1W3SA

The crystal structure of reco from deinococcus radiodurans.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
230
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN DR0819
publication title Crystal Structure and DNA-Binding Analysis of Reco from Deinococcus Radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna repair
total genus 53
structure length 230
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1w3sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1w3sA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1w3sA03
1L1OC 3G48A 3ZJYC 4X64L 3EIVA 1KC8C 2F3IA 1D8LA 1FL0A 4LF8L 2VS1A 1VQPA 4JI7L 4A3KH 4A3BG 4UP7A 1PH9A 3PUXA 4JI3Q 3I7FA 3JAMi 2B3GA 2R92H 1IBMQ 1IBLL 1HJPA 1Q8KA 1S3OA 2LSSA 3I2ZA 4A3LG 4LFBQ 4C2MH 1XPOA 1KRSA 4LW1A 3HOYH 2EXDA 4DR5Q 2YU9H 1VQIA 1XNQQ 1EUJA 3UDGA 1FJGQ 2ASBA 4R4TA 2R93H 1Q12A 3S2DH 4POFA 1KD1C 4A3FH 1QZGA 1P8LA 4JBWA 3GTQH 4A4IA 3UE1A 4A3JH 3L2PA 3H3VI 2UUBL 4QIWE 2ZJPA 2CCZA 2C35B 2ZM6L 1C9OA 3GTJH 4DR1Q 3G4SA 3T1HL 2PNHA 4AH6A 4OO1I 2E8GA 5GROA 2R92G 1HZ9A 4DPGA 4LFAQ 4POGA 4DR6L 3CCRA 4R1JA 4JI6L 3TEHB 2Q2HA 4C3IH 1OXSC 3ULLA 3CPFA 5IWAQ 4DR7Q 3I4OA 4DKAC 1OXXK 1MIUA 1XMQQ 4MZ9A 4A93G 4LF4L 2K52A 3S1RH 1B70B 4NXNQ 2IHFA 1UE7A 4L5TA 4APVA 1WCMG 5IYDH 4A3MG 4DV3Q 4LF5Q 2HHHL 4IPGA 1PH5A 4X65L 1JJ2A 1N36Q 1EYGA 1G51A 4GNXB 1MJCA 2CFMA 1ASZA 2ATWA 1PH2A 1VQNA 2XTIA 4JI8L 4HJ7A 2OQKA 3MXNB 3UDIA 4DV4L 3ICEA 4DR4Q 5K36G 3VDYA 1SE8A 3H0GH 5M5WH 3D31A 1JMCA 3TQYA 2BA1A 1WYDA 1BVSA 4LFCL 2JA8G 4OX9Q 3I4MH 2VQFQ 3GTKH 3CCMA 2YTVA 1NBWA 3HOUH 3F1ZA 2JA7H 3D0FA 3CPWA 1NMGA 2UUCQ 4P71A 4JI5L 3W1BA 3KLWA 4YY3Q 3GTGH 1I3QH 1VQOA 4JYAL 2ALYB 4X6AH 2YV5A 3K80C 4FDBA 2Z6KA 3S24A 