4ZA 4NXMQ 2Y0SB 1K9MC 4NXML 1K0RA 1I6VC 2BL8A 3U4ZA 4AS3A 4DNTB 1SMXA 4DR4Q 3HOVH 1UE6A 3CXLA 4H0LC 1LTSD 2KCTA 3KOJA 2KCNA 4JI6L 1RD9D 4FF2A 2OWOA 1UAPA 5IY0A 1WTVA 2VUMB 1TXYA 1GUOA 2MJFB 2MPMA 3K7AH 1K8OA 4K14A 4LFCQ 1FJGQ 1FNVA 3HS0C 3L2PA 3CF5A 4A3DG 3RD4A 2PQEA 4R9WA 3FC3A 2ZRRA 1IBLL 2BCOA 3GV3A 3P7JA 4O1NA 3M4OB 2JYOA 1SYDA 1ULNA 5IGBA 4DV2L 1IL8A 1XNQQ 1FYCA 3OWEB 1S72A 2F6MB 4JCVE 3V96A 4K0KQ 1EZ8A 3A56A 3S14H 4POFA 1BCPC 4CDCC 2E73A 1YIJA 1CT1D 5C0XH 1TIHA 1II3A 1DGSA 3K57A 2ODDA 2CQAA 2Q8TA 1JQYD 1PH5A 4A4IA 1VQ7A 1K28A 3BDOA 3FMCA 3FHWA 4TSSA 1IBKL 5C4JH 5E3FA 3T1YL 1B9NA 4C3HH 5CGKA 3S17B 3LJ2A 2OU2A 1VF7A 2IW3A 2E76C 4ZKBB 4A3FG 3UOEA 3TS0A 4A3CG 2PQAA 2AUKA 2E2IB 1SNCA 1X32A 3CCRA 1YZ6A 3ULLA 4X3TA 4DK1A 4UPAA 3KF6B 1ONLA 3URYA 2BOSA 4IALA 1H9JA 1DXMA 3BU2A 3CCVA 4DR3Q 4UXIA 2BL7A 3NWTA 1VQ4A 1ET6A 4YZ9A 1OXUA 5FO7B 3E9IA 1CT2I 3Q6SA 5D3DA 4RG1A 2ZTDA 3DM3A 5IOCA 1RKNA 4OHJA 4Q0FA 1IZ6A 1IBML 3UGLA 3NENA 5KIXA 3HOZB 3R2TA 4OGQC 3I4LA 5FUVA 1HZBA 1AE2A 5I9OA 1HR0Q 4P74A 1KDBA 1W3SA 4ME3A 3I73A 3BJIA 3U50C 3GTGH 5CV7A 2PMZB 2K28A 3CCUA 1SMYC 2RCFA 2L11A 1SE2A 3OMCA 1K7VA 4PMWA 4IPHA 1TWAH 1NXUA 2B29A 5C5LA 1KRTA 4ZLTF 4JPBW 5CYUA 4KV6A 2A6HC 3M4YA 1DZ1A 2KENA 2G9DA 4PG3A 1WTPA 2KKMA 3JSBA 3GTLH 1VMPA 5JEAG 4H7BA 3N6RA 1HQMC 2XN9C 1WD1A 4B9WA 1KAAA 1IBMQ 1AW7A 4A3GH 4PV1C 1GUWA 4WFN3 1PZJD 1P9GA 2AWNA 2JEAI 1VQKA 3HKZG 1FVIA 3H3VC 1SR3A 2NB0A 2L55A 2MUYA 5EQ0A 4FKDA 1E3PA 3CKIB 1D1IA 4JI6Q 2Z0SA 2QPOA 2JB3A 2F3WA 3RNUA 1X3QA 3R93A 5C3WA 4BY7B 2CQOA 2PI2E 4PL3A 1OTCA 3I91A 3OPOA 1Y14B 1O7IA 4BY7H 1N34Q 2R3ZA 2VRWB 3LJ1A 1YVCA 2A6ED 4GKJL 3R3OA 3K5MA 2M5XA 2B39A 3EVQA 4IO9A 1EIFA 1RL2A 1LUZA 1GKHA 1YI2A 1BCPB 3C2PA 2O2LD 2QEJC 1A62A 1VQPA 2NVXH 3CC2A 4AYBG 1CHPD 1VS0A 3SVMA 1E2VA 1NY4A 1HH2P 1SNMA 3T51B 3MC0B 2VS1A 3E6ZX 1A2TA 5JEAJ 4CDEC 4X62L 4JI7Q 2DUDA 5IYBG 1VQ6A 3H3VH 3QTLD 1TGSI 1I4GA 4F88A 4RHRA 4B3MQ 3M3YH 4A3IB 4KHZA 2L15A 5HI7A 1N36Q 5ELDA 4EGVA 3OIQA 1J5EQ 3GTPB 4JI0L 3I4MB 2C9OA 1KDCA 1IYVA 1STGA 4UDUC 2EJFC 2B2TC 3RZOH 1QWYA 2HHHL 1N33Q 2OTJA 3SK5A 1XPOA 4DV4Q 4GI3C 4IJLA 5ELEA 4CJ1B 4HCEA 1Z9FA 1HEVA 2NBFA 3GTOH 2TMPA 4JI4L 2JA6G 2A8VA 1LTTD 2LXKA 1UE5A 2R93G 1NMFA 2GVAA 3GV6A 5C4HA 4DR7L 1SFOH 3NHHA 3MTSA 4G57A 4OX9L 4XTCS 3P23A 2ZXPA 4EQNA 1X3PA 3I3CA 1PH3A 4RAUC 2JA5H 2N88A 1MJBA 1ZXTA 1QG7A 1I94Q 2E2IH 2L7XA 5M5WH 1A15A 5EKLA 1STEA 1K3RA 3ICEA 1UE7A 4DK6C 2GKVA 2HQEA 2K50A 3NUCA 1R0RI 1Y1WG 3CXCA 3S17H 4BWGB 3S1MH 3ERQA 4A76A 4JBMA 5EX0A 1Q9BA 3KLSA 4F8MA 4OEMB 1YNND 2ZT9C 3TO9A 2H1EA 2NU2I 4GLXA 1KMAA 3FEWX 2ZTCA 2K14A 3KLRA 1YHQA 2BE5C 3HOYG 3GTQB 2WAQE 5FJ8H 2ALYB 4JI1L 4X64Q 1VQIA 4X3KA 4LF7Q 1PFMA 2J7ZA 2CHBD 1MJCA 3W3AA 3J81i 4BY1H 2HDMA 4LUVA 1D1KA 2EE1A 2XVSA 1AE3A 1HNZQ 1HPTA 5FLMG 1TS4A 5KGUA 2ETDA 3K59A 1VQNA 1GHJA 2Z1CA 2KEDA 3O13A 1BO0A 5DEHA 1CT0I 1C0AA 1NBWA 3K6OA 2EZVA 1LR9A 2ES2A 3S1NH 4GZYC 1NSNS 2VUMH 4C3IH 1SXTA 1UE1A 1F2ZA 4LF4Q 2WVJA 1DS2I 3OVOA 2ENNA 2KCMA 2UZ3A 5C4XB 3QJYA 1B2TA 3F2UA 4BXXG 3LX0A 2PZUA 4DN4M 4LF6L 4JW0A 2BDNA 4HN7A 4MTNA 4AQYQ 1UVFA 3VYTA 5JJKA 4IUPA 5I6WA 3Q8DA 2YTVA 2DIPA 3RLOA 3K0YA 2WB1E 1KD1C 2E75C 3TS2A 4C2MH 5GAGC 1Y8PB 4GN4B 4OO1G 1CUKA 4DV5Q 2ASBA 4LF5Q 1TQOA 1LYLA 3FKIG 2NU0I 4UP8A 5E4WC 4BXXH 1S5BD 5IWAQ 2KMOA 1RIPA 3IL8A 3NTIA 4LF6Q 1TWGB 1RDPD 5CCLA 2RSNA 3SK6A 2E2HB 4EQPA 4HEA1 1SAPA 1QUQA 3FP9A 2VUMG 4DK0A 1TWCB 3NBHA 1SGPI 2VQFQ 4L5SA 2A73B 2WB1B 1PFSA 4LK1C 1A3TA 3CCSA 3OTOQ 5M3FH 4A3MG 2UUAL 4ALPA 3SGQI 3PUWA 4MZ9A 3FVVA 5IT9L 4LFBQ 5DLQE 2OQ0A 3EIVA 1KC8C 1I3QB 1J6QA 4A3BH 1A2UA 2JE6I 4KKUA 2BH8A 1JE4A 1N13A 2ELIA 1SNPA 4YCUA 2IHFA 5I2YA 4O1OA 2E2HH 1CZWA 3KFUA 3RR5A 3Q24A 3CRLC 2JQOA 1WCMB 3Q22A 5E3PA 1WVLA 5C4JB 1WGCA 2ZM6Q 1HDLA 3R2IA 4RCOA 3I4MG 4HMJA 3QWNA 1QNUA 1YJ9A 1Y1WH 1VDDA 5CMDA 4F7XA 3J7AF 3U58A 4JBKA 3TO7A 2RF4A 4E1RA 4JI5L 4X66Q 2KA7A 1IBKQ 2N55A 2LS01 4IPGA 3LWUA 3S1QB 4LAAA 1EOTA 2RBMA 2OTLA 3BJUA 4L5QA 4MN3A 4LF8L 2V53A 2NN6H 1OMUA 1O80A 1UEBA 4QIWE 2JA6B 1L1OA 3KF8A 4ZCKA 4KHPL 2I5MX 3HP3A 2I0QA 2UXCL 4FF1A 1G291 1K73C 4GNXC 4BBRH 4PL4A 4JV5Q 1SROA 3CAMA 1S5CD 1VQBA 3WOFA 3ULPA 1FD7D 1XNQL 4DR2Q 2JA8B 1E2WA 5C44B 1STHA 4K2KA 4K5XA 4Z7GA 2F4VL 1AEXA 2XMXA 3F2DA 2CH4A 2EDGA 4RHSA 2JA8H 1XA6A 1D6EC 2NTSA 2X69A 1DCZA 2K03A 3S2HH 3UE1A 1TR5A 1Y8OB 2EPBA 1DD2A 1FY7A 3RN5A 4GOPC 3MWYW 4B3SQ 2ICEC 4LF8Q 1STBA 2F52A 1YU6C 4AS2A 3T13A 2G9HD 3UFFA 1N32L 1PTQA 1C9OA 3F8TA 1BBXC 4ABNA 5IYDH 1M8CA 4PNYA 4IUVA 5IYBH 2NZHA 4RA8A 5K36G 1VQDA 1OXSC 1L2FA 1CE3A 2D62A 3CCMA 3PF4A 1B3AA 1FAQA 4HIMA 1G91A 3LWEA 4NDXA 3MXUA 4PZ7A 1BVSA 3MFYA 2UUCL 1QILA 4YWLA 3S15H 4DNRB 1IY6A 4NW2A 3MZ5A 2EY1A 1EQRA 2XTRA 1PXUA 5EKIA 1HTLD 5M5WB 4QB4A 5IP9G 2N49A 3M4OH 2A19A 4DNIA 2FMCA 1Y1VH 1L0WA 4HIDA 2JSOA 1VF5C 3MXNA 3J7ZC 3CPFA 4LUOA 1H9MA 3ULJA 4JOIA 5M3MB 2F0SA 3G7LA 4OO1H 2IY5B 2VL6A 5BN3A 2HUGA 2JA7G 2L0CA 4V0BA 4A24A 4KKTA 1PRTC 3SK4A 5C3EH 2F0OA 3I90A 5GQOA 1TS2A 4A93B 4A3GG 1JOOA 4JI8Q 1JC7A 2Z9HA 1ULKA 1YJNA 1BCPF 1SYFA 2JP1A 4ZK9B 3RZOB 5KYIA 5BR8L 1WD0A 4J8QA 1DM0B 1SYCA 3S2DB 2I5HA 1LV9A 1PZKD 2QGQA 4A3IG 4FF3A 3ER0A 3GTKH 3VA9A 3CU7A 4AMLA 2CH4W 2IT1A 2A2DA 4C3IG 3CC7A 1V1OA 2AWOA 4IFDH 4A3IH 2F1MA 3BYYB 1C48A 3T1HQ 4DF7A 3QB3A 3KDFB 3RZDB 2BH2A 4C2MB 1OO9B 5LL6X 4RFBA 1VQFA 3QR8A 4IOCA 2K33A 1HFGA 1UEAB 5FLMH 1SN8A 3A5UA 2NZOA 4HIOA 5FK9C 1HZAA 5JAVA 2UXDQ 4XYQA 2EYMA 4BY1G 1SSOA 5J39A 5EX3A 2NVXB 3HOZH 4DU9A 2ROWA 3HOYH 1IBLQ 4X3SA 2MQHA 4KTAA 1CHOI 2PMZE 3GQBA 4PZ6A 2JB2A 1HQRD 5A35A 5IGDA 3PO2B 5J3BA 4XYOA 5J1ZA 2HCIA 2PO4A 1VQ8A 2KMQA 1PV4A 1CHQD 4OAUC 1HA5A 2F66B 2HGKA 1ZYRC 2Z4IA 5IP9H 4JOIC 3AJFA 2N52A 3ERSX 1HZCA 2ZJPA 5I6YA 5LMNQ 2R7ZH 2LB7A 3CCLA 1HTPA 3E3XA 3TJQA 3NK9A 3OHXC 4ULLA 4F87A 2JA5G 4OIJA 2UXBQ 5HGQA 4CJ0B 3QOJA 1KBFA 4PZ8A 2PCFB 1VMCA 1K8AC 3HOWB 4YHHL 1SGDI 1Y1BA 1Q12A 3E9HA 5FO9B 4Q9VA 1Q3LA 1EY7A 3HOYB 4CJ2C 5DAUA 2D2CC 2JA6H 1BUVT 2XTQA 1Y1CA 2F0IA 3RU0A 1SNOA 1N9WA 2CWAA 1PCEA 4M1UB 4A3LH 3NP8A 3OYYA 1WTHA 2OD1A 4KI0A 3GP7A 2QQ0A 5E3RA 4NKLA 3LGJA 4P72A 2NVTB 3FBVA 1EU3A 2YUUA 4LW1A 2F0GA 2D0OA 2JA8G 1G8ZD 3W5OA 1U4LA 1HR0W 3VDPA 4DUYQ 4A3LG 4A3EB 2A69D 1PH6A 1EEFD 3SK8A 1HHVA 5D14A 1V1HA 4XIGS 1EQQA 3Q23A 4K0KL 2I07B 5CR3A 1SGNI 4IUUA 4B08A 1CQFA 4CGYB 2YU9B 4A3BB 1QNKA 1R4QB 1X4SA 4KY7A 4R8NA 4QQBX 4ZYSA 2YQPA 3I4NB 2AKWB 5JPMC 2N3SA 1L1OC 2JZMA 4HSPA 3KDFA 2JEBI 3NE5B 3X3MA 1HNWQ 2SNSA 4UXHA 4IUNA 5CV9A 5KYLA 3TP7A 1TWCH 1FNUA 4OELB 3FKIB 2BUSA 2B63B 5IYCG 3K5NA 3WWVA 2V4DA 3BVMA 1TOTA 5KNBA 2KECA 4H44C 2J9RA 3DM1A 3M3YB 1SE8A 3SE0A 1V9PA 3HOXB 4DUZQ 4GKKQ 2HQLA 1MSHA 3DA3A 3FPPA 4ID6A 1PH9A 3GO5A 3RZDH 1JT8A 2OZUA 5M9OA 2ERWA 3F4MA 3DO9A 2VZAA 2RKSA 4DWLA 5FOBB 3VE5A 2FXQA 4RKLA 1O7ZA 5E7NA 3C1FA 3MEKA 7WGAA 2IHEA 4BA1I 4A3KB 4V190 1SDFA 2PW5A 2KOLA 1WTWA 2PPBC 1MD2D 4U6RA 3PIO3 3VDYA 2JJQA 5EBCA 3E0EA 3ZJYC 4A93G 5M3FG 3G48A 4A3MH 3H3VI 1SYBA 3M4QA 4IFDG 1K83B 2MO1A 2F0QA 2P22B 2AUJD 3H91A 2KJXA 4UP9A 5F2DA 2D9UA 1WI5A 1K8MA 1QVGA 5JJIA 2YU9H 3I4OA 1U9RA 5EPKA 1WCMG 1CZGA 3UDXA 5LMNL 3B6YA 1TBRR 2TSSA 2N17A 4R4OA 3VR3A 5IWAL 2QKIC 3TP8A 1YHBA 3KUPA 3K7UC 5DM63 2WAQB 4X3UA 1V1IA 2F0UA 4JI2L 3B55A 4KHVA 1WTRA 4Y7NB 4PL5A 1ESFA 5T1GA 1BOSA 1VQHA 2JA7H 4FF4A 1PTOB 2F0HA 3AYHB 4A3KH 2KMPA 1S3OA 3MHBA 3UDFA 5E3QA 4X62Q 1H95A 1STYA 1E1TA 3J7YW 3KJOA 2ZM6L 1WOCA 1G6PA 4DAPA 2K9HA 1LABA 5CBEE 1IYJB 1E22A 2RHQB 1O7YA 3H0GH 5HURA 4FYDA 2DGYA 3EA6A 3GTQH 1HUMA 4C3JG 1XMOQ 3A7AB 2K1BA 2MP1A 3CW2C 1PYSB 1KQSA 4JI0Q 3NPPA 3IKJA 3PO2G 2F3CI 2RC4A 2FJ2A 1VQEA 2F0WA 2XNAC 4GN3B 1JE5A 3A8KE 4DFAA 2VW9A 1CA5A 3KLWA 1IL2A 4LFAL 1EIGA 1A3VA 4DR5L 2MHVA 2FNFX 4DR6Q 2O4XA 5K36H 1PFBA 2IX3A 4DV0L 4DK3C 1VQ5A 2H4OA 4NV5A 3RUZA 4RH6A 1R9TB 5I9PA 2O5JC 5LMUL 2SEBD 3L9AX 4LWCA 3GTJB 4JI4Q 2YV5A 3QO2A 3S2HB 4A3JB 2VB3X 1NTGA 1BBUA 3CP0A 5KEEA 3HOWG 3PO3G 2LSSA 1XMOL 3G6JB 2B2UC 3TOAA 3LNNA 3UDIA 1PYWD 1V43A 1AN8A 2XSCA 4LF7L 1HRJA 4HAEA 3MA2B 1SYEA 3T1YQ 4ME5A 4FXGC 5JJZA 1HPCA 1B4OA 2AQ2B 3JAME 2LEOA 4OWWB 1GOZA 3CQZB 3D4RA 5ELNA 2BE5D 2NN6I 3PUYA 1EEID 3NEMA 1X65A 1B44D 3EJIA 1I6HH 4ZRZA 1ET9A 1D5ZC 2RADA 3AU7A 4KY6A 1C8CA 1ILQA 3OW7A 2HT1A 2NU3I 2KUMA 1JMCA 2LFNA 3HOVG 1EFWA 4DGZA 1PH4A 3CD6A 1Y8FA 4NMZA 2MFIA 1AH9A 2F3VA 3W1GA 1JWUD 1TT2A 1O78A 4HJ5A 1XPRA 2UUBL 1MIUA 2P5ZX 3EBEA 3F2CA 4LF9L 1DOMA 4X65L 1VQCA 1VQ9A 2PI2A 3E2IA 3NBIA 4GNXA 3AFPA 3NSWA 4HSVA 1JOKA 4I65A 1PTOC 4BBSB 1R4PB 5IIFA 1U0LA 3FRPB 4QF4A 3TSSA 3OMGA 3VR4A 2R7ZB 4OIKA 4DXFA 4FDBA 4G76A 1OXTA 1LR7A 5COYA 3NTHA 3HOUB 1JJ2A 3C46A 2FFKB 1W6JA 5C3EB 1RCVD 3E5SA 2N8NA 3HGBA 4L5RC 1TWHB 4ILWA 3DWPA 2DB6A 1X3GA 2GA4B 1SNQA 4J15A 4DV6Q 1LT5D 2B2TA 4L63B 4NP5A 1TBQR 4X65Q 1B1ZA 4LF9Q 3HOXG 2Y0SE 2XWJB 3HRZC 5L37A 1OVOA 2M9VA 2CWGA 2NVQH 4UP7A 3V05A 3SDZA 5JVG3 2A2CA 3WDNA 1LR8A 2YTXA 3A74A 1SJED 1YHAA 2GSCA 2RHSB 3H0GB 4AYBB 3HOXH 3J80c 1KTKA 4DUZL 2NVYB 4G4KA 3GTMH 3UI2A 1IY5A 1F9SA 3PUVA 4X66L 1TWAB 1K7TA 5H1SE 5A2QE 3M4PA 3FKIH 1VQJA 2K5VA 5TSSA 4LJZC 4WJ4A 1JCKB 1K8GA 3S1MB 4PMCA 5T1IA 2VQFL 2K6AA 2C5CA 3H15A 2RDHA 1FARA 3OTOL 2UUAQ 1YNJD 4DR2L 1CGJI 2JA5B 3BZDB 1GUGA 5IGGA 2BA0A 2WAQG 2A20A 2MO0A 1Y8NB 4ZKCB 5IGCA 4IPDA 1SFOB 3H6MA 4SGBI 2JYYA 3K5OA 2J87A 1SGQI 3KBGA 4IUTA 1VQMA 1Q7YC 4KY5A 1V8QA 1M8BA 3D3RA 4JK1C 4A3MB 1DOLA 2NN6G 4LFCL 1K0SA 3GTOB 2IWHA 2LKVA 2CAZB 2X6GA 2R93B 3DA4A 1Y1VB 5C0XI 4RGTA 4DV0Q 2GVBA 2EJGC 5HGTA 1Z2IA 2EIFA 2K04A 3LJ0A 2R7DA 5D65A 2AQ1B 4DV2Q 1EFID 1G2TA 3PF5A 2NVTH 4S3SA 