2HT1A 3TS0A 4BXXG 2RHSB 1TWHH 1BBWA 2R6GA 4LUOA 4JOIA 2VQEQ 4DUZL 4DV2Q 5FJ8H 3HOZH 4DV7Q 1EOVA 4X66L 2K14A 1WI5A 2NVTH 4LFAL 2ZTCA 2UXDQ 1HR0Q 2KCTA 3RN5A 1PYSB 2UXCQ 4X64Q 3CC7A 3I4MG 1HZBA 1LYLA 4PZ8A 4IPHA 2KBNA 4GKJL 2KCMA 2E5LQ 4DR7L 2JEBI 4JI7Q 4AYBG 1HNZL 4QQBX 4YWMA 1Y1WH 4HJ5A 2QEXA 2VZAA 2DGYA 2UUAL 4BY1H 5LMNW 4JV5L 4QGUA 4A3CG 2B29A 1YJNA 2D0PA 4LF9L 4C3HH 2H5XA 5E7NA 2OTJA 2JA6H 4DV3L 5M5XH 1E3PA 4BBRH 3CCUA 4LF5L 1PH6A 1L2FA 3KF8B 5FLMH 1N36L 2NVXH 5DLQE 4QJFA 4RG1A 3CCQA 4A75A 1N8RC 4NXML 3PO3H 3RR5A 4J15A 5M3MG 1JB7A 2F4VQ 4P73A 1SR3A 1K73C 1X3GA 5C3EH 3PF5A 1IBKL 2K4KA 1YEZA 2UUBQ 4KHZA 4A3DH 2K5VA 4JG2A 4QY7A 5IP7H 1Y1WG 1HH2P 3A0JA 4PZ7A 2PMZE 4YCVA 3J81i 4HIOA 4DR6Q 4IO9A 1W3SA 3K7UC 3J7ZC 2UU9Q 4JI6Q 3M4OH 3HOXG 1X54A 5LMUL 4GOPB 1PA6A 2N3SA 2NZHA 4YCWA 3PGZA 5FLMG 3CP0A 2K75A 1S40A 2MO1A 2D0OA 2A8VA 1UEBA 3CMEA 4O2DA 2NN6I 4DV2L 4LF4Q 2CQOA 2VQEL 3HKZG 5JJKA 1Q86C 1VQDA 2HIVA 2QA4A 4LF6L 2YTXA 3GTOH 3M4PA 1EQRA 1GVPA 3CMAA 1HR0L 4A3DG 5M3FH 2HHHQ 1E1TA 4X65Q 3HOVH 5IP7G 2UXCL 4B3RQ 1CSPA 4JI4L 3AFPA 1JJCB 1GKHA 2ZTDA 4OONA 4JI8Q 3CCEA 2E5LL 5JJIA 4BBSG 1EIYB 4DV4Q 4R4CA 3S14H 1Q81C 1AH9A 3M85A 4GOPA 4DV6Q 3EBEA 1J6QA 1E7ZA 1LM0A 2ZJRA 4NB3A 4LFCQ 2BH2A 4DR2L 4O0AA 3G6EA 1N9WA 4ME3A 3AFQA 1CKNB 2QGQA 3F8TA 4KLKA 3H3VH 2R7ZH 1TWCH 3GTLH 4JC0A 5ELNA 2LXKA 4JI5Q 1JE5A 2R7DA 4GLVB 2F4VL 4L5QA 4JYAQ 5JJLA 2MO0A 1X56A 2AHOB 1HNWQ 1IXRA 5HGQA 5C0XG 2JQOA 1NTGA 3AQQA 3OYYA 4TVAB 2I5LX 1KRTA 3SGIA 3WWVA 3CCJA 4DUZQ 4A3KG 1VQ4A 2MQHA 5IT9c 4B3SL 2A1AA 2CWAA 4IOAA 4X66Q 1YHQA 1PYBA 1Y1VH 4DAYB 3UDFA 4X62L 3GTPH 2V1CC 4JI2Q 2UU9L 4MNOA 3A5UA 4HIKA 3HOYG 1O7IA 3M7NA 1CKNA 3M3YH 2PQAA 4GKJQ 2RHQB 3OTOL 5GQOA 1KHIA 