2EYJA 4A75A 1Z7KB 1CKNB 4CKEA 3R5DA 3L7ZC 1K3BC 3CC4A 3ONAB 2KHSA 4R4QA 4OX9Q 1FJGL 3S14B 1CSPA 3QWPA 1H9RA 4BA2I 1XNRQ 5FLXE 4HR7B 5I2XA 3HOWH 4QJFA 2PZTA 4A3BG 4YHHQ 2A74C 3HFZB 3SDJA 3J81E 3P20A 3I4NH 1EQVA 1RTNA 2JW6A 4DR6L 1GXDC 1T5EA 3V2TA 1OMTA 3QG1A 3TRZA 4A3CH 4UXJA 1TKWB 1X3FA 1EQTA 2R61A 4JV5L 1CSOI 4HIKA 2F0JA 1C4QA 3TZDA 1VQGA 1BDOA 2WIIB 5EPJA 1S5FD 3UEJA 2L8EA 1KL9A 4G7ZC 2L4NA 1EY9A 1B53A 3SEBA 1H9KA 3AQQA 3FDTA 3DHQA 3FPUB 4YIJA 4JI1Q 4QUCA 2M2LA 2DNEA 3CHBD 4GN5A 4OWTB 2A68C 4B3TQ 1EOVA 3I55A 2XRSD 3HOVB 1TWFH 1RTOA 1DJRD 4DUYL 4OL7A 1HNZL 4H13C 2B2UA 2B8TA 5C6AA 4I7ZC 2QQCA 2GKRI 1D5XC 2DY7A 5KNDA 4AQYL 5C4XG 1WTJA 2NZ1D 1LLRD 4P71A 1QE6A 1HZ9A 4A3KG 3GTPH 1WFQA 2F0MA 4CBVA 1D8LA 2KMRA 2BA1A 1J9OA 2PYKA 3UDGA 4IZ8A 5LL6S 1LACA 1SJHD 2NTTA 2SGQI 2OVOA 3VYRA 1GD7A 3DWAA 2MNAA 3HG9A 4KJNA 2QQEA 1T5XD 1WCMH 3GTKB 4J6HA 1JICA 4DAVA 2CWHA 2F3IA 1XMQQ 2SGEI 3S2DH 1XYIA 5ISRA 2JB1A 5K5PA 4OXPA 1HR0L 1B50A 1I50H 2EVBA 3K80C 1TWFB 1ENFA 3AFQA 1A63A 1SLJA 1EYAA 1YJWA 4NXNL 3R8BA 4A93H 4R4CA 3QOLA 1Q86C 3IAS1 2F0LA 5EJWA 2E2JH 3MXNB 4OVOA 4QUFA 4OWXB 5M5YH 3NELA 4IOAA 2ZXRA 3T16A 5IP7G 1BQQT 4G7OC 4L8JA 1L0XB 2WV6D 4K5WA 2NYZD 4GOPA 3FVQA 3G71A 2FEFA 4BBSH 1YNNC 4C3JB 3TEHB 2X52A 1CFMA 4A3GB 1WYDA 4FXKC 4IQZA 3FNBA 4HEDA 1IKMA 3VYSA 4JI7L 5IYCH 2B2YA 2PQ8A 4RCNA 4CDDC 2E5LL 1IKLA 1X74A 1JQOA 4CHTB 4C56C 1A8VA 3J81c 3KK7A 2DNCA 3TREA 1KAWA 2GIVA 2Y0SG 1EYCA 2NUCA 1E2ZA 2EYFA 1CA6A 4UHVA 1BXTA 5JEAH 2EYLA 1J5EL 2EYOA 2B63H 1KABA 1BMOA 1HJPA 2QILA 1E1OA 1ZEQX 3BDLA 3MVVA 1SNDA 4AIMA 2UU9Q 1SBBB 1YNXA 1NMGA 1EZ6A 4CKBA 2ZW3A 3KYHC 4TRDA 1QOHA 3S16B 4WORA 2VB2X 4LFAQ 2A1AA 2LY7A 2K7VA 1SEBD 2A6HD 4ZQ3A 4APVA 4DV4L 1BF4A 2F0TA 1G6ZA 2UXCQ 5EPLA 2R93H 4X6AH 2CJSC 4N9PA 4OONA 2RDFA 3STBD 3K8AA 3PUZA 1MJAA 2CW0D 2QEXA 4L5TA 4JI3Q 2ARPF 1EWHA 1F2LA 2AMCB 2KVMA 2RQXA 2I5LX 2IL8A 1ICWA 1JWSD 1P9ZA 1NNXA 1NR2A 1U4RA 2NU4I 1FYBA 3R5BA 3RLNA 1Q90A 3QIAA 2CVRA 4JC0A 2K05A 1QB5D 4BBRB 3SGIA 1WTXA 2QQDA 4X64L 2VY3A 4IN3A 4GLAC 4KN7C 3J7A5 5AFWA 3K0XA 1ENAA 1UWVA 2LXJA 1N32Q 1ZYRD 2FUG1 2HHHQ 4UY8C 1PZID 3JAMi 1CKNA 3MXPA 4QL5A 3CMEA 1EY4A 1A6XA 3S1QH 2G5DA 4I7AA 1GUSA 2QGMA 1F2YA 3J7AV 3PMFA 4LUZA 4MNOA 1TIID 2QW7A 2EY5A 4A3FH 3AMUA 1V1PB 4C1NK 2K5NA 4GNXB 2HD3A 4C3HG 3TZUA 4FXDA 4N8X1 1PH1A 1CSQA 1EL0A 2F0NA 5C5MA 1STNA 3TP5A 4U673 2R7ZG 1F2MA 3JAML 3UGDA 5C0XG 2RDGA 3I72A 4L9MA 3HOUG 1PDQA 1V1PA 1LTBD 1EIYB 4GXTA 4DR5Q 2RIJA 2NVQB 1BUSA 3M7GA 1E0BA 3I2ZA 3A54A 1AN1I 1TS3A 2FHTA 2JAEA 1S5DD 1ASYA 1BBWA 1PRTF 5LHY1 1MJEA 3UE0A 1EIHA 3DLLA 3CCJA 2JK8A 1BR9A 1D5MC 4GKKL 3SGBI 1HA6A 1TWHH 4XT3B 3SHLA 4LMQD 4JI8L 3HOZG 2YFAA 1CTMA 3A8JE 3ITPA 1TURA 1SE4A 2IJ0A 4KD3A 4N9TA 2UUCQ 2OF1A 4NV2A 1ZKOA 2ZXOA 4WP4A 2WINB 1FL0A 2SOBA 3VA5A 2OT2A 3KBXA 1PYBA 4K6DA 1K83H 2OCEA 3BDCA 5J8CA 3T56B 1SGRI 2RA4A 5FO8B 2B3GA 1CK1A 1S20A 2NU1I 2B0UC 2PW7A 4POGA 3J80L 3D0FA 2WACA 4DA2A 4DXGA 3DEOA 2WKCA 1XTDA 3TDQA 3KJPA 1J8IA 3S1RH 1QVCA 3C1EA 2NVYH 3CCEA 1I4PA 2JXMB 4GS3A 1GUNA 3I8ZA 4GKJQ 1CQVA 2EXDA 5A2QL 1PFNA 3EFXD 2B63G 1B3QA 1XX8A 2VQEL 3U9SA 2N71A 3STBC 5HY6A 1SYGA 1VQLA 1WJJA 4YY3Q 1GVPA 2PZWA 4QY7A 4DNCA 1SRUA 3J80i 1XJVA 1ICFB 2K4KA 2Q8IB 1S40A 2YFBA 3KF6A 1PA6A 1I3QH 1S5ED 1Z47A 1PTRA 1F9RA 5LMNW 1G2SA 1Q1BA 1FGUA 5M5YB 2L5TA 3D4DA 2RIOA 4P75A 1UUCA 3PGZA 2E2DC 2E5LQ 1VDZA 1Y1VG 5GAEC 4H02A 2XGTA 3VR5A 4C1NI 3S1NB 4DV1Q 4JI5Q 5JJLA 2F0DA 4A3JH 3HEJA 5C3XA 4IFDJ 2B2VA 1P16A 2HIXA 3OL0A 1HJAI 1H9SB 4KLKA 1PH2A 4G75A 4YZDA 1BCPD 2K19A 1LT6D 2Z6KC 1A3UA 1JJCB 3K81C 4KK7A 3GTLB 2LMCB 3U9OA 2L9HA 4TVAB 4B3RQ 5DM73 4JI3L 5AJ3L 4PQXA 2E74C 2K5DA 4HFVA 3I7FA 2Q2IA 4K2LA 4E1PA 4A3FB 4JVZA 2F0EA 4YZCA 4DR7Q 3TO6A 4XQNA 3F1ZA 3HKSA 3HKZE 2V6EA 3RN2A 3MAQA 2R92B 1I6HB 3TN2A 1XNRL 3DEPA 1NUBA 1TS5A 1WTOA 1PMRA 1PTOH 2K01A 4FNFA 5C4XH 4P73A 3OSOA 4RMFA 3SXHA 3HZXA 3M9BA 3VA7A 1IHZA 1Q46A 4BBRG 2B2WC 3CRKC 1UNSA 9WGAA 1KLGD 2AQ3B 2B2YC 4HJ8A 4IPCA 2Q8RE 1HXYD 2AHOB 4KMUC 4NB3A 3T53B 1SE3A 1HNWL 2KQ3A 2F0PA 1CI3M 1PLFA 4B3TL 2M00A 1MGSA 4A3JG 3MFGA 5EKKA 1PTOF 2R92H 3PO3B 4DAYB 1EY8A 4C3HB 2R7FA 3I4MH 2WP8J 2WFWA 4K5VA 1PPFI 1U4PA 3KP9A 4FP5D 3I4NG 4EQ5A 1XBTA 2OEOA 4JBJA 3BZKA 2WCYA 3WOEA 2QSBA 2V1CC 1CKMA 1X55A 4GOPB 1ESRA 3GTMB 1KXLA 2P6AC 2FMMA 3PV0A 4LF4L 3BVGA 1L1OB 3KF8B 3E59A 1HUNA 4DAMA 3W1BA 4Q5VA 4EQOA 2IX0A 2CFMA 4ODGA 3RLFA 3A5ZB 4IFDI 2DKVA 3UEYA 1RJTA 3NTKA 1K7UA 1EY5A 4EX5A 3UGIA 1FGBD 3S24A 3ZYYX 1WKXA 1CGII 1M8AA 4TQUS 5ELBA 1Q81C 1FNWA 5M5XH 3TP6A 4IUQA 1G51A 3NQIA 2XRQD 3K7AB 1HNXL 2D0PA 1PVOA 1HNXQ 2KHJA 3T4AC 1UVGA 2XRCA 4LF5L 1M1KC 1XWEA 3Q0AA 5CV8A 1HFNA 2A69C 5M3FB 2Z6KA 2ENZA 4J1MA 1PHJA 1MT1A 3L0OA 1KBEA 2RCNA 5CC4A 4YCWA 4YY3L 2QDLA 2KBNA 2ENBA 3VYUA 4O1PA 3S16H 3W2DA 1D7QA 3IFDA 3BS1A 4DV6L 2V1CA 2UU9L 3PDNA 1KRSA 3BVZA 2B8GA 4IURA 5G3LD 3SR1A 1QJOA 4KD4A 5C3EG 3J81L 2YYZA 1YEZA 4JBWA 4A3EH 1SGEI 1NAPA 1TU2B 5E4XA 5EGTA 3J80E 2Q2UA 3M7NA 2JXDA 3P75A 5CV6A 5D3IB 1VQAA 1YO7A 5AJ3Q 1Q82C 3A7LA 1JR0D 3GD7A 2KHIA 4B3ML 1N34L 3PIP3 4HJ7A 3AEVA 1GHKA 2SGDI 1AZPA 1W2BA 3R5CA 2RVLA 2GVIA 1DOKA 4ZUJA 2DJGC 1KIXA 4UAIA 3EN2A 3FSXA 1N33L 2K5QA 3IAYA 1XPUA 1Q1EA 2B2WA 1RHPA 3CQZH 2Q2TA 1QVFA 5CV5A 2ICIA 3NXWA 3D4WA 3H09A 3OXFA 3DXJC 2EY2A 1A0IA 4YWMA 3TMEA 5IYDG 4R4IA 4DAYA 4AH6A 5FUXA 4CDFC 1VQOA 5IGEA 5EAYA 1Q8IA 5IT9E 3PIPA 4HMIA 1JB7A 1VCIA 1N36L 4Z7HA 3GTJH 1AP0A 4PMBA 1YNJC 5GROA 1ULMA 1LO5D 5FJ8G 1R9TH 1D2BA 4HCSA 2UXBL 1L0YB 3PIOA 5ELCA 3G6EA 3ND9A 2SGPI 1ML0D 3DWQA 3P1HA 4E6IA 2A6EC 4K8IA 2DY8A 3OOCA 2EYPA 4MTKA 4XXEA 1H0ZA 1JJGA 1I4RA 5KRUA 2CWFA 5HQ8A 2DJFC 2R92G 1I4XA 1W6KA 4A3DB 1XX6A 2B2VC 3EROA 1TUSA 2PNRC 2CCZA 1F9QA 4R4TA 3JAMc 1ASZA 4MPIA 3GTGB 1E24A 1B7YB 1XTCD 1ILPA 1NJIC 5ELFA 2J4XA 2E8GA 1LTRD 5NUCA 4LNQA 3PSIA 4MIUA 5C44G 2ATWA 1IXRA 1CKOA 2JA9A 4KHPQ 2JBWA 1Z7TA 2UUBQ 5FUYA 5LNK1 2J0TD 2KCCA 4Y7NH 2LUYA 3D31A 1MBYA 4HTHA 1WTQA 1Y69U 1CT4I 5I4DA 1GO3E 4RGNA 1EUJA 3NQTA 3MEFA 3IRBA 5CBAE 3F2BA 2B8FA 4XQQA 3OXLA 1GUTA 2XWBB 1MHWC 4WJ3M 2N1AB 1U4MA 4HJAA 4MHEA 1QUQB 3CPWA 1KDAA 4DR3L 1Q8KA 2ORVA 1IW7D 1TDPA 4KJOA 1U5KA 1LTAD 4BBSG 4RWSC 3KY9A 3OIPA 2FINB 5DAEA 5FLXL 1TBOA 1F77A 5GADC 1OXVA 2IX1A 4KKSA 2I46A 5BR8Q 5M3MH 1BNZA 1MJ9A 1DS3I 1B8AA 1R79A 4G7HC 4B3SL 4ZUIA 2GN5A 2BDOA 1P8LA 4WRDA 5M5XB 2HCCA 2L1BA 4KN4C 1Z6HA 1EYDA 4CKCA 4EVOA 4TKOB 4FVMA 4Z9CB 3UITA 5IGFA 3MXGA 2K52A 5E1FA 2QDBA 2SGFI 2A68D 5GAHC 1ENCA 2K75A 3VDUA 1TWGH 1NE3A 2SDFA 3D6CA 3R5AA 3KLSX 2VQEQ 2L12A 3I9V1 2WB1G 2JA1A 2ORWA 1LT4D 4JYAQ 4OO1I 1FR3A 5HGIA 2KEEA 4C3JH 5M3MG 3VR2A 4XQJA 1JB3A 2IPKD 2Z8LA 3A55A 2F0FA 4DR1Q 3H0GG 2CKZB 4U68A 4JI2Q 5CV4A 1EWIA 5ELOA 4DR4L 1NUCA 1STAA 5IE8A 1M90C 4DV3Q 4DV3L 5JOBA 4XDXA 1W4RA 2F0VA 2PQAB 2K32A 4NXNQ 3OWFA 2QCPX 3T1HL 1H9SA 4XT1B 3A0JA 3BG3A 4K6LA 2R6GA 1SGYI 1LT3D 2A5HA 1XXGA 4HGUA 4LFBL 2K5WA 4AYBE 3OW2A 1B70B 1HCZA 1NCVA 1I50B 1X3EA 4B9XA 1AZQA 4JG2A 1B9MA 4JYAL 1RODA 3DMUA 1O7LA 1UHAA 5C44H 5CCMA 1KNAA 1TVXA 2OXPA 2EYHA 1I94L 2D5DA 5JHWC 1M4VA 3RMHA 3C3LA 4N8FA 1I4HA 2F4IA 3GDEA 4OAVB 1C7YA 2N78A 4B3RL 3TQYA 1GJXA 1EY0A 2QZGA 5BN5A 3HH2C 5J8FA 2C35B 4IJHA 1CM9A 4BS9A 1AFPA 2WKDA 2FU2A 1OXXK 2F0KA 5KNCA 4QGUA 2RLDA 3J81j 5FUWA 4HJ9A 4DV7Q 4L6TB 2E5RA 1EWCA 3PQIA 1LM0A 2ZTEA 3X3NA 1PH7A 3D8GA 3AB9A 3S9WA 5FKAC 5J22A 4ZAIA 2K5HA 3K5LA 3L3OC 3PO3H 2NWGA 2HDLA 1I5FA 3ND8A 3U4VA 2XTIA 4QCLA 2ZJRA
chains in the Genus database with same CATH topology
4DV0L 2WB1E 2B0UC 4DK3C 1KD1C 1VQ5A 2OD1A 4POGA 1SJ8A 4NV5A 3TS2A 3D0FA 1OYVI 4C2MH 5GAGC 5LMUL 4OO1G 4GN4B 4LWCA 4JI4Q 1CUKA 2YV5A 3HOUH 2QA4A 1XTDA 1MKHA 3KJPA 3S1RH 1QVCA 4O2DA 1NTGA 2NVYH 4DV5Q 3CCEA 1BBUA 1BKBA 3CP0A 2ASBA 4GS3A 3HOWG 3PO3G 4DV7L 4LF5Q 2LSSA 1N8RC 1CT0I 1XMOL 1LYLA 4GKJQ 3FKIG 3UDIA 1V43A 2EXDA 2B63G 1PJUA 2KCXA 2NU0I 4UP8A 1QZGA 4B6DA 2VQEL 4BXXH 3PUXA 4LF7L 2N71A 5IWAQ 3PO2H 3STBC 2QQDA 2KMOA 5HY6A 3SEKC 1RIPA 1VQLA 4LF6Q 3T1YQ 1WJJA 5CCLA 2CWPA 4YY3Q 1GVPA 2YUUA 4QY7A 2LEOA 1SRUA 3J80i 1PH8A 4OWWB 4HEA1 1X9NA 1XJVA 2K4KA 1QUQA 4YWKA 3FP9A 5ELNA 3PUYA 2YFBA 2NN6I 4R1JA 1S40A 2VUMG 1SGPI 3NEMA 1X65A 3KF6A 2VQFQ 1PA6A 1I3QH 4L5SA 1Z47A 1PTRA 4I1TA 3CCSA 1PFSA 1I6HH 5LMNW 5LMUQ 3OTOQ 5M3FH 4A3MG 2UUAL 3HOYG 1Q1BA 4ALPA 2VNUD 4OVOA 1FGUA 2RIOA 4P75A 2HT1A 2NU3I 1UUCA 3PGZA 2F4VQ 2E5LQ 1X56A 1Y1VG 5GAEC 1JMCA 4DV5L 3HOVG 3PUWA 1EFWA 4H02A 3CMAA 4A3EG 4MZ9A 2XGTA 1PH4A 3CD6A 2Q2HA 4A3DH 4LFBQ 1Y8FA 2YTYA 5DLQE 2OQ0A 3EIVA 4DV1Q 4JI5Q 1KC8C 5JJLA 2MFIA 1AH9A 1GM5A 3OXGA 1J6QA 4A3BH 3W1GA 4A3JH 2JE6I 4HJ5A 3CCQA 1XPRA 2BH8A 4IFDJ 2UUBL 1N13A 3BZCA 4O0AA 2ELIA 4YCUA 1MIUA 1P16A 2HIXA 2IHFA 3OL0A 3EBEA 4O1OA 3F2CA 2E2HH 4LF9L 1HJAI 2GKTI 4X65L 3KFUA 4KLKA 1PH2A 1VQCA 4G75A 4YZDA 1VQ9A 4GLVB 3RR5A 3GOXA 2PI2A 2ID0A 2K19A 2JQOA 3E2IA 2Z6KC 4GNXA 3AFPA 1JJCB 3JC66 3K81C 1YBYA 1CE3A 1U0LA 2ZM6Q 1TBNA 2W0TA 2PNHA 5IT9c 1YITA 4K0KL 1HDLA 4FDBA 3I4MG 1IW4A 4G76A 1OXTA 4TVAB 1Y1WH 1YJ9A 4JI3L 5AJ3L 4B3RQ 1LR7A 1VDDA 2ZJQA 4Y52H 3I56A 4HFVA 3I7FA 3U58A 4JBKA 2Q2IA 1JJ2A 4NPSA 1X54A 4E1PA 2RF4A 2HIVA 4YZCA 4DR7Q 4L5RC 4E1RA 2N8NA 4JI5L 4X66Q 1IBKQ 3F1ZA 2DB6A 1X3GA 3HKSA 2A20A 4J15A 4IPGA 3HKZE 2V6EA 4DV6Q 3RN2A 1XMQL 2OTLA 1EYGA 1LR9A 3BJUA 3PCOB 4L5QA 1TBQR 4LF8L 4X65Q 2V53A 1OMUA 1QZHA 4LF9Q 2IP6A 1LTLA 1UEBA 4QIWE 1XNRL 4KHPL 1L1OA 3HOXG 4BY7G 1NUBA 2Y0SE 1V1QA 2I5MX 1T9HA 2I0QA 2UXCL 3D00A 1G291 1OVOA 4DR1L 4DKAC 2NVQH 5C4XH 4UP7A 1K73C 2A2CA 2EQSA 4PL4A 4P73A 4BBRH 4GNXC 1SROA 3CAMA 1VQBA 3NBHB 