3I4NH 1HNZQ 2R7ZG 1D7QA 3BZKA 2R93G 4YHHQ 2PI2A 1M90C 4A3FG 2UUAQ 4JV5Q 4R4OA 3ULJA 1I94L 1HNXL 4HJ9A 4A3JG 5GAHC 2RCNA 4OO1G 1X3FA 4BA1I 4HJ8A 4LF9Q 1PHJA 3BJUA 3M9BA 5C0XJ 2OTLA 4B3RL 4PG3A 4UY8C 4NXMQ 1FVIA 4TQUS 3BU2A 2R7FA 3F2CA 1JT8A 3CAMA 4DV6L 1B7YB 2B63H 1IBKQ 3RZOH 2JEAI 4RMFA 3B6YA 2KHJA 2F52A 4A3GH 1OXUA 3BZCA 1RL2A 4GNXC 1VQLA 4DV5Q 4C3JH 3HKSA 3PUYA 1PH1A 4GN4B 1U5KA 1Q1EA 5IYDG 3J80c 5LMUQ 1TWFH 2YYZA 1BKBA 4KI0A 4P74A 3S1NH 4GN5A 5C4XH 1HNWL 3PUWA 1RIPA 1VQGA 1VQFA 2AWNA 2VNUD 4ALPA 1WOCA 3PIPA 3NELA 3GTMH 3H0GG 1CUKA 4JCVE 5C44H 2MNAA 2B63G 4LF6Q 1PH3A 3PF4A 3KFUA 1VQHA 4LUVA 3PSIA 4JI2L 4GN3B 4LUZA 4JI4Q 2WB1G 4DNIA 4B3ML 2UXBQ 1OXTA 1N34L 3HOUG 4HIDA 2JA7G 4B3TQ 3RLFA 4YHHL 3FKIH 3CC2A 4IFDG 2CWPA 2WAQG 1UWVA 3RLOA 3TREA 1PH4A 1A0IA 5C4XG 4DR2Q 5IYCH 4UP8A 1K3RA 2IT1A 3CCSA 3HOZG 1GD7A 2Y0SG 5FJ8G 5C44G 1XJVA 4DV0L 3J80i 2IHEA 4OXPA 1QVFA 2AMCB 1G6PA 4IJLA 1Q82C 3KJPA 3HOWH 1VQBA 5IYBH 4A3EH 3ERSX 4WJ3M 4IPDA 1XMOQ 1C7YA 1X55A 1TWAH 4B3SQ 4JI0Q 1U0LA 1MJEA 4XIGS 4DV5L 2WFWA 3FHWA 1TWGH 4BY1G 4X62Q 1YNXA 4P72A 1GO3E 1N32Q 3K7AH 2VY3A 2JA6G 3J81j 5H1SE 4DK6C 1SFOH 4BBRG 3PO2H 4DUYQ 4R4IA 2EQSA 3OTOQ 5IP9H 2DUDA 1XNRL 1J5EL 3PO3G 4LF7L 4BY7H 3ER0A 4PZ6A 3DM3A 3U4ZA 1VQ9A 1I94Q 1HNXQ 2JE6I 1A8VA 2HIXA 5IYBG 5C3EG 4GOPC 1UE1A 4A3EG 3JAMc 3I55A 1KL9A 2E2IH 1NE3A 4AYBE 3GD7A 4OWWB 1SMXA 4L5SA 1OXVA 1V9PA 2UXBL 4OWXB 1SRUA 1I5FA 4JBMA 2FXQA 2NZOA 1YBYA 4GS3A 5GADC 4HJAA 3LGJA 1PV4A 4B3TL 1XPUA 3PO2G 1YJ9A 1R9TH 1IZ6A 5LMNL 1SLJA 2OCEA 2A19A 3PUVA 5AJ3Q 3RNUA 3S2HH 1E1OA 4A3LH 1L1OB 1DGSA 3STBD 4AIMA 4A3IH 4BY7G 1AE3A 1X9NA 3KOJA 1L0WA 1EQQA 1GM5A 2N8NA 5BR8L 2PQAB 1CKMA 4DK3C 3AYHB 1QUQB 1EFWA 5M3FG 1VCIA 3HOVG 1A63A 2JJQA 4UP9A 3TRZA 2LXJA 3CCVA 4DV1L 4JI0L 1KIXA 3K8AA 5IY0A 1OTCA 1KAWA 3E9HA 1C0AA 5C0XI 3G71A 1L1OA 3JC66 1K8AC 3PIOA 2K50A 1NMFA 4Y7NH 4A3IG 1N32L 2VL6A 2I0QA 4B3MQ 4DUYL 4Y52H 3HKZE 1N34Q 3KJOA 4QL5A 4KHPL 1V43A 1QUQA 1YVCA 4A93H 3S1QH 1T9HA 3PCOB 4GLAC 5EAYA 3ULPA 1ASYA 2IX1A 4YWLA 1X65A 1WCMH 3E9IA 5JEAG 4A3MH 1SROA 1VQ8A 3CC4A 3S15H 3K81C 1BBUA 1UE5A 2D62A 2I5HA 1K83H 4DV0Q 1Y1VG 4GKKL 1VQEA 2GVBA 3T1YL 4WJ4A 2L15A 3H15A 2HQLA 3DLLA 4A76A 2Q2UA 3F2DA 1JJGA 3RZDH 2ZJQA 5IE8A 1KXLA 2AKWB 5AJ3L 1H95A 2JA9A 5GAGC 1VQMA 2JA5H 1N33L 3I4NG 1B8AA 2JA8H 1YHBA 1HZAA 1V1QA 3I56A 4DR3L 4IPCA 1QZHA 2Z6KC 1LTLA 2BH8A 2OQ0A 2PI2E 2Z0SA 4K0KQ 4JOIC 1UE6A 4JI1L 2CKZB 2WP8J 3A5ZB 3L7ZC 5HY6A 1EIFA 1QVGA 4AQYL 1PH7A 5JEAJ 2KENA 1XNRQ 1J5EQ 1K9MC 1K8GA 4LF7Q 4BXXH 1X3EA 3STBC 2Q2TA 3Q8DA 1YI2A 1Z47A 5J3BA 1PFSA 1YZ6A 1Z9FA 2BA0A 3L0OA 4JI3L 3UDXA 3K0XA 4L5RC 1VQ6A 2JK8A 1IBML 3EN2A 1MKHA 3RN2A 1NY4A 3KF6B 1YITA 2JA5G 1CKOA 4A3GG 2E2HH 4LFBL 2ID0A 4XTCS 3CF5A 1Q1BA 3A74A 1PVOA 4DR5L 3OW2A 1XNQL 3CW2C 4H02A 1VQJA 1CSQA 4GLXA 4IJHA 1FJGL 3HFZB 3NEMA 5LMNQ 1VQCA 4GNXA 4A3CH 3S16H 3MEFA 2AWOA 2MFIA 3M4QA 1K0RA 2N49A 1A62A 3GO5A 5GAEC 4R4QA 2KHIA 1WJJA 1VQ5A 4JBKA 3S17H 3S1MH 5BR8Q 4DR1L 4IFDI 5M5YH 4P75A 2GN5A 4LNQA 1IYJB 3U50C 4PMWA 2GVAA 3KF6A 2I5MX 1E24A 1S72A 1HR0W 1Y14B 5M3MH 3J81c 1E22A 1Q7YC 3PUZA 1XPRA 2EIFA 3CQZH 2RF4A 5IWAL 3U58A 4LF8Q 1I50H 4LWCA 1XMQL 1SN8A 4DV1Q 5ELOA 3U4VA 4BA2I 3FKIG 3FP9A 4EQ5A 3AEVA 4K0KL 4NXNL 4DAMA 1PH8A 1IBLQ 2VUMH 1YHAA 4YWKA 1XTDA 3HOXH 4IFDJ 5IYCG 2K5HA 2K5NA 1QVCA 3KDFB 4NPSA 2IY5B 3CXCA 1P16A 1FGUA 1X6OA 2NVYH 1LUZA 4UPAA 4KHPQ 1EWIA 3UE0A 5C4JH 3GDEA 1NJIC 3PV0A 4DR4L 3KYHC 3J7A5 3HOWG 2YTYA 