4RMFA 3M9BA 3ULPA 1XNQL 4DR2Q 1X6OA 1Q46A 2OQKA 4BBRG 2YTXA 4Z7GA 3A74A 2F4VL 2XMXA 3F2DA 1YHAA 2RHSB 1YTPA 3HOXH 3J80c 4HJ8A 5C0XJ 4DUZL 4IPCA 4DV1L 2JA8H 1XA6A 2L1LB 3GTMH 2H5XA 4DPGA 3PUVA 5IP7H 4X66L 3G4SA 3S2HH 1IY5A 3UE1A 3B4VC 2AHOB 1E7ZA 5H1SE 4NB3A 2UXDL 3M4PA 3RN5A 3FKIH 4GOPC 1VQJA 4B3SQ 3M85A 4YCVA 1KHIA 2F52A 4LF8Q 2K5VA 1HNWL 4AS2A 3L0IA 4B3TL 1YU6C 4WJ4A 1K8GA 3IAM1 4A3JG 5FLXc 3UFFA 2R92H 4NXMQ 1K9MC 1N32L 1PTQA 4NXML 1C9OA 1K0RA 4DAYB 3U4ZA 2VQFL 4AS3A 3F8TA 3H15A 2R7FA 1SMXA 3I4MH 2WP8J 4DR4Q 1FARA 3HOVH 2WFWA 1PPFI 5IYDH 3KP9A 3OTOL 2UUAQ 4EQ5A 3I4NG 1UE6A 4DR2L 1M8CA 5IYBH 1XBTA 1CGJI 3CXLA 2NZHA 5K36G 4JBJA 2KCTA 1VQDA 1OXSC 3BZKA 2V1CC 1CKMA 1L2FA 2BA0A 2D62A 2WAQG 3KOJA 3CCMA 1X55A 2MO0A 4GOPB 4HIMA 4JI6L 3PF4A 1KXLA 2P6AC 3PV0A 1FAQA 4IPDA 4LF4L 1L1OB 3KF8B 3E59A 2OWOA 4DAMA 4SGBI 2JYYA 4PZ7A 3W1BA 1BVSA 5IY0A 2UUCL 1SGQI 4YWLA 3S15H 2J87A 1TXYA 2CFMA 2IX0A 1VQMA 1Q7YC 1IY6A 2MJFB 1M8BA 3K7AH 4LFCQ 1EQRA 2XTRA 1FJGQ 2NN6G 3A5ZB 4LFCL 3RLFA 3L2PA 4IFDI 3CF5A 3UEYA 5IP9G 2N49A 4A3DG 2CAZB 3FC3A 3M4OH 2A19A 4DNIA 4EX5A 2ZRRA 3UGIA 3VE5A 3DA4A 1Y1VH 1L0WA 3S24A 5C0XI 4HIDA 1IBLL 1CGII 3J7ZC 4DV0Q 2GVBA 3CPFA 4TQUS 4LUOA 1Q81C 5M5XH 2EIFA 3LJ0A 2R7DA 1G51A 4JOIA 3ULJA 1RFHA 4DV2L 1HNXL 2D0PA 1XNQQ 1PVOA 4DV2Q 1HNXQ 3PF5A 2NVTH 4K0KQ 1S72A 2F6MB 4JCVE 2KHJA 2VL6A 2JA7G 4A75A 2IY5B 1UVGA 4A24A 1Z7KB 3S14H 2XRCA 4POFA 5C3EH 4LF5L 1M1KC 1CKNB 2E73A 5GQOA 3L7ZC 1YIJA 3CC4A 4A3GG 1TIHA 1DGSA 2Z6KA 2ENZA 2ODDA 4JI8Q 1PH5A 4A4IA 1PHJA 1MT1A 4R4QA 1YJNA 3L0OA 1VQ7A 1CSPA 4OX9Q 2RCNA 1FJGL 1KBEA 3QWPA 4YCWA 4YY3L 3FHWA 1IBKL 1XNRQ 5C4JH 3T1YL 4BA2I 2KBNA 4C3HH 3LJ2A 3S16H 4O1PA 5BR8L 1D7QA 3HOWH 4DV6L 4QJFA 2V1CA 2UU9L 4A3BG 3PDNA 1KRSA 4YHHQ 2I5HA 2QGQA 4A3FG 4A3IG 3HFZB 3TS0A 3SDJA 3ER0A 4A3CG 2PQAA 3GTKH 3VA9A 5C3EG 2YYZA 2SGEI 3I4NH 3SGBI 1YEZA 4JBWA 3CCRA 1YZ6A 3ULLA 4A3EH 1SGEI 2JW6A 2IT1A 4DR6L 2A2DA 3CC7A 2Q2UA 1OMTA 3TRZA 2AWOA 3M7NA 4A3CH 4UPAA 2JXDA 4A3IH 4UXJA 1VQAA 1YO7A 3KF6B 5AJ3Q 1X3FA 4JV5L 1Q82C 1CSOI 4HIKA 3T1HQ 1LR8A 1VQGA 3BU2A 3GD7A 3CCVA 3KDFB 2BH2A 2KHIA 4DR3Q 4B3ML 4UXIA 3UEJA 1VQFA 2L8EA 1KL9A 4IOCA 1N34L 2SGDI 4HJ7A 3AEVA 5FLMH 1SN8A 1VQ4A 3A5UA 4YZ9A 1OXUA 2NZOA 4HIOA 1HZAA 1W2BA 3E9IA 3AQQA 1CT2I 2UXDQ 2GVIA 4JI1Q 4GN5A 4OWTB 4RG1A 1KIXA 4BY1G 2ZTDA 3DM3A 3EN2A 4B3TQ 1EOVA 3I55A 5EX3A 3HOZH 1N33L 1XPUA 1Q1EA 2ROWA 1IZ6A 1TWFH 1IBML 1IBLQ 3HOYH 3NENA 3UGLA 2MQHA 4DUYL 3CQZH 1HNZL 1CHOI 2Q2TA 5FUVA 2B8TA 2PMZE 1QVFA 4PZ6A 1HZBA 1AE2A 2JB2A 1HR0Q 2QQCA 2GKRI 4AQYL 4P74A 5C4XG 1W3SA 4ME3A 3BJIA 3OXFA 3U50C 3GTGH 4P71A 5J3BA 1HZ9A 4A3KG 1A0IA 3GTPH 4YWMA 1WFQA 5IYDG 3CCUA 4R4IA 1VQ8A 2KMQA 1D8LA 1PV4A 2KMRA 4AH6A 2BA1A 4OAUC 4PMWA 4IPHA 2L7XA 5FUXA 3UDGA 1TWAH 2F66B 5IP9H 1VQOA 2B29A 5EAYA 1KRTA 4JOIC 3AJFA 3PIPA 2N52A 1JB7A 1VCIA 3ERSX 2SGQI 1HZCA 1N36L 4Z7HA 2OVOA 2ZJPA 2KENA 5LMNQ 1GD7A 2R7ZH 4PG3A 3GTJH 2KKMA 5GROA 2MNAA 3JSBA 3CCLA 2WCYA 5FJ8G 1R9TH 3GTLH 2QQEA 5JEAG 1WCMH 3TJQA 2JA5G 2UXBL 2UXBQ 5HGQA 3PIOA 2F3IA 1KBFA 4PZ8A 1XMQQ 3G6EA 3S2DH 1IBMQ 4A3GH 1K8AC 3ICEA 2SGPI 2JB1A 4YHHL 1SGDI 1Y1BA 4OXPA 2AWNA 1Q12A 3E9HA 1HR0L 1VQKA 2JEAI 3HKZG 1FVIA 4Q9VA 1I50H 3K80C 1H0ZA 1SR3A 1JJGA 3AFQA 1A63A 2JA6H 1SLJA 2XTQA 5HQ8A 1Y1CA 1YJWA 4FKDA 1E3PA 2GKVA 2R92G 3RU0A 4NXNL 4JI6Q 4A93H 2Z0SA 4R4CA 2JB3A 1N9WA 2CWAA 1PCEA 3RNUA 1Q86C 1XX6A 4A3LH 1TUSA 2CQOA 2PI2E 3OYYA 4KI0A 4PL3A 2CCZA 1OTCA 4R4TA 3IAS1 3JAMc 1ASZA 2QQ0A 1Y14B 1O7IA 3LGJA 2E2JH 4P72A 1E24A 3MXNB 3FBVA 1N34Q 4OWXB 5M5YH 3LJ1A 1YVCA 3NELA 4LW1A 1B7YB 4IOAA 4GKJL 2VRWB 5IP7G 1NJIC 2E8GA 2D0OA 4LNQA 2JA8G 2M5XA 3PSIA 4IO9A 1EIFA 1RL2A 5C44G 2ATWA 1IXRA 1CKOA 1GKHA 1LUZA 2JA9A 3W5OA 1YI2A 4KHPQ 3SGQI 1HR0W 3VDPA 1A62A 1VQPA 3HH2C 2JA1A 4GOPA 2UUBQ 3G71A 5LNK1 2NVXH 3CC2A 4BBSH 4AYBG 4DUYQ 4A3LG 5FUYA 1VS0A 1PH6A 3TEHB 1NY4A 1HH2P 4Y7NH 1WYDA 1V1HA 3D31A 1CT4I 2LUYA 2VS1A 1GO3E 4XIGS 1EQQA 1EUJA 4JI7L 3MEFA 3IRBA 5JEAJ 4X62L 3F2BA 5IYCH 2DUDA 5IYBG 1M90C 4JI7Q 1VQ6A 3OXLA 2E5LL 3H3VH 1SGNI 1X74A 2NU1I 3QTLD 4WJ3M 2N1AB 3J81c 1A8VA 1TGSI 4HJAA 3TREA 1KAWA 1QUQB 3CPWA 4DR3L 2Y0SG 4B3MQ 3M3YH 1Q8KA 4KHZA 2ORVA 1X4SA 2L15A 4QQBX 5HI7A 1J5EL 1U5KA 1N36Q 1J5EQ 2B63H 4BBSG 1BMOA 2YQPA 3KY9A 1HJPA 1E1OA 2AKWB 5DAEA 2N3SA 1L1OC 2JZMA 3KDFA 4AIMA 5GADC 2UU9Q 1OXVA 4JI0L 1YNXA 1NMGA 2JEBI 2IX1A 5BR8Q 5M3MH 3KYHC 1DS3I 1B8AA 1R79A 4B3SL 1HNWQ 3RZOH 4UXHA 2GN5A 4LFAQ 2A1AA 1P8LA 1TWCH 2HHHL 1N33Q 2OTJA 4APVA 4DV4L 1XPOA 4DV4Q 4GI3C 2BUSA 2UXCQ 3UITA 4IJLA 5IYCG 2R93H 2K52A 3WWVA 4X6AH 1TOTA 2CJSC 4OONA 2SGFI 1Z9FA 5GAHC 2K75A 2J9RA 3VDUA 1TWGH 1NE3A 3STBD 3K8AA 3GTOH 3PUZA 1SE8A 4JI4L 2QEXA 4L5TA 4JI3Q 1V9PA 2JA6G 2A8VA 2ARPF 4DUZQ 2LXKA 1UE5A 2AMCB 4GKKQ 2R93G 2HQLA 2I5LX 3DA3A 1NMFA 1PH9A 3GO5A 3RZDH 2VQEQ 2GVAA 1JT8A 4DR7L 1SFOH 2NU4I 2ERWA 3F4MA 1FYBA 3DO9A 2VZAA 3I9V1 4DWLA 2WB1G 4JC0A 3P23A 2FXQA 4XTCS 3RLNA 5E7NA 4OX9L 2ORWA 3MEKA 4JYAQ 2IHEA 3SGIA 4BA1I 5HGIA 4C3JH 2VY3A 5M3MG 4GLAC 4X64L 1PH3A 2JA5H 3J7A5 3K0XA 1UWVA 2LXJA 4DR1Q 4U6RA 3H0GG 1N32Q 1I94Q 2FUG1 2CKZB 2E2IH 2HHHQ 4UY8C 3VDYA 4JI2Q 2JJQA 5M5WH 1EWIA 3E0EA 5ELOA 3ZJYC 4DR4L 4A93G 5IE8A 3JAMi 1K3RA 5M3FG 3G48A 4A3MH 1CKNA 1UE7A 4QL5A 4DK6C 3CMEA 4DV3Q 4DV3L 3H3VI 2K50A 3M4QA 3S1QH 1Y1WG 3CXCA 2MO1A 3S17H 4IFDG 1R0RI 1W4RA 3S1MH 4A76A 2P22B 2PQAB 4LUZA 4MNOA 4NXNQ 4JBMA 5EX0A 3T1HL 4UP9A 4A3FH 3A0JA 2R6GA 1SGYI 1WI5A 2K5NA 2NU2I 1QVGA 4GLXA 4GNXB 5JJIA 1KMAA 2ZTCA 4HGUA 2YU9H 3I4OA 2K14A 4LFBL 1WCMG 3UDXA 5LMNL 4AYBE 3B6YA 3OW2A 1YHQA 1B70B 1TBRR 1X3EA 4R4OA 2WAQE 5FJ8H 1PH1A 1CSQA 2ALYB 4JI1L 4JG2A 4X64Q 1VQIA 5IWAL 4JYAL 2R7ZG 4LF7Q 4BY7H 3UGDA 1YHBA 3K7UC 1MJCA 3J81i 4BY1H 5C0XG 4LUVA 5C44H 4L9MA 1V1IA 5CCMA 4JI2L 3HOUG 1HNZQ 1I94L 4GXTA 4PL5A 1AE3A 4DR5Q 1EIYB 1HPTA 5JHWC 5FLMG 1BUSA 1VQHA 2JA7H 1VQNA 3GDEA 3I2ZA 4OAVB 3AYHB 4A3KH 1C7YA 2KMPA 1S3OA 3UDFA 1C0AA 2N78A 4B3RL 1ASYA 2JAEA 3TQYA 4X62Q 1H95A 1AN1I 2QPOA 1BBWA 1NBWA 1E1TA 3KJOA 2ZM6L 2ES2A 1WOCA 2C35B 4IJHA 3S1NH 1G6PA 1MJEA 3UE0A 2K9HA 1IYJB 1E22A 2RHQB 3H0GH 3DLLA 3CCJA 2VUMH 4C3IH 2DGYA 1OXXK 1UE1A 2JK8A 4QGUA 3GTQH 4GKKL 4LF4Q 2WVJA 1TWHH 3J81j 3HOZG 1DS2I 4JI8L 4OO1I 1TBOA 4JV5Q 2YFAA 3OVOA 5FUWA 1XMOQ 2ENNA 4HJ9A 1TURA 4DV7Q 2KCMA 3CW2C 1PYSB 1KQSA 2UUCQ 2E5RA 2UZ3A 4JI0Q 1LM0A 2ZTEA 3PO2G 4NV2A 4BXXG 1PH7A 2F3CI 1FL0A 1VQEA 1IL2A 4GN3B 2VW9A 1JE5A 4LF6L 3KLWA 1PYBA 2K5HA 4LFAL 1K83H 2OCEA 4DR5L 3PO3H 4MTNA 2N17A 1I5FA 4AQYQ 1SGRI 1UVFA 5JJKA 2FNFX 3U4VA 4DR6Q 2XTIA 2B3GA 3Q8DA 2YTVA 2DIPA 3RLOA 2ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 L;  2WB1 E;  4DK3 C;  1KD1 C;  1VQ5 A;  4POG A;  3TS2 A;  3D0F A;  4C2M H;  5GAG C;  5LMU L;  4OO1 G;  4GN4 B;  4LWC A;  4JI4 Q;  1CUK A;  2YV5 A;  3HOU H;  2QA4 A;  1XTD A;  1MKH A;  3KJP A;  3S1R H;  1QVC A;  4O2D A;  1NTG A;  2NVY H;  4DV5 Q;  3CCE A;  1BBU A;  1BKB A;  3CP0 A;  2ASB A;  4GS3 A;  3HOW G;  3PO3 G;  4DV7 L;  4LF5 Q;  2LSS A;  1N8R C;  1XMO L;  1LYL A;  4GKJ Q;  3FKI G;  3UDI A;  1V43 A;  2EXD A;  2B63 G;  4UP8 A;  1QZG A;  2VQE L;  4BXX H;  3PUX A;  4LF7 L;  5IWA Q;  3PO2 H;  3STB C;  5HY6 A;  1RIP A;  1VQL A;  4LF6 Q;  3T1Y Q;  1WJJ A;  2CWP A;  4YY3 Q;  1GVP A;  4QY7 A;  1SRU A;  3J80 i;  1PH8 A;  4OWW B;  1X9N A;  1XJV A;  2K4K A;  1QUQ A;  4YWK A;  3FP9 A;  5ELN A;  3PUY A;  2NN6 I;  4R1J A;  1S40 A;  2VUM G;  3NEM A;  1X65 A;  3KF6 A;  2VQF Q;  1PA6 A;  1I3Q H;  4L5S A;  1Z47 A;  3CCS A;  1PFS A;  1I6H H;  5LMN W;  5LMU Q;  3OTO Q;  5M3F H;  4A3M G;  2UUA L;  3HOY G;  1Q1B A;  4ALP A;  2VNU D;  1FGU A;  4P75 A;  2HT1 A;  3PGZ A;  2F4V Q;  2E5L Q;  1X56 A;  1Y1V G;  5GAE C;  1JMC A;  4DV5 L;  3HOV G;  3PUW A;  1EFW A;  4H02 A;  3CMA A;  4A3E G;  4MZ9 A;  2XGT A;  1PH4 A;  3CD6 A;  2Q2H A;  4A3D H;  4LFB Q;  2YTY A;  5DLQ E;  2OQ0 A;  3EIV A;  4DV1 Q;  4JI5 Q;  1KC8 C;  5JJL A;  2MFI A;  1AH9 A;  1GM5 A;  1J6Q A;  4A3B H;  3W1G A;  4A3J H;  2JE6 I;  4HJ5 A;  3CCQ A;  1XPR A;  2BH8 A;  4IFD J;  2UUB L;  3BZC A;  4O0A A;  4YCU A;  1MIU A;  1P16 A;  2HIX A;  2IHF A;  3EBE A;  2E2H H;  3F2C A;  4LF9 L;  4X65 L;  3KFU A;  4KLK A;  1PH2 A;  1VQC A;  1VQ9 A;  4GLV B;  3RR5 A;  2PI2 A;  2ID0 A;  2JQO A;  2Z6K C;  4GNX A;  3AFP A;  1JJC B;  3JC6 6;  3K81 C;  1YBY A;  1U0L A;  2ZM6 Q;  2PNH A;  5IT9 c;  1YIT A;  4K0K L;  4FDB A;  3I4M G;  1OXT A;  4TVA B;  1Y1W H;  1YJ9 A;  4JI3 L;  5AJ3 L;  4B3R Q;  2ZJQ A;  4Y52 H;  3I56 A;  3I7F A;  3U58 A;  4JBK A;  2Q2I A;  1JJ2 A;  4NPS A;  1X54 A;  2RF4 A;  2HIV A;  4DR7 Q;  4L5R C;  2N8N A;  4JI5 L;  4X66 Q;  1IBK Q;  3F1Z A;  1X3G A;  3HKS A;  4J15 A;  4IPG A;  3HKZ E;  4DV6 Q;  3RN2 A;  1XMQ L;  2OTL A;  1EYG A;  3BJU A;  3PCO B;  4L5Q A;  4LF8 L;  4X65 Q;  1QZH A;  4LF9 Q;  1LTL A;  1XNR L;  1UEB A;  4QIW E;  4KHP L;  1L1O A;  3HOX G;  4BY7 G;  2Y0S E;  1V1Q A;  2I5M X;  1T9H A;  2I0Q A;  2UXC L;  1G29 1;  4DR1 L;  4DKA C;  2NVQ H;  5C4X H;  4UP7 A;  1K73 C;  4P73 A;  2EQS A;  4BBR H;  4GNX C;  3ICE A;  4JV5 Q;  1SRO A;  3CAM A;  1VQB A;  3NBH B;  4RMF A;  3M9B A;  3ULP A;  1XNQ L;  4DR2 Q;  1X6O A;  1Q46 A;  2OQK A;  4BBR G;  2YTX A;  3A74 A;  2F4V L;  3F2D A;  1YHA A;  2RHS B;  3HOX H;  3J80 c;  4HJ8 A;  5C0X J;  4DUZ L;  4IPC A;  4DV1 L;  2JA8 H;  3GTM H;  2H5X A;  4DPG A;  3PUV A;  5IP7 H;  4X66 L;  3G4S A;  3S2H H;  3UE1 A;  2AHO B;  1E7Z A;  5H1S E;  4NB3 A;  2UXD L;  3M4P A;  3RN5 A;  3FKI H;  4GOP C;  1VQJ A;  4B3S Q;  3M85 A;  4YCV A;  1KHI A;  2F52 A;  4LF8 Q;  2K5V A;  1HNW L;  4B3T L;  4WJ4 A;  1K8G A;  4A3J G;  5FLX c;  2R92 H;  4NXM Q;  1K9M C;  1N32 L;  4NXM L;  1C9O A;  1K0R A;  4DAY B;  3U4Z A;  2VQF L;  3F8T A;  3H15 A;  2R7F A;  1SMX A;  3I4M H;  2WP8 J;  4DR4 Q;  3HOV H;  2WFW A;  5IYD H;  3OTO L;  2UUA Q;  3I4N G;  4EQ5 A;  1UE6 A;  4DR2 L;  5IYB H;  2NZH A;  5K36 G;  4JBJ A;  2KCT A;  1VQD A;  1OXS C;  3BZK A;  2V1C C;  1CKM A;  1L2F A;  2WAQ G;  2BA0 A;  2D62 A;  3KOJ A;  3CCM A;  1X55 A;  2MO0 A;  4GOP B;  4HIM A;  4JI6 L;  3PF4 A;  1KXL A;  3PV0 A;  4IPD A;  4LF4 L;  1L1O B;  3KF8 B;  2OWO A;  4DAM A;  4PZ7 A;  3W1B A;  1BVS A;  5IY0 A;  2UUC L;  4YWL A;  3S15 H;  1TXY A;  2CFM A;  2IX0 A;  1VQM A;  1Q7Y C;  3K7A H;  4LFC Q;  1EQR A;  1FJG Q;  2NN6 G;  3A5Z B;  4LFC L;  3RLF A;  3L2P A;  4IFD I;  3CF5 A;  5IP9 G;  2N49 A;  4A3D G;  3M4O H;  2A19 A;  4DNI A;  4EX5 A;  1IBL L;  1Y1V H;  1L0W A;  3S24 A;  5C0X I;  4HID A;  3J7Z C;  4DV0 Q;  2GVB A;  3CPF A;  4TQU S;  4LUO A;  1Q81 C;  5M5X H;  2EIF A;  2R7D A;  1G51 A;  4JOI A;  3ULJ A;  4DV2 L;  1HNX L;  2D0P A;  1XNQ Q;  1PVO A;  4DV2 Q;  1HNX Q;  3PF5 A;  2NVT H;  4K0K Q;  1S72 A;  2VL6 A;  4JCV E;  2KHJ A;  2JA7 G;  2IY5 B;  4A75 A;  3S14 H;  4POF A;  5C3E H;  4LF5 L;  1M1K C;  1CKN B;  5GQO A;  3L7Z C;  1YIJ A;  3CC4 A;  4A3G G;  1DGS A;  2Z6K A;  4JI8 Q;  1PH5 A;  4A4I A;  1PHJ A;  4R4Q A;  1YJN A;  3L0O A;  1VQ7 A;  1CSP A;  4OX9 Q;  2RCN A;  1FJG L;  4YCW A;  4YY3 L;  3FHW A;  1IBK L;  1XNR Q;  5C4J H;  3T1Y L;  4BA2 I;  2KBN A;  4C3H H;  3S16 H;  5BR8 L;  1D7Q A;  3HOW H;  4DV6 L;  4QJF A;  2UU9 L;  4A3B G;  1KRS A;  4YHH Q;  2I5H A;  2QGQ A;  4A3F G;  4A3I G;  3HFZ B;  3TS0 A;  3ER0 A;  4A3C G;  2PQA A;  3GTK H;  5C3E G;  2YYZ A;  3I4N H;  1YEZ A;  4JBW A;  3CCR A;  1YZ6 A;  3ULL A;  4A3E H;  2IT1 A;  4DR6 L;  3CC7 A;  2Q2U A;  3TRZ A;  2AWO A;  3M7N A;  4A3C H;  4UPA A;  4A3I H;  1VQA A;  3KF6 B;  5AJ3 Q;  1X3F A;  4JV5 L;  1Q82 C;  4HIK A;  3T1H Q;  1VQG A;  3BU2 A;  3GD7 A;  3CCV A;  3KDF B;  2BH2 A;  2KHI A;  4DR3 Q;  4B3M L;  1VQF A;  1KL9 A;  4IOC A;  1N34 L;  4HJ7 A;  3AEV A;  5FLM H;  1SN8 A;  1VQ4 A;  3A5U A;  1OXU A;  2NZO A;  4HIO A;  1W2B A;  1HZA A;  3E9I A;  3AQQ A;  2UXD Q;  4JI1 Q;  4GN5 A;  4OWT B;  4RG1 A;  1KIX A;  4BY1 G;  2ZTD A;  3DM3 A;  3EN2 A;  4B3T Q;  1EOV A;  3I55 A;  3HOZ H;  1N33 L;  1XPU A;  1Q1E A;  1IZ6 A;  1TWF H;  1IBM L;  1IBL Q;  3HOY H;  3NEN A;  2MQH A;  4DUY L;  3CQZ H;  1HNZ L;  2Q2T A;  2PMZ E;  1QVF A;  4PZ6 A;  1HZB A;  1AE2 A;  1HR0 Q;  4AQY L;  4P74 A;  5C4X G;  1W3S A;  4ME3 A;  3U50 C;  3GTG H;  4P71 A;  5J3B A;  1HZ9 A;  4A3K G;  1A0I A;  3GTP H;  4YWM A;  1WFQ A;  5IYD G;  3CCU A;  4R4I A;  1VQ8 A;  1D8L A;  1PV4 A;  4AH6 A;  2BA1 A;  4PMW A;  4IPH A;  3UDG A;  1TWA H;  1VQO A;  5IP9 H;  2B29 A;  5EAY A;  1KRT A;  4JOI C;  3PIP A;  1JB7 A;  3ERS X;  1VCI A;  1HZC A;  1N36 L;  2ZJP A;  2KEN A;  5LMN Q;  1GD7 A;  2R7Z H;  4PG3 A;  3GTJ H;  5GRO A;  2MNA A;  3CCL A;  5FJ8 G;  1R9T H;  3GTL H;  5JEA G;  1WCM H;  2JA5 G;  2UXB L;  2UXB Q;  5HGQ A;  3PIO A;  2F3I A;  4PZ8 A;  1XMQ Q;  3G6E A;  3S2D H;  1IBM Q;  4A3G H;  1K8A C;  4YHH L;  4OXP A;  2AWN A;  1Q12 A;  3E9H A;  1HR0 L;  1VQK A;  2JEA I;  3HKZ G;  1FVI A;  1I50 H;  3K80 C;  1SR3 A;  1JJG A;  3AFQ A;  1A63 A;  2JA6 H;  1SLJ A;  1YJW A;  1E3P A;  2R92 G;  4NXN L;  4JI6 Q;  4A93 H;  2Z0S A;  4R4C A;  1N9W A;  2CWA A;  3RNU A;  1Q86 C;  4A3L H;  2CQO A;  2PI2 E;  3OYY A;  4KI0 A;  2CCZ A;  1OTC A;  4R4T A;  3JAM c;  1ASZ A;  1Y14 B;  1O7I A;  3LGJ A;  2E2J H;  4P72 A;  1E24 A;  3MXN B;  4BY7 H;  1N34 Q;  4OWX B;  5M5Y H;  1YVC A;  3NEL A;  4LW1 A;  4IOA A;  1B7Y B;  4GKJ L;  5IP7 G;  1NJI C;  2D0O A;  2E8G A;  4LNQ A;  2JA8 G;  3PSI A;  4IO9 A;  1EIF A;  1RL2 A;  5C44 G;  2ATW A;  1IXR A;  1CKO A;  1GKH A;  1LUZ A;  2JA9 A;  3W5O A;  1YI2 A;  4KHP Q;  1HR0 W;  1A62 A;  1VQP A;  4GOP A;  2UUB Q;  3G71 A;  2NVX H;  3CC2 A;  4BBS H;  4AYB G;  4DUY Q;  4A3L G;  1VS0 A;  1PH6 A;  3TEH B;  1NY4 A;  1HH2 P;  4Y7N H;  1WYD A;  3D31 A;  2VS1 A;  1GO3 E;  4XIG S;  1EQQ A;  1EUJ A;  4JI7 L;  3MEF A;  3IRB A;  5JEA J;  4X62 L;  3F2B A;  5IYC H;  2DUD A;  5IYB G;  1M90 C;  4JI7 Q;  1VQ6 A;  2E5L L;  3H3V H;  4WJ3 M;  3J81 c;  1A8V A;  4HJA A;  3TRE A;  1KAW A;  1QUQ B;  3CPW A;  4DR3 L;  2Y0S G;  4B3M Q;  3M3Y H;  1Q8K A;  4KHZ A;  2L15 A;  4QQB X;  1J5E L;  1U5K A;  1N36 Q;  1J5E Q;  2B63 H;  4BBS G;  1HJP A;  1E1O A;  2AKW B;  2N3S A;  1L1O C;  3KDF A;  4AIM A;  5GAD C;  2UU9 Q;  1OXV A;  4JI0 L;  1YNX A;  1NMG A;  2JEB I;  2IX1 A;  5BR8 Q;  5M3M H;  3KYH C;  1B8A A;  4B3S L;  1HNW Q;  3RZO H;  2GN5 A;  4LFA Q;  2A1A A;  1P8L A;  1TWC H;  2HHH L;  1N33 Q;  2OTJ A;  4APV A;  4DV4 L;  1XPO A;  4DV4 Q;  2UXC Q;  4IJL A;  5IYC G;  2R93 H;  4X6A H;  2K52 A;  3WWV A;  4OON A;  1Z9F A;  5GAH C;  2K75 A;  1TWG H;  1NE3 A;  3STB D;  3K8A A;  3GTO H;  3PUZ A;  1SE8 A;  4JI4 L;  2QEX A;  4L5T A;  4JI3 Q;  1V9P A;  2JA6 G;  2A8V A;  4DUZ Q;  2LXK A;  1UE5 A;  2AMC B;  4GKK Q;  2R93 G;  2HQL A;  2I5L X;  1NMF A;  1PH9 A;  3GO5 A;  3RZD H;  2VQE Q;  2GVA A;  1JT8 A;  4DR7 L;  1SFO H;  2VZA A;  3RLN A;  2WB1 G;  4JC0 A;  4XTC S;  4OX9 L;  2FXQ A;  5E7N A;  4JYA Q;  2IHE A;  3SGI A;  4BA1 I;  4C3J H;  5M3M G;  2VY3 A;  4X64 L;  4GLA C;  1PH3 A;  2JA5 H;  3J7A 5;  3K0X A;  1UWV A;  2LXJ A;  4DR1 Q;  1N32 Q;  3H0G G;  1I94 Q;  2CKZ B;  2E2I H;  2HHH Q;  4UY8 C;  3VDY A;  4JI2 Q;  2JJQ A;  5M5W H;  1EWI A;  3E0E A;  5ELO A;  3ZJY C;  4DR4 L;  4A93 G;  5IE8 A;  3JAM i;  1K3R A;  5M3F G;  3G48 A;  4A3M H;  1CKN A;  1UE7 A;  4QL5 A;  4DK6 C;  3CME A;  4DV3 Q;  4DV3 L;  3H3V I;  2K50 A;  3M4Q A;  3S1Q H;  1Y1W G;  3CXC A;  2MO1 A;  3S17 H;  4IFD G;  3S1M H;  4A76 A;  2PQA B;  4LUZ A;  4MNO A;  4NXN Q;  4JBM A;  3T1H L;  4UP9 A;  4A3F H;  3A0J A;  2R6G A;  1WI5 A;  2K5N A;  1QVG A;  4GLX A;  4GNX B;  5JJI A;  2ZTC A;  2YU9 H;  3I4O A;  2K14 A;  4LFB L;  1WCM G;  3UDX A;  5LMN L;  4AYB E;  3B6Y A;  3OW2 A;  1YHQ A;  1B70 B;  1X3E A;  4R4O A;  2WAQ E;  5FJ8 H;  1PH1 A;  1CSQ A;  2ALY B;  4JI1 L;  4JG2 A;  4X64 Q;  1VQI A;  5IWA L;  4JYA L;  2R7Z G;  4LF7 Q;  1YHB A;  3K7U C;  1MJC A;  3J81 i;  4BY1 H;  5C0X G;  4LUV A;  5C44 H;  4JI2 L;  3HOU G;  1HNZ Q;  1I94 L;  1AE3 A;  4DR5 Q;  1EIY B;  5FLM G;  1VQH A;  2JA7 H;  1VQN A;  3GDE A;  3I2Z A;  3AYH B;  4A3K H;  1C7Y A;  1S3O A;  3UDF A;  1C0A A;  2N78 A;  4B3R L;  1ASY A;  3TQY A;  4X62 Q;  1H95 A;  1BBW A;  1NBW A;  1E1T A;  3KJO A;  2ZM6 L;  2ES2 A;  1WOC A;  2C35 B;  4IJH A;  3S1N H;  1G6P A;  1MJE A;  3UE0 A;  1IYJ B;  1E22 A;  2RHQ B;  3H0G H;  3DLL A;  3CCJ A;  2VUM H;  4C3I H;  2DGY A;  1OXX K;  1UE1 A;  2JK8 A;  4QGU A;  3GTQ H;  4GKK L;  4LF4 Q;  1TWH H;  3J81 j;  3HOZ G;  4JI8 L;  4OO1 I;  1XMO Q;  4HJ9 A;  4DV7 Q;  2KCM A;  3CW2 C;  1PYS B;  1KQS A;  2UUC Q;  4JI0 Q;  1LM0 A;  2ZTE A;  3PO2 G;  4BXX G;  1PH7 A;  1FL0 A;  1VQE A;  1IL2 A;  4GN3 B;  2VW9 A;  1JE5 A;  4LF6 L;  3KLW A;  1PYB A;  2K5H A;  4LFA L;  1K83 H;  2OCE A;  4DR5 L;  3PO3 H;  4MTN A;  1I5F A;  4AQY Q;  5JJK A;  3U4V A;  4DR6 Q;  2XTI A;  2B3G A;  3Q8D A;  2YTV A;  3RLO A;  2ZJR A; 
#chains in the Genus database with same CATH topology
 3DUZ A;  2MGS A;  2WGC A;  1SJ8 A;  5DNF A;  1UUP A;  1OYV I;  3HOU H;  2QA4 A;  1MKH A;  1TY2 A;  2SNM A;  4O2D A;  1QCB D;  1I4Q A;  1BKB A;  4DV7 L;  1F9P A;  1N8R C;  2Z4H A;  3EQL C;  4O42 A;  4RKB A;  1JWM D;  5G3L F;  2X3T A;  2KCX A;  1QZG A;  4B6D A;  3PUX A;  2QF7 A;  2JN4 A;  3PO2 H;  5BN4 A;  3SEK C;  2EJM A;  2CWP A;  1RF2 D;  1SMY D;  1PH8 A;  4FO2 A;  1X9N A;  4YWK A;  4R1J A;  1EY6 A;  3E0J A;  2F03 A;  4I1T A;  1EU4 A;  1NR4 A;  1PJU A;  5LMU Q;  1JOR A;  3N52 A;  2VNU D;  4WJW A;  2F4V Q;  2O5I C;  1X56 A;  4DV5 L;  3CMA A;  4A3E G;  1DYQ A;  4A3D H;  2Q2H A;  5COR A;  2YTY A;  3OXG A;  1GM5 A;  1Y1W B;  3S1R B;  1LTI D;  3MEH A;  3CCQ A;  3BZC A;  4O0A A;  2XIW A;  2JA7 B;  1TY0 A;  2GKT I;  2DN8 A;  1PRT D;  1DON A;  4GLV B;  3GOX A;  4M8A A;  2ID0 A;  3JC6 6;  1YBY A;  5JPN C;  1TBN A;  2W0T A;  2PNH A;  5IT9 c;  1YIT A;  1IW4 A;  3TOB A;  3D6W A;  5IOD A;  2UVO A;  2ZJQ A;  1MSG A;  3I56 A;  4Y52 H;  4NPS A;  1X54 A;  2HIV A;  2RSO A;  2E2J B;  3HKZ B;  2Y0M A;  3A8I E;  1S4Z A;  3QAH A;  1PTO D;  4C3I B;  5JVH 3;  1IYU A;  2MJ8 A;  4QIW B;  1RFH A;  1XMQ L;  1EYG A;  3PCO B;  1QZH A;  2IP6 A;  1LTL A;  3TBI B;  3VR6 A;  2EXZ A;  4BY7 G;  1V1Q A;  1KLU D;  1T9H A;  3D00 A;  4DR1 L;  4DKA C;  1PRT B;  2Z6B A;  1IW7 C;  2EQS A;  3NBH B;  4QMG A;  1X6O A;  2OQK A;  4BY1 B;  3FSY A;  4RGO S;  3S15 B;  1YTP A;  1WGT A;  5C0X J;  4R8I A;  3IFT A;  4DV1 L;  2L1L B;  1MI2 A;  2EY6 A;  2H5X A;  4DPG A;  5IP7 H;  3G4S A;  3BYT B;  4RGM A;  5EBD A;  3K58 A;  1LTG D;  1E7Z A;  2EOT A;  1JOQ A;  3B4V C;  2UXD L;  2CW0 C;  2VXW A;  3H94 A;  3M85 A;  4YCV A;  1KHI A;  3L0I A;  2X6L A;  3IAM 1;  4P2C B;  3NWS A;  3I70 A;  5FLX c;  1KNE A;  4K8J A;  5C4Z A;  4NXM Q;  2Y0S B;  1K9M C;  4NXM L;  1K0R A;  1I6V C;  2BL8 A;  3U4Z A;  4AS3 A;  4DNT B;  1SMX A;  4DR4 Q;  3HOV H;  1UE6 A;  3CXL A;  4H0L C;  1LTS D;  2KCT A;  3KOJ A;  2KCN A;  4JI6 L;  1RD9 D;  4FF2 A;  2OWO A;  1UAP A;  5IY0 A;  1WTV A;  2VUM B;  1TXY A;  1GUO A;  2MJF B;  2MPM A;  3K7A H;  1K8O A;  4K14 A;  4LFC Q;  1FJG Q;  1FNV A;  3HS0 C;  3L2P A;  3CF5 A;  4A3D G;  3RD4 A;  2PQE A;  4R9W A;  3FC3 A;  2ZRR A;  1IBL L;  2BCO A;  3GV3 A;  3P7J A;  4O1N A;  3M4O B;  2JYO A;  1SYD A;  1ULN A;  5IGB A;  4DV2 L;  1IL8 A;  1XNQ Q;  1FYC A;  3OWE B;  1S72 A;  2F6M B;  4JCV E;  3V96 A;  4K0K Q;  1EZ8 A;  3A56 A;  3S14 H;  4POF A;  1BCP C;  4CDC C;  2E73 A;  1YIJ A;  1CT1 D;  5C0X H;  1TIH A;  1II3 A;  1DGS A;  3K57 A;  2ODD A;  2CQA A;  2Q8T A;  1JQY D;  1PH5 A;  4A4I A;  1VQ7 A;  1K28 A;  3BDO A;  3FMC A;  3FHW A;  4TSS A;  1IBK L;  5C4J H;  5E3F A;  3T1Y L;  1B9N A;  4C3H H;  5CGK A;  3S17 B;  3LJ2 A;  2OU2 A;  1VF7 A;  2IW3 A;  2E76 C;  4ZKB B;  4A3F G;  3UOE A;  3TS0 A;  4A3C G;  2PQA A;  2AUK A;  2E2I B;  1SNC A;  1X32 A;  3CCR A;  1YZ6 A;  3ULL A;  4X3T A;  4DK1 A;  4UPA A;  3KF6 B;  1ONL A;  3URY A;  2BOS A;  4IAL A;  1H9J A;  1DXM A;  3BU2 A;  3CCV A;  4DR3 Q;  4UXI A;  2BL7 A;  3NWT A;  1VQ4 A;  1ET6 A;  4YZ9 A;  1OXU A;  5FO7 B;  3E9I A;  1CT2 I;  3Q6S A;  5D3D A;  4RG1 A;  2ZTD A;  3DM3 A;  5IOC A;  1RKN A;  4OHJ A;  4Q0F A;  1IZ6 A;  1IBM L;  3UGL A;  3NEN A;  5KIX A;  3HOZ B;  3R2T A;  4OGQ C;  3I4L A;  5FUV A;  1HZB A;  1AE2 A;  5I9O A;  1HR0 Q;  4P74 A;  1KDB A;  1W3S A;  4ME3 A;  3I73 A;  3BJI A;  3U50 C;  3GTG H;  5CV7 A;  2PMZ B;  2K28 A;  3CCU A;  1SMY C;  2RCF A;  2L11 A;  1SE2 A;  3OMC A;  1K7V A;  4PMW A;  4IPH A;  1TWA H;  1NXU A;  2B29 A;  5C5L A;  1KRT A;  4ZLT F;  4JPB W;  5CYU A;  4KV6 A;  2A6H C;  3M4Y A;  1DZ1 A;  2KEN A;  2G9D A;  4PG3 A;  1WTP A;  2KKM A;  3JSB A;  3GTL H;  1VMP A;  5JEA G;  4H7B A;  3N6R A;  1HQM C;  2XN9 C;  1WD1 A;  4B9W A;  1KAA A;  1IBM Q;  1AW7 A;  4A3G H;  4PV1 C;  1GUW A;  4WFN 3;  1PZJ D;  1P9G A;  2AWN A;  2JEA I;  1VQK A;  3HKZ G;  1FVI A;  3H3V C;  1SR3 A;  2NB0 A;  2L55 A;  2MUY A;  5EQ0 A;  4FKD A;  1E3P A;  3CKI B;  1D1I A;  4JI6 Q;  2Z0S A;  2QPO A;  2JB3 A;  2F3W A;  3RNU A;  1X3Q A;  3R93 A;  5C3W A;  4BY7 B;  2CQO A;  2PI2 E;  4PL3 A;  1OTC A;  3I91 A;  3OPO A;  1Y14 B;  1O7I A;  4BY7 H;  1N34 Q;  2R3Z A;  2VRW B;  3LJ1 A;  1YVC A;  2A6E D;  4GKJ L;  3R3O A;  3K5M A;  2M5X A;  2B39 A;  3EVQ A;  4IO9 A;  1EIF A;  1RL2 A;  1LUZ A;  1GKH A;  1YI2 A;  1BCP B;  3C2P A;  2O2L D;  2QEJ C;  1A62 A;  1VQP A;  2NVX H;  3CC2 A;  4AYB G;  1CHP D;  1VS0 A;  3SVM A;  1E2V A;  1NY4 A;  1HH2 P;  1SNM A;  3T51 B;  3MC0 B;  2VS1 A;  3E6Z X;  1A2T A;  5JEA J;  4CDE C;  4X62 L;  4JI7 Q;  2DUD A;  5IYB G;  1VQ6 A;  3H3V H;  3QTL D;  1TGS I;  1I4G A;  4F88 A;  4RHR A;  4B3M Q;  3M3Y H;  4A3I B;  4KHZ A;  2L15 A;  5HI7 A;  1N36 Q;  5ELD A;  4EGV A;  3OIQ A;  1J5E Q;  3GTP B;  4JI0 L;  3I4M B;  2C9O A;  1KDC A;  1IYV A;  1STG A;  4UDU C;  2EJF C;  2B2T C;  3RZO H;  1QWY A;  2HHH L;  1N33 Q;  2OTJ A;  3SK5 A;  1XPO A;  4DV4 Q;  4GI3 C;  4IJL A;  5ELE A;  4CJ1 B;  4HCE A;  1Z9F A;  1HEV A;  2NBF A;  3GTO H;  2TMP A;  4JI4 L;  2JA6 G;  2A8V A;  1LTT D;  2LXK A;  1UE5 A;  2R93 G;  1NMF A;  2GVA A;  3GV6 A;  5C4H A;  4DR7 L;  1SFO H;  3NHH A;  3MTS A;  4G57 A;  4OX9 L;  4XTC S;  3P23 A;  2ZXP A;  4EQN A;  1X3P A;  3I3C A;  1PH3 A;  4RAU C;  2JA5 H;  2N88 A;  1MJB A;  1ZXT A;  1QG7 A;  1I94 Q;  2E2I H;  2L7X A;  5M5W H;  1A15 A;  5EKL A;  1STE A;  1K3R A;  3ICE A;  1UE7 A;  4DK6 C;  2GKV A;  2HQE A;  2K50 A;  3NUC A;  1R0R I;  1Y1W G;  3CXC A;  3S17 H;  4BWG B;  3S1M H;  3ERQ A;  4A76 A;  4JBM A;  5EX0 A;  1Q9B A;  3KLS A;  4F8M A;  4OEM B;  1YNN D;  2ZT9 C;  3TO9 A;  2H1E A;  2NU2 I;  4GLX A;  1KMA A;  3FEW X;  2ZTC A;  2K14 A;  3KLR A;  1YHQ A;  2BE5 C;  3HOY G;  3GTQ B;  2WAQ E;  5FJ8 H;  2ALY B;  4JI1 L;  4X64 Q;  1VQI A;  4X3K A;  4LF7 Q;  1PFM A;  2J7Z A;  2CHB D;  1MJC A;  3W3A A;  3J81 i;  4BY1 H;  2HDM A;  4LUV A;  1D1K A;  2EE1 A;  2XVS A;  1AE3 A;  1HNZ Q;  1HPT A;  5FLM G;  1TS4 A;  5KGU A;  2ETD A;  3K59 A;  1VQN A;  1GHJ A;  2Z1C A;  2KED A;  3O13 A;  1BO0 A;  5DEH A;  1CT0 I;  1C0A A;  1NBW A;  3K6O A;  2EZV A;  1LR9 A;  2ES2 A;  3S1N H;  4GZY C;  1NSN S;  2VUM H;  4C3I H;  1SXT A;  1UE1 A;  1F2Z A;  4LF4 Q;  2WVJ A;  1DS2 I;  3OVO A;  2ENN A;  2KCM A;  2UZ3 A;  5C4X B;  3QJY A;  1B2T A;  3F2U A;  4BXX G;  3LX0 A;  2PZU A;  4DN4 M;  4LF6 L;  4JW0 A;  2BDN A;  4HN7 A;  4MTN A;  4AQY Q;  1UVF A;  3VYT A;  5JJK A;  4IUP A;  5I6W A;  3Q8D A;  2YTV A;  2DIP A;  3RLO A;  3K0Y A;  2WB1 E;  1KD1 C;  2E75 C;  3TS2 A;  4C2M H;  5GAG C;  1Y8P B;  4GN4 B;  4OO1 G;  1CUK A;  4DV5 Q;  2ASB A;  4LF5 Q;  1TQO A;  1LYL A;  3FKI G;  2NU0 I;  4UP8 A;  5E4W C;  4BXX H;  1S5B D;  5IWA Q;  2KMO A;  1RIP A;  3IL8 A;  3NTI A;  4LF6 Q;  1TWG B;  1RDP D;  5CCL A;  2RSN A;  3SK6 A;  2E2H B;  4EQP A;  4HEA 1;  1SAP A;  1QUQ A;  3FP9 A;  2VUM G;  4DK0 A;  1TWC B;  3NBH A;  1SGP I;  2VQF Q;  4L5S A;  2A73 B;  2WB1 B;  1PFS A;  4LK1 C;  1A3T A;  3CCS A;  3OTO Q;  5M3F H;  4A3M G;  2UUA L;  4ALP A;  3SGQ I;  3PUW A;  4MZ9 A;  3FVV A;  5IT9 L;  4LFB Q;  5DLQ E;  2OQ0 A;  3EIV A;  1KC8 C;  1I3Q B;  1J6Q A;  4A3B H;  1A2U A;  2JE6 I;  4KKU A;  2BH8 A;  1JE4 A;  1N13 A;  2ELI A;  1SNP A;  4YCU A;  2IHF A;  5I2Y A;  4O1O A;  2E2H H;  1CZW A;  3KFU A;  3RR5 A;  3Q24 A;  3CRL C;  2JQO A;  1WCM B;  3Q22 A;  5E3P A;  1WVL A;  5C4J B;  1WGC A;  2ZM6 Q;  1HDL A;  3R2I A;  4RCO A;  3I4M G;  4HMJ A;  3QWN A;  1QNU A;  1YJ9 A;  1Y1W H;  1VDD A;  5CMD A;  4F7X A;  3J7A F;  3U58 A;  4JBK A;  3TO7 A;  2RF4 A;  4E1R A;  4JI5 L;  4X66 Q;  2KA7 A;  1IBK Q;  2N55 A;  2LS0 1;  4IPG A;  3LWU A;  3S1Q B;  4LAA A;  1EOT A;  2RBM A;  2OTL A;  3BJU A;  4L5Q A;  4MN3 A;  4LF8 L;  2V53 A;  2NN6 H;  1OMU A;  1O80 A;  1UEB A;  4QIW E;  2JA6 B;  1L1O A;  3KF8 A;  4ZCK A;  4KHP L;  2I5M X;  3HP3 A;  2I0Q A;  2UXC L;  4FF1 A;  1G29 1;  1K73 C;  4GNX C;  4BBR H;  4PL4 A;  4JV5 Q;  1SRO A;  3CAM A;  1S5C D;  1VQB A;  3WOF A;  3ULP A;  1FD7 D;  1XNQ L;  4DR2 Q;  2JA8 B;  1E2W A;  5C44 B;  1STH A;  4K2K A;  4K5X A;  4Z7G A;  2F4V L;  1AEX A;  2XMX A;  3F2D A;  2CH4 A;  2EDG A;  4RHS A;  2JA8 H;  1XA6 A;  1D6E C;  2NTS A;  2X69 A;  1DCZ A;  2K03 A;  3S2H H;  3UE1 A;  1TR5 A;  1Y8O B;  2EPB A;  1DD2 A;  1FY7 A;  3RN5 A;  4GOP C;  3MWY W;  4B3S Q;  2ICE C;  4LF8 Q;  1STB A;  2F52 A;  1YU6 C;  4AS2 A;  3T13 A;  2G9H D;  3UFF A;  1N32 L;  1PTQ A;  1C9O A;  3F8T A;  1BBX C;  4ABN A;  5IYD H;  1M8C A;  4PNY A;  4IUV A;  5IYB H;  2NZH A;  4RA8 A;  5K36 G;  1VQD A;  1OXS C;  1L2F A;  1CE3 A;  2D62 A;  3CCM A;  3PF4 A;  1B3A A;  1FAQ A;  4HIM A;  1G91 A;  3LWE A;  4NDX A;  3MXU A;  4PZ7 A;  1BVS A;  3MFY A;  2UUC L;  1QIL A;  4YWL A;  3S15 H;  4DNR B;  1IY6 A;  4NW2 A;  3MZ5 A;  2EY1 A;  1EQR A;  2XTR A;  1PXU A;  5EKI A;  1HTL D;  5M5W B;  4QB4 A;  5IP9 G;  2N49 A;  3M4O H;  2A19 A;  4DNI A;  2FMC A;  1Y1V H;  1L0W A;  4HID A;  2JSO A;  1VF5 C;  3MXN A;  3J7Z C;  3CPF A;  4LUO A;  1H9M A;  3ULJ A;  4JOI A;  5M3M B;  2F0S A;  3G7L A;  4OO1 H;  2IY5 B;  2VL6 A;  5BN3 A;  2HUG A;  2JA7 G;  2L0C A;  4V0B A;  4A24 A;  4KKT A;  1PRT C;  3SK4 A;  5C3E H;  2F0O A;  3I90 A;  5GQO A;  1TS2 A;  4A93 B;  4A3G G;  1JOO A;  4JI8 Q;  1JC7 A;  2Z9H A;  1ULK A;  1YJN A;  1BCP F;  1SYF A;  2JP1 A;  4ZK9 B;  3RZO B;  5KYI A;  5BR8 L;  1WD0 A;  4J8Q A;  1DM0 B;  1SYC A;  3S2D B;  2I5H A;  1LV9 A;  1PZK D;  2QGQ A;  4A3I G;  4FF3 A;  3ER0 A;  3GTK H;  3VA9 A;  3CU7 A;  4AML A;  2CH4 W;  2IT1 A;  2A2D A;  4C3I G;  3CC7 A;  1V1O A;  2AWO A;  4IFD H;  4A3I H;  2F1M A;  3BYY B;  1C48 A;  3T1H Q;  4DF7 A;  3QB3 A;  3KDF B;  3RZD B;  2BH2 A;  4C2M B;  1OO9 B;  5LL6 X;  4RFB A;  1VQF A;  3QR8 A;  4IOC A;  2K33 A;  1HFG A;  1UEA B;  5FLM H;  1SN8 A;  3A5U A;  2NZO A;  4HIO A;  5FK9 C;  1HZA A;  5JAV A;  2UXD Q;  4XYQ A;  2EYM A;  4BY1 G;  1SSO A;  5J39 A;  5EX3 A;  2NVX B;  3HOZ H;  4DU9 A;  2ROW A;  3HOY H;  1IBL Q;  4X3S A;  2MQH A;  4KTA A;  1CHO I;  2PMZ E;  3GQB A;  4PZ6 A;  2JB2 A;  1HQR D;  5A35 A;  5IGD A;  3PO2 B;  5J3B A;  4XYO A;  5J1Z A;  2HCI A;  2PO4 A;  1VQ8 A;  2KMQ A;  1PV4 A;  1CHQ D;  4OAU C;  1HA5 A;  2F66 B;  2HGK A;  1ZYR C;  2Z4I A;  5IP9 H;  4JOI C;  3AJF A;  2N52 A;  3ERS X;  1HZC A;  2ZJP A;  5I6Y A;  5LMN Q;  2R7Z H;  2LB7 A;  3CCL A;  1HTP A;  3E3X A;  3TJQ A;  3NK9 A;  3OHX C;  4ULL A;  4F87 A;  2JA5 G;  4OIJ A;  2UXB Q;  5HGQ A;  4CJ0 B;  3QOJ A;  1KBF A;  4PZ8 A;  2PCF B;  1VMC A;  1K8A C;  3HOW B;  4YHH L;  1SGD I;  1Y1B A;  1Q12 A;  3E9H A;  5FO9 B;  4Q9V A;  1Q3L A;  1EY7 A;  3HOY B;  4CJ2 C;  5DAU A;  2D2C C;  2JA6 H;  1BUV T;  2XTQ A;  1Y1C A;  2F0I A;  3RU0 A;  1SNO A;  1N9W A;  2CWA A;  1PCE A;  4M1U B;  4A3L H;  3NP8 A;  3OYY A;  1WTH A;  2OD1 A;  4KI0 A;  3GP7 A;  2QQ0 A;  5E3R A;  4NKL A;  3LGJ A;  4P72 A;  2NVT B;  3FBV A;  1EU3 A;  2YUU A;  4LW1 A;  2F0G A;  2D0O A;  2JA8 G;  1G8Z D;  3W5O A;  1U4L A;  1HR0 W;  3VDP A;  4DUY Q;  4A3L G;  4A3E B;  2A69 D;  1PH6 A;  1EEF D;  3SK8 A;  1HHV A;  5D14 A;  1V1H A;  4XIG S;  1EQQ A;  3Q23 A;  4K0K L;  2I07 B;  5CR3 A;  1SGN I;  4IUU A;  4B08 A;  1CQF A;  4CGY B;  2YU9 B;  4A3B B;  1QNK A;  1R4Q B;  1X4S A;  4KY7 A;  4R8N A;  4QQB X;  4ZYS A;  2YQP A;  3I4N B;  2AKW B;  5JPM C;  2N3S A;  1L1O C;  2JZM A;  4HSP A;  3KDF A;  2JEB I;  3NE5 B;  3X3M A;  1HNW Q;  2SNS A;  4UXH A;  4IUN A;  5CV9 A;  5KYL A;  3TP7 A;  1TWC H;  1FNU A;  4OEL B;  3FKI B;  2BUS A;  2B63 B;  5IYC G;  3K5N A;  3WWV A;  2V4D A;  3BVM A;  1TOT A;  5KNB A;  2KEC A;  4H44 C;  2J9R A;  3DM1 A;  3M3Y B;  1SE8 A;  3SE0 A;  1V9P A;  3HOX B;  4DUZ Q;  4GKK Q;  2HQL A;  1MSH A;  3DA3 A;  3FPP A;  4ID6 A;  1PH9 A;  3GO5 A;  3RZD H;  1JT8 A;  2OZU A;  5M9O A;  2ERW A;  3F4M A;  3DO9 A;  2VZA A;  2RKS A;  4DWL A;  5FOB B;  3VE5 A;  2FXQ A;  4RKL A;  1O7Z A;  5E7N A;  3C1F A;  3MEK A;  7WGA A;  2IHE A;  4BA1 I;  4A3K B;  4V19 0;  1SDF A;  2PW5 A;  2KOL A;  1WTW A;  2PPB C;  1MD2 D;  4U6R A;  3PIO 3;  3VDY A;  2JJQ A;  5EBC A;  3E0E A;  3ZJY C;  4A93 G;  5M3F G;  3G48 A;  4A3M H;  3H3V I;  1SYB A;  3M4Q A;  4IFD G;  1K83 B;  2MO1 A;  2F0Q A;  2P22 B;  2AUJ D;  3H91 A;  2KJX A;  4UP9 A;  5F2D A;  2D9U A;  1WI5 A;  1K8M A;  1QVG A;  5JJI A;  2YU9 H;  3I4O A;  1U9R A;  5EPK A;  1WCM G;  1CZG A;  3UDX A;  5LMN L;  3B6Y A;  1TBR R;  2TSS A;  2N17 A;  4R4O A;  3VR3 A;  5IWA L;  2QKI C;  3TP8 A;  1YHB A;  3KUP A;  3K7U C;  5DM6 3;  2WAQ B;  4X3U A;  1V1I A;  2F0U A;  4JI2 L;  3B55 A;  4KHV A;  1WTR A;  4Y7N B;  4PL5 A;  1ESF A;  5T1G A;  1BOS A;  1VQH A;  2JA7 H;  4FF4 A;  1PTO B;  2F0H A;  3AYH B;  4A3K H;  2KMP A;  1S3O A;  3MHB A;  3UDF A;  5E3Q A;  4X62 Q;  1H95 A;  1STY A;  1E1T A;  3J7Y W;  3KJO A;  2ZM6 L;  1WOC A;  1G6P A;  4DAP A;  2K9H A;  1LAB A;  5CBE E;  1IYJ B;  1E22 A;  2RHQ B;  1O7Y A;  3H0G H;  5HUR A;  4FYD A;  2DGY A;  3EA6 A;  3GTQ H;  1HUM A;  4C3J G;  1XMO Q;  3A7A B;  2K1B A;  2MP1 A;  3CW2 C;  1PYS B;  1KQS A;  4JI0 Q;  3NPP A;  3IKJ A;  3PO2 G;  2F3C I;  2RC4 A;  2FJ2 A;  1VQE A;  2F0W A;  2XNA C;  4GN3 B;  1JE5 A;  3A8K E;  4DFA A;  2VW9 A;  1CA5 A;  3KLW A;  1IL2 A;  4LFA L;  1EIG A;  1A3V A;  4DR5 L;  2MHV A;  2FNF X;  4DR6 Q;  2O4X A;  5K36 H;  1PFB A;  2IX3 A;  4DV0 L;  4DK3 C;  1VQ5 A;  2H4O A;  4NV5 A;  3RUZ A;  4RH6 A;  1R9T B;  5I9P A;  2O5J C;  5LMU L;  2SEB D;  3L9A X;  4LWC A;  3GTJ B;  4JI4 Q;  2YV5 A;  3QO2 A;  3S2H B;  4A3J B;  2VB3 X;  1NTG A;  1BBU A;  3CP0 A;  5KEE A;  3HOW G;  3PO3 G;  2LSS A;  1XMO L;  3G6J B;  2B2U C;  3TOA A;  3LNN A;  3UDI A;  1PYW D;  1V43 A;  1AN8 A;  2XSC A;  4LF7 L;  1HRJ A;  4HAE A;  3MA2 B;  1SYE A;  3T1Y Q;  4ME5 A;  4FXG C;  5JJZ A;  1HPC A;  1B4O A;  2AQ2 B;  3JAM E;  2LEO A;  4OWW B;  1GOZ A;  3CQZ B;  3D4R A;  5ELN A;  2BE5 D;  2NN6 I;  3PUY A;  1EEI D;  3NEM A;  1X65 A;  1B44 D;  3EJI A;  1I6H H;  4ZRZ A;  1ET9 A;  1D5Z C;  2RAD A;  3AU7 A;  4KY6 A;  1C8C A;  1ILQ A;  3OW7 A;  2HT1 A;  2NU3 I;  2KUM A;  1JMC A;  2LFN A;  3HOV G;  1EFW A;  4DGZ A;  1PH4 A;  3CD6 A;  1Y8F A;  4NMZ A;  2MFI A;  1AH9 A;  2F3V A;  3W1G A;  1JWU D;  1TT2 A;  1O78 A;  4HJ5 A;  1XPR A;  2UUB L;  1MIU A;  2P5Z X;  3EBE A;  3F2C A;  4LF9 L;  1DOM A;  4X65 L;  1VQC A;  1VQ9 A;  2PI2 A;  3E2I A;  3NBI A;  4GNX A;  3AFP A;  3NSW A;  4HSV A;  1JOK A;  4I65 A;  1PTO C;  4BBS B;  1R4P B;  5IIF A;  1U0L A;  3FRP B;  4QF4 A;  3TSS A;  3OMG A;  3VR4 A;  2R7Z B;  4OIK A;  4DXF A;  4FDB A;  4G76 A;  1OXT A;  1LR7 A;  5COY A;  3NTH A;  3HOU B;  1JJ2 A;  3C46 A;  2FFK B;  1W6J A;  5C3E B;  1RCV D;  3E5S A;  2N8N A;  3HGB A;  4L5R C;  1TWH B;  4ILW A;  3DWP A;  2DB6 A;  1X3G A;  2GA4 B;  1SNQ A;  4J15 A;  4DV6 Q;  1LT5 D;  2B2T A;  4L63 B;  4NP5 A;  1TBQ R;  4X65 Q;  1B1Z A;  4LF9 Q;  3HOX G;  2Y0S E;  2XWJ B;  3HRZ C;  5L37 A;  1OVO A;  2M9V A;  2CWG A;  2NVQ H;  4UP7 A;  3V05 A;  3SDZ A;  5JVG 3;  2A2C A;  3WDN A;  1LR8 A;  2YTX A;  3A74 A;  1SJE D;  1YHA A;  2GSC A;  2RHS B;  3H0G B;  4AYB B;  3HOX H;  3J80 c;  1KTK A;  4DUZ L;  2NVY B;  4G4K A;  3GTM H;  3UI2 A;  1IY5 A;  1F9S A;  3PUV A;  4X66 L;  1TWA B;  1K7T A;  5H1S E;  5A2Q E;  3M4P A;  3FKI H;  1VQJ A;  2K5V A;  5TSS A;  4LJZ C;  4WJ4 A;  1JCK B;  1K8G A;  3S1M B;  4PMC A;  5T1I A;  2VQF L;  2K6A A;  2C5C A;  3H15 A;  2RDH A;  1FAR A;  3OTO L;  2UUA Q;  1YNJ D;  4DR2 L;  1CGJ I;  2JA5 B;  3BZD B;  1GUG A;  5IGG A;  2BA0 A;  2WAQ G;  2A20 A;  2MO0 A;  1Y8N B;  4ZKC B;  5IGC A;  4IPD A;  1SFO B;  3H6M A;  4SGB I;  2JYY A;  3K5O A;  2J87 A;  1SGQ I;  3KBG A;  4IUT A;  1VQM A;  1Q7Y C;  4KY5 A;  1V8Q A;  1M8B A;  3D3R A;  4JK1 C;  4A3M B;  1DOL A;  2NN6 G;  4LFC L;  1K0S A;  3GTO B;  2IWH A;  2LKV A;  2CAZ B;  2X6G A;  2R93 B;  3DA4 A;  1Y1V B;  5C0X I;  4RGT A;  4DV0 Q;  2GVB A;  2EJG C;  5HGT A;  1Z2I A;  2EIF A;  2K04 A;  3LJ0 A;  2R7D A;  5D65 A;  2AQ1 B;  4DV2 Q;  1EFI D;  1G2T A;  3PF5 A;  2NVT H;  4S3S A;  2EYJ A;  4A75 A;  1Z7K B;  1CKN B;  4CKE A;  3R5D A;  3L7Z C;  1K3B C;  3CC4 A;  3ONA B;  2KHS A;  4R4Q A;  4OX9 Q;  1FJG L;  3S14 B;  1CSP A;  3QWP A;  1H9R A;  4BA2 I;  1XNR Q;  5FLX E;  4HR7 B;  5I2X A;  3HOW H;  4QJF A;  2PZT A;  4A3B G;  4YHH Q;  2A74 C;  3HFZ B;  3SDJ A;  3J81 E;  3P20 A;  3I4N H;  1EQV A;  1RTN A;  2JW6 A;  4DR6 L;  1GXD C;  1T5E A;  3V2T A;  1OMT A;  3QG1 A;  3TRZ A;  4A3C H;  4UXJ A;  1TKW B;  1X3F A;  1EQT A;  2R61 A;  4JV5 L;  1CSO I;  4HIK A;  2F0J A;  1C4Q A;  3TZD A;  1VQG A;  1BDO A;  2WII B;  5EPJ A;  1S5F D;  3UEJ A;  2L8E A;  1KL9 A;  4G7Z C;  2L4N A;  1EY9 A;  1B53 A;  3SEB A;  1H9K A;  3AQQ A;  3FDT A;  3DHQ A;  3FPU B;  4YIJ A;  4JI1 Q;  4QUC A;  2M2L A;  2DNE A;  3CHB D;  4GN5 A;  4OWT B;  2A68 C;  4B3T Q;  1EOV A;  3I55 A;  2XRS D;  3HOV B;  1TWF H;  1RTO A;  1DJR D;  4DUY L;  4OL7 A;  1HNZ L;  4H13 C;  2B2U A;  2B8T A;  5C6A A;  4I7Z C;  2QQC A;  2GKR I;  1D5X C;  2DY7 A;  5KND A;  4AQY L;  5C4X G;  1WTJ A;  2NZ1 D;  1LLR D;  4P71 A;  1QE6 A;  1HZ9 A;  4A3K G;  3GTP H;  1WFQ A;  2F0M A;  4CBV A;  1D8L A;  2KMR A;  2BA1 A;  1J9O A;  2PYK A;  3UDG A;  4IZ8 A;  5LL6 S;  1LAC A;  1SJH D;  2NTT A;  2SGQ I;  2OVO A;  3VYR A;  1GD7 A;  3DWA A;  2MNA A;  3HG9 A;  4KJN A;  2QQE A;  1T5X D;  1WCM H;  3GTK B;  4J6H A;  1JIC A;  4DAV A;  2CWH A;  2F3I A;  1XMQ Q;  2SGE I;  3S2D H;  1XYI A;  5ISR A;  2JB1 A;  5K5P A;  4OXP A;  1HR0 L;  1B50 A;  1I50 H;  2EVB A;  3K80 C;  1TWF B;  1ENF A;  3AFQ A;  1A63 A;  1SLJ A;  1EYA A;  1YJW A;  4NXN L;  3R8B A;  4A93 H;  4R4C A;  3QOL A;  1Q86 C;  3IAS 1;  2F0L A;  5EJW A;  2E2J H;  3MXN B;  4OVO A;  4QUF A;  4OWX B;  5M5Y H;  3NEL A;  4IOA A;  2ZXR A;  3T16 A;  5IP7 G;  1BQQ T;  4G7O C;  4L8J A;  1L0X B;  2WV6 D;  4K5W A;  2NYZ D;  4GOP A;  3FVQ A;  3G71 A;  2FEF A;  4BBS H;  1YNN C;  4C3J B;  3TEH B;  2X52 A;  1CFM A;  4A3G B;  1WYD A;  4FXK C;  4IQZ A;  3FNB A;  4HED A;  1IKM A;  3VYS A;  4JI7 L;  5IYC H;  2B2Y A;  2PQ8 A;  4RCN A;  4CDD C;  2E5L L;  1IKL A;  1X74 A;  1JQO A;  4CHT B;  4C56 C;  1A8V A;  3J81 c;  3KK7 A;  2DNC A;  3TRE A;  1KAW A;  2GIV A;  2Y0S G;  1EYC A;  2NUC A;  1E2Z A;  2EYF A;  1CA6 A;  4UHV A;  1BXT A;  5JEA H;  2EYL A;  1J5E L;  2EYO A;  2B63 H;  1KAB A;  1BMO A;  1HJP A;  2QIL A;  1E1O A;  1ZEQ X;  3BDL A;  3MVV A;  1SND A;  4AIM A;  2UU9 Q;  1SBB B;  1YNX A;  1NMG A;  1EZ6 A;  4CKB A;  2ZW3 A;  3KYH C;  4TRD A;  1QOH A;  3S16 B;  4WOR A;  2VB2 X;  4LFA Q;  2A1A A;  2LY7 A;  2K7V A;  1SEB D;  2A6H D;  4ZQ3 A;  4APV A;  4DV4 L;  1BF4 A;  2F0T A;  1G6Z A;  2UXC Q;  5EPL A;  2R93 H;  4X6A H;  2CJS C;  4N9P A;  4OON A;  2RDF A;  3STB D;  3K8A A;  3PUZ A;  1MJA A;  2CW0 D;  2QEX A;  4L5T A;  4JI3 Q;  2ARP F;  1EWH A;  1F2L A;  2AMC B;  2KVM A;  2RQX A;  2I5L X;  2IL8 A;  1ICW A;  1JWS D;  1P9Z A;  1NNX A;  1NR2 A;  1U4R A;  2NU4 I;  1FYB A;  3R5B A;  3RLN A;  1Q90 A;  3QIA A;  2CVR A;  4JC0 A;  2K05 A;  1QB5 D;  4BBR B;  3SGI A;  1WTX A;  2QQD A;  4X64 L;  2VY3 A;  4IN3 A;  4GLA C;  4KN7 C;  3J7A 5;  5AFW A;  3K0X A;  1ENA A;  1UWV A;  2LXJ A;  1N32 Q;  1ZYR D;  2FUG 1;  2HHH Q;  4UY8 C;  1PZI D;  3JAM i;  1CKN A;  3MXP A;  4QL5 A;  3CME A;  1EY4 A;  1A6X A;  3S1Q H;  2G5D A;  4I7A A;  1GUS A;  2QGM A;  1F2Y A;  3J7A V;  3PMF A;  4LUZ A;  4MNO A;  1TII D;  2QW7 A;  2EY5 A;  4A3F H;  3AMU A;  1V1P B;  4C1N K;  2K5N A;  4GNX B;  2HD3 A;  4C3H G;  3TZU A;  4FXD A;  4N8X 1;  1PH1 A;  1CSQ A;  1EL0 A;  2F0N A;  5C5M A;  1STN A;  3TP5 A;  4U67 3;  2R7Z G;  1F2M A;  3JAM L;  3UGD A;  5C0X G;  2RDG A;  3I72 A;  4L9M A;  3HOU G;  1PDQ A;  1V1P A;  1LTB D;  1EIY B;  4GXT A;  4DR5 Q;  2RIJ A;  2NVQ B;  1BUS A;  3M7G A;  1E0B A;  3I2Z A;  3A54 A;  1AN1 I;  1TS3 A;  2FHT A;  2JAE A;  1S5D D;  1ASY A;  1BBW A;  1PRT F;  5LHY 1;  1MJE A;  3UE0 A;  1EIH A;  3DLL A;  3CCJ A;  2JK8 A;  1BR9 A;  1D5M C;  4GKK L;  3SGB I;  1HA6 A;  1TWH H;  4XT3 B;  3SHL A;  4LMQ D;  4JI8 L;  3HOZ G;  2YFA A;  1CTM A;  3A8J E;  3ITP A;  1TUR A;  1SE4 A;  2IJ0 A;  4KD3 A;  4N9T A;  2UUC Q;  2OF1 A;  4NV2 A;  1ZKO A;  2ZXO A;  4WP4 A;  2WIN B;  1FL0 A;  2SOB A;  3VA5 A;  2OT2 A;  3KBX A;  1PYB A;  4K6D A;  1K83 H;  2OCE A;  3BDC A;  5J8C A;  3T56 B;  1SGR I;  2RA4 A;  5FO8 B;  2B3G A;  1CK1 A;  1S20 A;  2NU1 I;  2B0U C;  2PW7 A;  4POG A;  3J80 L;  3D0F A;  2WAC A;  4DA2 A;  4DXG A;  3DEO A;  2WKC A;  1XTD A;  3TDQ A;  3KJP A;  1J8I A;  3S1R H;  1QVC A;  3C1E A;  2NVY H;  3CCE A;  1I4P A;  2JXM B;  4GS3 A;  1GUN A;  3I8Z A;  4GKJ Q;  1CQV A;  2EXD A;  5A2Q L;  1PFN A;  3EFX D;  2B63 G;  1B3Q A;  1XX8 A;  2VQE L;  3U9S A;  2N71 A;  3STB C;  5HY6 A;  1SYG A;  1VQL A;  1WJJ A;  4YY3 Q;  1GVP A;  2PZW A;  4QY7 A;  4DNC A;  1SRU A;  3J80 i;  1XJV A;  1ICF B;  2K4K A;  2Q8I B;  1S40 A;  2YFB A;  3KF6 A;  1PA6 A;  1I3Q H;  1S5E D;  1Z47 A;  1PTR A;  1F9R A;  5LMN W;  1G2S A;  1Q1B A;  1FGU A;  5M5Y B;  2L5T A;  3D4D A;  2RIO A;  4P75 A;  1UUC A;  3PGZ A;  2E2D C;  2E5L Q;  1VDZ A;  1Y1V G;  5GAE C;  4H02 A;  2XGT A;  3VR5 A;  4C1N I;  3S1N B;  4DV1 Q;  4JI5 Q;  5JJL A;  2F0D A;  4A3J H;  3HEJ A;  5C3X A;  4IFD J;  2B2V A;  1P16 A;  2HIX A;  3OL0 A;  1HJA I;  1H9S B;  4KLK A;  1PH2 A;  4G75 A;  4YZD A;  1BCP D;  2K19 A;  1LT6 D;  2Z6K C;  1A3U A;  1JJC B;  3K81 C;  4KK7 A;  3GTL B;  2LMC B;  3U9O A;  2L9H A;  4TVA B;  4B3R Q;  5DM7 3;  4JI3 L;  5AJ3 L;  4PQX A;  2E74 C;  2K5D A;  4HFV A;  3I7F A;  2Q2I A;  4K2L A;  4E1P A;  4A3F B;  4JVZ A;  2F0E A;  4YZC A;  4DR7 Q;  3TO6 A;  4XQN A;  3F1Z A;  3HKS A;  3HKZ E;  2V6E A;  3RN2 A;  3MAQ A;  2R92 B;  1I6H B;  3TN2 A;  1XNR L;  3DEP A;  1NUB A;  1TS5 A;  1WTO A;  1PMR A;  1PTO H;  2K01 A;  4FNF A;  5C4X H;  4P73 A;  3OSO A;  4RMF A;  3SXH A;  3HZX A;  3M9B A;  3VA7 A;  1IHZ A;  1Q46 A;  4BBR G;  2B2W C;  3CRK C;  1UNS A;  9WGA A;  1KLG D;  2AQ3 B;  2B2Y C;  4HJ8 A;  4IPC A;  2Q8R E;  1HXY D;  2AHO B;  4KMU C;  4NB3 A;  3T53 B;  1SE3 A;  1HNW L;  2KQ3 A;  2F0P A;  1CI3 M;  1PLF A;  4B3T L;  2M00 A;  1MGS A;  4A3J G;  3MFG A;  5EKK A;  1PTO F;  2R92 H;  3PO3 B;  4DAY B;  1EY8 A;  4C3H B;  2R7F A;  3I4M H;  2WP8 J;  2WFW A;  4K5V A;  1PPF I;  1U4P A;  3KP9 A;  4FP5 D;  3I4N G;  4EQ5 A;  1XBT A;  2OEO A;  4JBJ A;  3BZK A;  2WCY A;  3WOE A;  2QSB A;  2V1C C;  1CKM A;  1X55 A;  4GOP B;  1ESR A;  3GTM B;  1KXL A;  2P6A C;  2FMM A;  3PV0 A;  4LF4 L;  3BVG A;  1L1O B;  3KF8 B;  3E59 A;  1HUN A;  4DAM A;  3W1B A;  4Q5V A;  4EQO A;  2IX0 A;  2CFM A;  4ODG A;  3RLF A;  3A5Z B;  4IFD I;  2DKV A;  3UEY A;  1RJT A;  3NTK A;  1K7U A;  1EY5 A;  4EX5 A;  3UGI A;  1FGB D;  3S24 A;  3ZYY X;  1WKX A;  1CGI I;  1M8A A;  4TQU S;  5ELB A;  1Q81 C;  1FNW A;  5M5X H;  3TP6 A;  4IUQ A;  1G51 A;  3NQI A;  2XRQ D;  3K7A B;  1HNX L;  2D0P A;  1PVO A;  1HNX Q;  2KHJ A;  3T4A C;  1UVG A;  2XRC A;  4LF5 L;  1M1K C;  1XWE A;  3Q0A A;  5CV8 A;  1HFN A;  2A69 C;  5M3F B;  2Z6K A;  2ENZ A;  4J1M A;  1PHJ A;  1MT1 A;  3L0O A;  1KBE A;  2RCN A;  5CC4 A;  4YCW A;  4YY3 L;  2QDL A;  2KBN A;  2ENB A;  3VYU A;  4O1P A;  3S16 H;  3W2D A;  1D7Q A;  3IFD A;  3BS1 A;  4DV6 L;  2V1C A;  2UU9 L;  3PDN A;  1KRS A;  3BVZ A;  2B8G A;  4IUR A;  5G3L D;  3SR1 A;  1QJO A;  4KD4 A;  5C3E G;  3J81 L;  2YYZ A;  1YEZ A;  4JBW A;  4A3E H;  1SGE I;  1NAP A;  1TU2 B;  5E4X A;  5EGT A;  3J80 E;  2Q2U A;  3M7N A;  2JXD A;  3P75 A;  5CV6 A;  5D3I B;  1VQA A;  1YO7 A;  5AJ3 Q;  1Q82 C;  3A7L A;  1JR0 D;  3GD7 A;  2KHI A;  4B3M L;  1N34 L;  3PIP 3;  4HJ7 A;  3AEV A;  1GHK A;  2SGD I;  1AZP A;  1W2B A;  3R5C A;  2RVL A;  2GVI A;  1DOK A;  4ZUJ A;  2DJG C;  1KIX A;  4UAI A;  3EN2 A;  3FSX A;  1N33 L;  2K5Q A;  3IAY A;  1XPU A;  1Q1E A;  2B2W A;  1RHP A;  3CQZ H;  2Q2T A;  1QVF A;  5CV5 A;  2ICI A;  3NXW A;  3D4W A;  3H09 A;  3OXF A;  3DXJ C;  2EY2 A;  1A0I A;  4YWM A;  3TME A;  5IYD G;  4R4I A;  4DAY A;  4AH6 A;  5FUX A;  4CDF C;  1VQO A;  5IGE A;  5EAY A;  1Q8I A;  5IT9 E;  3PIP A;  4HMI A;  1JB7 A;  1VCI A;  1N36 L;  4Z7H A;  3GTJ H;  1AP0 A;  4PMB A;  1YNJ C;  5GRO A;  1ULM A;  1LO5 D;  5FJ8 G;  1R9T H;  1D2B A;  4HCS A;  2UXB L;  1L0Y B;  3PIO A;  5ELC A;  3G6E A;  3ND9 A;  2SGP I;  1ML0 D;  3DWQ A;  3P1H A;  4E6I A;  2A6E C;  4K8I A;  2DY8 A;  3OOC A;  2EYP A;  4MTK A;  4XXE A;  1H0Z A;  1JJG A;  1I4R A;  5KRU A;  2CWF A;  5HQ8 A;  2DJF C;  2R92 G;  1I4X A;  1W6K A;  4A3D B;  1XX6 A;  2B2V C;  3ERO A;  1TUS A;  2PNR C;  2CCZ A;  1F9Q A;  4R4T A;  3JAM c;  1ASZ A;  4MPI A;  3GTG B;  1E24 A;  1B7Y B;  1XTC D;  1ILP A;  1NJI C;  5ELF A;  2J4X A;  2E8G A;  1LTR D;  5NUC A;  4LNQ A;  3PSI A;  4MIU A;  5C44 G;  2ATW A;  1IXR A;  1CKO A;  2JA9 A;  4KHP Q;  2JBW A;  1Z7T A;  2UUB Q;  5FUY A;  5LNK 1;  2J0T D;  2KCC A;  4Y7N H;  2LUY A;  3D31 A;  1MBY A;  4HTH A;  1WTQ A;  1Y69 U;  1CT4 I;  5I4D A;  1GO3 E;  4RGN A;  1EUJ A;  3NQT A;  3MEF A;  3IRB A;  5CBA E;  3F2B A;  2B8F A;  4XQQ A;  3OXL A;  1GUT A;  2XWB B;  1MHW C;  4WJ3 M;  2N1A B;  1U4M A;  4HJA A;  4MHE A;  1QUQ B;  3CPW A;  1KDA A;  4DR3 L;  1Q8K A;  2ORV A;  1IW7 D;  1TDP A;  4KJO A;  1U5K A;  1LTA D;  4BBS G;  4RWS C;  3KY9 A;  3OIP A;  2FIN B;  5DAE A;  5FLX L;  1TBO A;  1F77 A;  5GAD C;  1OXV A;  2IX1 A;  4KKS A;  2I46 A;  5BR8 Q;  5M3M H;  1BNZ A;  1MJ9 A;  1DS3 I;  1B8A A;  1R79 A;  4G7H C;  4B3S L;  4ZUI A;  2GN5 A;  2BDO A;  1P8L A;  4WRD A;  5M5X B;  2HCC A;  2L1B A;  4KN4 C;  1Z6H A;  1EYD A;  4CKC A;  4EVO A;  4TKO B;  4FVM A;  4Z9C B;  3UIT A;  5IGF A;  3MXG A;  2K52 A;  5E1F A;  2QDB A;  2SGF I;  2A68 D;  5GAH C;  1ENC A;  2K75 A;  3VDU A;  1TWG H;  1NE3 A;  2SDF A;  3D6C A;  3R5A A;  3KLS X;  2VQE Q;  2L12 A;  3I9V 1;  2WB1 G;  2JA1 A;  2ORW A;  1LT4 D;  4JYA Q;  4OO1 I;  1FR3 A;  5HGI A;  2KEE A;  4C3J H;  5M3M G;  3VR2 A;  4XQJ A;  1JB3 A;  2IPK D;  2Z8L A;  3A55 A;  2F0F A;  4DR1 Q;  3H0G G;  2CKZ B;  4U68 A;  4JI2 Q;  5CV4 A;  1EWI A;  5ELO A;  4DR4 L;  1NUC A;  1STA A;  5IE8 A;  1M90 C;  4DV3 Q;  4DV3 L;  5JOB A;  4XDX A;  1W4R A;  2F0V A;  2PQA B;  2K32 A;  4NXN Q;  3OWF A;  2QCP X;  3T1H L;  1H9S A;  4XT1 B;  3A0J A;  3BG3 A;  4K6L A;  2R6G A;  1SGY I;  1LT3 D;  2A5H A;  1XXG A;  4HGU A;  4LFB L;  2K5W A;  4AYB E;  3OW2 A;  1B70 B;  1HCZ A;  1NCV A;  1I50 B;  1X3E A;  4B9X A;  1AZQ A;  4JG2 A;  1B9M A;  4JYA L;  1ROD A;  3DMU A;  1O7L A;  1UHA A;  5C44 H;  5CCM A;  1KNA A;  1TVX A;  2OXP A;  2EYH A;  1I94 L;  2D5D A;  5JHW C;  1M4V A;  3RMH A;  3C3L A;  4N8F A;  1I4H A;  2F4I A;  3GDE A;  4OAV B;  1C7Y A;  2N78 A;  4B3R L;  3TQY A;  1GJX A;  1EY0 A;  2QZG A;  5BN5 A;  3HH2 C;  5J8F A;  2C35 B;  4IJH A;  1CM9 A;  4BS9 A;  1AFP A;  2WKD A;  2FU2 A;  1OXX K;  2F0K A;  5KNC A;  4QGU A;  2RLD A;  3J81 j;  5FUW A;  4HJ9 A;  4DV7 Q;  4L6T B;  2E5R A;  1EWC A;  3PQI A;  1LM0 A;  2ZTE A;  3X3N A;  1PH7 A;  3D8G A;  3AB9 A;  3S9W A;  5FKA C;  5J22 A;  4ZAI A;  2K5H A;  3K5L A;  3L3O C;  3PO3 H;  2NWG A;  2HDL A;  1I5F A;  3ND8 A;  3U4V A;  2XTI A;  4QCL A;  2ZJR A; 
#chains in the Genus database with same CATH homology
 4DV0 L;  2WB1 E;  2B0U C;  4DK3 C;  1KD1 C;  1VQ5 A;  2OD1 A;  4POG A;  1SJ8 A;  4NV5 A;  3TS2 A;  3D0F A;  1OYV I;  4C2M H;  5GAG C;  5LMU L;  4OO1 G;  4GN4 B;  4LWC A;  4JI4 Q;  1CUK A;  2YV5 A;  3HOU H;  2QA4 A;  1XTD A;  1MKH A;  3KJP A;  3S1R H;  1QVC A;  4O2D A;  1NTG A;  2NVY H;  4DV5 Q;  3CCE A;  1BBU A;  1BKB A;  3CP0 A;  2ASB A;  4GS3 A;  3HOW G;  3PO3 G;  4DV7 L;  4LF5 Q;  2LSS A;  1N8R C;  1CT0 I;  1XMO L;  1LYL A;  4GKJ Q;  3FKI G;  3UDI A;  1V43 A;  2EXD A;  2B63 G;  1PJU A;  2KCX A;  2NU0 I;  4UP8 A;  1QZG A;  4B6D A;  2VQE L;  4BXX H;  3PUX A;  4LF7 L;  2N71 A;  5IWA Q;  3PO2 H;  3STB C;  2QQD A;  2KMO A;  5HY6 A;  3SEK C;  1RIP A;  1VQL A;  4LF6 Q;  3T1Y Q;  1WJJ A;  5CCL A;  2CWP A;  4YY3 Q;  1GVP A;  2YUU A;  4QY7 A;  2LEO A;  1SRU A;  3J80 i;  1PH8 A;  4OWW B;  4HEA 1;  1X9N A;  1XJV A;  2K4K A;  1QUQ A;  4YWK A;  3FP9 A;  5ELN A;  3PUY A;  2YFB A;  2NN6 I;  4R1J A;  1S40 A;  2VUM G;  1SGP I;  3NEM A;  1X65 A;  3KF6 A;  2VQF Q;  1PA6 A;  1I3Q H;  4L5S A;  1Z47 A;  1PTR A;  4I1T A;  3CCS A;  1PFS A;  1I6H H;  5LMN W;  5LMU Q;  3OTO Q;  5M3F H;  4A3M G;  2UUA L;  3HOY G;  1Q1B A;  4ALP A;  2VNU D;  4OVO A;  1FGU A;  2RIO A;  4P75 A;  2HT1 A;  2NU3 I;  1UUC A;  3PGZ A;  2F4V Q;  2E5L Q;  1X56 A;  1Y1V G;  5GAE C;  1JMC A;  4DV5 L;  3HOV G;  3PUW A;  1EFW A;  4H02 A;  3CMA A;  4A3E G;  4MZ9 A;  2XGT A;  1PH4 A;  3CD6 A;  2Q2H A;  4A3D H;  4LFB Q;  1Y8F A;  2YTY A;  5DLQ E;  2OQ0 A;  3EIV A;  4DV1 Q;  4JI5 Q;  1KC8 C;  5JJL A;  2MFI A;  1AH9 A;  1GM5 A;  3OXG A;  1J6Q A;  4A3B H;  3W1G A;  4A3J H;  2JE6 I;  4HJ5 A;  3CCQ A;  1XPR A;  2BH8 A;  4IFD J;  2UUB L;  1N13 A;  3BZC A;  4O0A A;  2ELI A;  4YCU A;  1MIU A;  1P16 A;  2HIX A;  2IHF A;  3OL0 A;  3EBE A;  4O1O A;  3F2C A;  2E2H H;  4LF9 L;  1HJA I;  2GKT I;  4X65 L;  3KFU A;  4KLK A;  1PH2 A;  1VQC A;  4G75 A;  4YZD A;  1VQ9 A;  4GLV B;  3RR5 A;  3GOX A;  2PI2 A;  2ID0 A;  2K19 A;  2JQO A;  3E2I A;  2Z6K C;  4GNX A;  3AFP A;  1JJC B;  3JC6 6;  3K81 C;  1YBY A;  1CE3 A;  1U0L A;  2ZM6 Q;  1TBN A;  2W0T A;  2PNH A;  5IT9 c;  1YIT A;  4K0K L;  1HDL A;  4FDB A;  3I4M G;  1IW4 A;  4G76 A;  1OXT A;  4TVA B;  1Y1W H;  1YJ9 A;  4JI3 L;  5AJ3 L;  4B3R Q;  1LR7 A;  1VDD A;  2ZJQ A;  4Y52 H;  3I56 A;  4HFV A;  3I7F A;  3U58 A;  4JBK A;  2Q2I A;  1JJ2 A;  4NPS A;  1X54 A;  4E1P A;  2RF4 A;  2HIV A;  4YZC A;  4DR7 Q;  4L5R C;  4E1R A;  2N8N A;  4JI5 L;  4X66 Q;  1IBK Q;  3F1Z A;  2DB6 A;  1X3G A;  3HKS A;  2A20 A;  4J15 A;  4IPG A;  3HKZ E;  2V6E A;  4DV6 Q;  3RN2 A;  1XMQ L;  2OTL A;  1EYG A;  1LR9 A;  3BJU A;  3PCO B;  4L5Q A;  1TBQ R;  4LF8 L;  4X65 Q;  2V53 A;  1OMU A;  1QZH A;  4LF9 Q;  2IP6 A;  1LTL A;  1UEB A;  4QIW E;  1XNR L;  4KHP L;  1L1O A;  3HOX G;  4BY7 G;  1NUB A;  2Y0S E;  1V1Q A;  2I5M X;  1T9H A;  2I0Q A;  2UXC L;  3D00 A;  1G29 1;  1OVO A;  4DR1 L;  4DKA C;  2NVQ H;  5C4X H;  4UP7 A;  1K73 C;  2A2C A;  2EQS A;  4PL4 A;  4P73 A;  4BBR H;  4GNX C;  1SRO A;  3CAM A;  1VQB A;  3NBH B;  4RMF A;  3M9B A;  3ULP A;  1XNQ L;  4DR2 Q;  1X6O A;  1Q46 A;  2OQK A;  4BBR G;  2YTX A;  4Z7G A;  3A74 A;  2F4V L;  2XMX A;  3F2D A;  1YHA A;  2RHS B;  1YTP A;  3HOX H;  3J80 c;  4HJ8 A;  5C0X J;  4DUZ L;  4IPC A;  4DV1 L;  2JA8 H;  1XA6 A;  2L1L B;  3GTM H;  2H5X A;  4DPG A;  3PUV A;  5IP7 H;  4X66 L;  3G4S A;  3S2H H;  1IY5 A;  3UE1 A;  3B4V C;  2AHO B;  1E7Z A;  5H1S E;  4NB3 A;  2UXD L;  3M4P A;  3RN5 A;  3FKI H;  4GOP C;  1VQJ A;  4B3S Q;  3M85 A;  4YCV A;  1KHI A;  2F52 A;  4LF8 Q;  2K5V A;  1HNW L;  4AS2 A;  3L0I A;  4B3T L;  1YU6 C;  4WJ4 A;  1K8G A;  3IAM 1;  4A3J G;  5FLX c;  3UFF A;  2R92 H;  4NXM Q;  1K9M C;  1N32 L;  1PTQ A;  4NXM L;  1C9O A;  1K0R A;  4DAY B;  3U4Z A;  2VQF L;  4AS3 A;  3F8T A;  3H15 A;  2R7F A;  1SMX A;  3I4M H;  2WP8 J;  4DR4 Q;  1FAR A;  3HOV H;  2WFW A;  1PPF I;  5IYD H;  3KP9 A;  3OTO L;  2UUA Q;  4EQ5 A;  3I4N G;  1UE6 A;  4DR2 L;  1M8C A;  5IYB H;  1XBT A;  1CGJ I;  3CXL A;  2NZH A;  5K36 G;  4JBJ A;  2KCT A;  1VQD A;  1OXS C;  3BZK A;  2V1C C;  1CKM A;  1L2F A;  2BA0 A;  2D62 A;  2WAQ G;  3KOJ A;  3CCM A;  1X55 A;  2MO0 A;  4GOP B;  4HIM A;  4JI6 L;  3PF4 A;  1KXL A;  2P6A C;  3PV0 A;  1FAQ A;  4IPD A;  4LF4 L;  1L1O B;  3KF8 B;  3E59 A;  2OWO A;  4DAM A;  4SGB I;  2JYY A;  4PZ7 A;  3W1B A;  1BVS A;  5IY0 A;  2UUC L;  1SGQ I;  4YWL A;  3S15 H;  2J87 A;  1TXY A;  2CFM A;  2IX0 A;  1VQM A;  1Q7Y C;  1IY6 A;  2MJF B;  1M8B A;  3K7A H;  4LFC Q;  1EQR A;  2XTR A;  1FJG Q;  2NN6 G;  3A5Z B;  4LFC L;  3RLF A;  3L2P A;  4IFD I;  3CF5 A;  3UEY A;  5IP9 G;  2N49 A;  4A3D G;  2CAZ B;  3FC3 A;  3M4O H;  2A19 A;  4DNI A;  4EX5 A;  2ZRR A;  3UGI A;  3VE5 A;  3DA4 A;  1Y1V H;  1L0W A;  3S24 A;  5C0X I;  4HID A;  1IBL L;  1CGI I;  3J7Z C;  4DV0 Q;  2GVB A;  3CPF A;  4TQU S;  4LUO A;  1Q81 C;  5M5X H;  2EIF A;  3LJ0 A;  2R7D A;  1G51 A;  4JOI A;  3ULJ A;  1RFH A;  4DV2 L;  1HNX L;  2D0P A;  1XNQ Q;  1PVO A;  4DV2 Q;  1HNX Q;  3PF5 A;  2NVT H;  4K0K Q;  1S72 A;  2F6M B;  4JCV E;  2KHJ A;  2VL6 A;  2JA7 G;  4A75 A;  2IY5 B;  1UVG A;  4A24 A;  1Z7K B;  3S14 H;  2XRC A;  4POF A;  5C3E H;  4LF5 L;  1M1K C;  1CKN B;  2E73 A;  5GQO A;  3L7Z C;  1YIJ A;  3CC4 A;  4A3G G;  1TIH A;  1DGS A;  2Z6K A;  2ENZ A;  2ODD A;  4JI8 Q;  1PH5 A;  4A4I A;  1PHJ A;  1MT1 A;  4R4Q A;  1YJN A;  3L0O A;  1VQ7 A;  1CSP A;  4OX9 Q;  2RCN A;  1FJG L;  1KBE A;  3QWP A;  4YCW A;  4YY3 L;  3FHW A;  1IBK L;  1XNR Q;  5C4J H;  3T1Y L;  4BA2 I;  2KBN A;  4C3H H;  3LJ2 A;  3S16 H;  4O1P A;  5BR8 L;  1D7Q A;  3HOW H;  4DV6 L;  4QJF A;  2V1C A;  2UU9 L;  4A3B G;  3PDN A;  1KRS A;  4YHH Q;  2I5H A;  2QGQ A;  4A3F G;  4A3I G;  3HFZ B;  3TS0 A;  3SDJ A;  3ER0 A;  4A3C G;  2PQA A;  3GTK H;  3VA9 A;  5C3E G;  2YYZ A;  2SGE I;  3I4N H;  3SGB I;  1YEZ A;  4JBW A;  3CCR A;  1YZ6 A;  3ULL A;  4A3E H;  1SGE I;  2JW6 A;  2IT1 A;  4DR6 L;  2A2D A;  3CC7 A;  2Q2U A;  1OMT A;  3TRZ A;  2AWO A;  3M7N A;  4A3C H;  4UPA A;  2JXD A;  4A3I H;  4UXJ A;  1VQA A;  1YO7 A;  3KF6 B;  5AJ3 Q;  1X3F A;  4JV5 L;  1Q82 C;  1CSO I;  4HIK A;  3T1H Q;  1LR8 A;  1VQG A;  3BU2 A;  3GD7 A;  3CCV A;  3KDF B;  2BH2 A;  2KHI A;  4DR3 Q;  4B3M L;  4UXI A;  3UEJ A;  1VQF A;  2L8E A;  1KL9 A;  4IOC A;  1N34 L;  2SGD I;  4HJ7 A;  3AEV A;  5FLM H;  1SN8 A;  1VQ4 A;  3A5U A;  4YZ9 A;  1OXU A;  2NZO A;  4HIO A;  1HZA A;  1W2B A;  3E9I A;  3AQQ A;  1CT2 I;  2UXD Q;  2GVI A;  4JI1 Q;  4GN5 A;  4OWT B;  4RG1 A;  1KIX A;  4BY1 G;  2ZTD A;  3DM3 A;  3EN2 A;  4B3T Q;  1EOV A;  3I55 A;  5EX3 A;  3HOZ H;  1N33 L;  1XPU A;  1Q1E A;  2ROW A;  1IZ6 A;  1TWF H;  1IBM L;  1IBL Q;  3HOY H;  3NEN A;  3UGL A;  2MQH A;  4DUY L;  3CQZ H;  1HNZ L;  1CHO I;  2Q2T A;  5FUV A;  2B8T A;  2PMZ E;  1QVF A;  4PZ6 A;  1HZB A;  1AE2 A;  2JB2 A;  1HR0 Q;  2QQC A;  2GKR I;  4AQY L;  4P74 A;  5C4X G;  1W3S A;  4ME3 A;  3BJI A;  3OXF A;  3U50 C;  3GTG H;  4P71 A;  5J3B A;  1HZ9 A;  4A3K G;  1A0I A;  3GTP H;  4YWM A;  1WFQ A;  5IYD G;  3CCU A;  4R4I A;  1VQ8 A;  2KMQ A;  1D8L A;  1PV4 A;  2KMR A;  4AH6 A;  2BA1 A;  4OAU C;  4PMW A;  4IPH A;  2L7X A;  5FUX A;  3UDG A;  1TWA H;  2F66 B;  5IP9 H;  1VQO A;  2B29 A;  5EAY A;  1KRT A;  4JOI C;  3AJF A;  3PIP A;  2N52 A;  1JB7 A;  1VCI A;  3ERS X;  2SGQ I;  1HZC A;  1N36 L;  4Z7H A;  2OVO A;  2ZJP A;  2KEN A;  5LMN Q;  1GD7 A;  2R7Z H;  4PG3 A;  3GTJ H;  2KKM A;  5GRO A;  2MNA A;  3JSB A;  3CCL A;  2WCY A;  5FJ8 G;  1R9T H;  3GTL H;  2QQE A;  5JEA G;  1WCM H;  3TJQ A;  2JA5 G;  2UXB L;  2UXB Q;  5HGQ A;  3PIO A;  2F3I A;  1KBF A;  4PZ8 A;  1XMQ Q;  3G6E A;  3S2D H;  1IBM Q;  4A3G H;  1K8A C;  3ICE A;  2SGP I;  2JB1 A;  4YHH L;  1SGD I;  1Y1B A;  4OXP A;  2AWN A;  1Q12 A;  3E9H A;  1HR0 L;  1VQK A;  2JEA I;  3HKZ G;  1FVI A;  4Q9V A;  1I50 H;  3K80 C;  1H0Z A;  1SR3 A;  1JJG A;  3AFQ A;  1A63 A;  2JA6 H;  1SLJ A;  2XTQ A;  5HQ8 A;  1Y1C A;  1YJW A;  4FKD A;  1E3P A;  2GKV A;  2R92 G;  3RU0 A;  4NXN L;  4JI6 Q;  4A93 H;  2Z0S A;  4R4C A;  2JB3 A;  1N9W A;  2CWA A;  1PCE A;  3RNU A;  1Q86 C;  1XX6 A;  4A3L H;  1TUS A;  2CQO A;  2PI2 E;  3OYY A;  4KI0 A;  4PL3 A;  2CCZ A;  1OTC A;  4R4T A;  3IAS 1;  3JAM c;  1ASZ A;  2QQ0 A;  1Y14 B;  1O7I A;  3LGJ A;  2E2J H;  4P72 A;  1E24 A;  3MXN B;  3FBV A;  1N34 Q;  4OWX B;  5M5Y H;  3LJ1 A;  1YVC A;  3NEL A;  4LW1 A;  1B7Y B;  4IOA A;  4GKJ L;  2VRW B;  5IP7 G;  1NJI C;  2E8G A;  2D0O A;  4LNQ A;  2JA8 G;  2M5X A;  3PSI A;  4IO9 A;  1EIF A;  1RL2 A;  5C44 G;  2ATW A;  1IXR A;  1CKO A;  1GKH A;  1LUZ A;  2JA9 A;  3W5O A;  1YI2 A;  4KHP Q;  3SGQ I;  1HR0 W;  3VDP A;  1A62 A;  1VQP A;  3HH2 C;  2JA1 A;  4GOP A;  2UUB Q;  3G71 A;  5LNK 1;  2NVX H;  3CC2 A;  4BBS H;  4AYB G;  4DUY Q;  4A3L G;  5FUY A;  1VS0 A;  1PH6 A;  3TEH B;  1NY4 A;  1HH2 P;  4Y7N H;  1WYD A;  1V1H A;  3D31 A;  1CT4 I;  2LUY A;  2VS1 A;  1GO3 E;  4XIG S;  1EQQ A;  1EUJ A;  4JI7 L;  3MEF A;  3IRB A;  5JEA J;  4X62 L;  3F2B A;  5IYC H;  2DUD A;  5IYB G;  1M90 C;  4JI7 Q;  1VQ6 A;  3OXL A;  2E5L L;  3H3V H;  1SGN I;  1X74 A;  2NU1 I;  3QTL D;  4WJ3 M;  2N1A B;  3J81 c;  1A8V A;  1TGS I;  4HJA A;  3TRE A;  1KAW A;  1QUQ B;  3CPW A;  4DR3 L;  2Y0S G;  4B3M Q;  3M3Y H;  1Q8K A;  4KHZ A;  2ORV A;  1X4S A;  2L15 A;  4QQB X;  5HI7 A;  1J5E L;  1U5K A;  1N36 Q;  1J5E Q;  2B63 H;  4BBS G;  1BMO A;  2YQP A;  3KY9 A;  1HJP A;  1E1O A;  2AKW B;  5DAE A;  2N3S A;  1L1O C;  2JZM A;  3KDF A;  4AIM A;  5GAD C;  2UU9 Q;  1OXV A;  4JI0 L;  1YNX A;  1NMG A;  2JEB I;  2IX1 A;  5BR8 Q;  5M3M H;  3KYH C;  1DS3 I;  1B8A A;  1R79 A;  4B3S L;  1HNW Q;  3RZO H;  4UXH A;  2GN5 A;  4LFA Q;  2A1A A;  1P8L A;  1TWC H;  2HHH L;  1N33 Q;  2OTJ A;  4APV A;  4DV4 L;  1XPO A;  4DV4 Q;  4GI3 C;  2BUS A;  2UXC Q;  3UIT A;  4IJL A;  5IYC G;  2R93 H;  2K52 A;  3WWV A;  4X6A H;  1TOT A;  2CJS C;  4OON A;  2SGF I;  1Z9F A;  5GAH C;  2K75 A;  2J9R A;  3VDU A;  1TWG H;  1NE3 A;  3STB D;  3K8A A;  3GTO H;  3PUZ A;  1SE8 A;  4JI4 L;  2QEX A;  4L5T A;  4JI3 Q;  1V9P A;  2JA6 G;  2A8V A;  2ARP F;  4DUZ Q;  2LXK A;  1UE5 A;  2AMC B;  4GKK Q;  2R93 G;  2HQL A;  2I5L X;  3DA3 A;  1NMF A;  1PH9 A;  3GO5 A;  3RZD H;  2VQE Q;  2GVA A;  1JT8 A;  4DR7 L;  1SFO H;  2NU4 I;  2ERW A;  3F4M A;  1FYB A;  3DO9 A;  2VZA A;  3I9V 1;  4DWL A;  2WB1 G;  4JC0 A;  3P23 A;  2FXQ A;  4XTC S;  3RLN A;  5E7N A;  4OX9 L;  2ORW A;  3MEK A;  4JYA Q;  2IHE A;  3SGI A;  4BA1 I;  5HGI A;  4C3J H;  2VY3 A;  5M3M G;  4GLA C;  4X64 L;  1PH3 A;  2JA5 H;  3J7A 5;  3K0X A;  1UWV A;  2LXJ A;  4DR1 Q;  4U6R A;  3H0G G;  1N32 Q;  1I94 Q;  2FUG 1;  2CKZ B;  2E2I H;  2HHH Q;  4UY8 C;  3VDY A;  4JI2 Q;  2JJQ A;  5M5W H;  1EWI A;  3E0E A;  5ELO A;  3ZJY C;  4DR4 L;  4A93 G;  5IE8 A;  3JAM i;  1K3R A;  5M3F G;  3G48 A;  4A3M H;  1CKN A;  1UE7 A;  4QL5 A;  4DK6 C;  3CME A;  4DV3 Q;  4DV3 L;  3H3V I;  2K50 A;  3M4Q A;  3S1Q H;  1Y1W G;  3CXC A;  2MO1 A;  3S17 H;  4IFD G;  1R0R I;  1W4R A;  3S1M H;  4A76 A;  2P22 B;  2PQA B;  4LUZ A;  4MNO A;  4NXN Q;  4JBM A;  5EX0 A;  3T1H L;  4UP9 A;  4A3F H;  3A0J A;  2R6G A;  1SGY I;  1WI5 A;  2K5N A;  2NU2 I;  1QVG A;  4GLX A;  4GNX B;  5JJI A;  1KMA A;  2ZTC A;  4HGU A;  2YU9 H;  3I4O A;  2K14 A;  4LFB L;  1WCM G;  3UDX A;  5LMN L;  4AYB E;  3B6Y A;  3OW2 A;  1YHQ A;  1B70 B;  1TBR R;  1X3E A;  4R4O A;  2WAQ E;  5FJ8 H;  1PH1 A;  1CSQ A;  2ALY B;  4JI1 L;  4JG2 A;  4X64 Q;  1VQI A;  5IWA L;  4JYA L;  2R7Z G;  4LF7 Q;  4BY7 H;  3UGD A;  1YHB A;  3K7U C;  1MJC A;  3J81 i;  4BY1 H;  5C0X G;  4LUV A;  5C44 H;  4L9M A;  1V1I A;  5CCM A;  4JI2 L;  3HOU G;  1HNZ Q;  1I94 L;  4GXT A;  4PL5 A;  1AE3 A;  4DR5 Q;  1EIY B;  1HPT A;  5JHW C;  5FLM G;  1BUS A;  1VQH A;  2JA7 H;  1VQN A;  3GDE A;  3I2Z A;  4OAV B;  3AYH B;  4A3K H;  1C7Y A;  2KMP A;  1S3O A;  3UDF A;  1C0A A;  2N78 A;  4B3R L;  1ASY A;  2JAE A;  3TQY A;  4X62 Q;  1H95 A;  1AN1 I;  2QPO A;  1BBW A;  1NBW A;  1E1T A;  3KJO A;  2ZM6 L;  2ES2 A;  1WOC A;  2C35 B;  4IJH A;  3S1N H;  1G6P A;  1MJE A;  3UE0 A;  2K9H A;  1IYJ B;  1E22 A;  2RHQ B;  3H0G H;  3DLL A;  3CCJ A;  2VUM H;  4C3I H;  2DGY A;  1OXX K;  1UE1 A;  2JK8 A;  4QGU A;  3GTQ H;  4GKK L;  4LF4 Q;  2WVJ A;  1TWH H;  3J81 j;  3HOZ G;  1DS2 I;  4JI8 L;  4OO1 I;  1TBO A;  4JV5 Q;  2YFA A;  3OVO A;  5FUW A;  1XMO Q;  2ENN A;  4HJ9 A;  1TUR A;  4DV7 Q;  2KCM A;  3CW2 C;  1PYS B;  1KQS A;  2UUC Q;  2E5R A;  2UZ3 A;  4JI0 Q;  1LM0 A;  2ZTE A;  3PO2 G;  4NV2 A;  4BXX G;  1PH7 A;  2F3C I;  1FL0 A;  1VQE A;  1IL2 A;  4GN3 B;  2VW9 A;  1JE5 A;  4LF6 L;  3KLW A;  1PYB A;  2K5H A;  4LFA L;  1K83 H;  2OCE A;  4DR5 L;  3PO3 H;  4MTN A;  2N17 A;  1I5F A;  4AQY Q;  1SGR I;  1UVF A;  5JJK A;  2FNF X;  3U4V A;  4DR6 Q;  2XTI A;  2B3G A;  3Q8D A;  2YTV A;  2DIP A;  3RLO A;  2ZJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...