2WB1E 2IX0A 3W1GA 1YJWA 1TXYA 3TS2A 2ZM6Q 3T1HQ 4OX9L 3RLNA 1WFQA 1KQSA 2VQFL 3CD6A 1I6HH 2VW9A 4GKKQ 1G291 2WAQE 2N78A 2E2JH 4EX5A 3T1YQ 3CCLA 4BBSH 2VUMG 1M1KC 4A3BH 1VQKA 4JBJA 3NENA 1XMOL 2UUCL 4YCUA 3KDFA 2NN6G 2Q2IA 4YY3L 4HIMA 2Y0SE 4OWTB 2OWOA 1Q46A 1N33Q 5IP9G 2NVQH 3E0EA 1AE2A 1HZCA 2ZTEA 4DR3Q 2ES2A 1VQ7A 3F2BA 5FLXc 1W2BA 1IL2A 4DV7L 1VQAA 1VS0A 4JI1Q 3NBHB 4MTNA 4IOCA 2UXDL 2XGTA 1YIJA 4AQYQ 3W5OA 3IRBA
chains in the Genus database with same CATH superfamily
3FVVA 1D8LA 1RFHA 2PZUA 5C0XH 1WTRA 1M8CA 1WTWA 4A3BG 3PUXA 2QW7A 4JI3Q 4FO2A 2B3GA 1PTRA 1IBLL 2CWHA 1PTOB 2D5DA 5EX0A 4FNFA 2PYKA 1XNQQ 3E5SA 3OWFA 4R4TA 1Q12A 5AFWA 4L6TB 2F0DA 3S2DH 1H0ZA 4JBWA 3FPPA 4A4IA 3NUCA 2UUBL 2ZJPA 5E3PA 1K3BC 3GTJH 1PCEA 1SGRI 4DPGA 3R2IA 4LFAQ 1XTCD 1YU6C 5K36H 4TSSA 1OXSC 2OVOA 2I07B 1LR9A 4OGQC 3I4OA 1MIUA 1VDDA 2GKTI 1DD2A 1CE3A 1CZWA 1O7YA 1WCMG 3P1HA 1T5EA 4CKBA 5IYDH 3MZ5A 4UDUC 4IPGA 1EYGA 1JJ2A 1N36Q 1UUPA 4JW0A 1PH2A 4MPIA 5LL6S 2ELIA 1DS3I 4XYQA 1SNDA 1T5XD 2B8FA 2B2VC 1SAPA 2BUSA 3DA4A 5HGIA 2EOTA 1SYCA 1GUGA 1BVSA 4KTAA 4LFCL 2JA8G 5CV7A 4OX9Q 4C3JB 3CCMA 3MAQA 1NBWA 1HA5A 1SMYD 3VE5A 4GI3C 1VQOA 2CH4W 4JYAL 1CZGA 2DJFC 3GV6A 2HT1A 1GUOA 4LUOA 2R6GA 4JOIA 1TU2B 1OO9B 1TR5A 1EOVA 2K14A 1WI5A 2WACA 1SEBD 2ZTCA 1W4RA 4ODGA 1DM0B 1QCBD 3OW7A 2N55A 3I90A 1DONA 4AS3A 2IPKD 1HNZL 3FKIB 4YWMA 5HGTA 2UUAL 1VF7A 2NU4I 2F0GA 2D0PA 3S17B 4C3HH 3MTSA 2OTJA 3HEJA 5M5XH 5IGEA 4RG1A 2F0NA 5KIXA 2QSBA 2ZXPA 3IAM1 5M3MG 3H91A 4N9PA 3PIP3 1ZXTA 3T4AC 2BL8A 1GOZA 3NHHA 4JG2A 1FNVA 1LT5D 3QOLA 2LFNA 1HH2P 3A0JA 1CM9A 1II3A 2VUMB 4DR6Q 3K7AB 1STGA 2FMCA 4KY6A 4JI6Q 3M4OH 2JXMB 1B1ZA 5LMUL 2N17A 3KF8A 3TZDA 3CP0A 2JXDA 2AQ3B 1WKXA 3TBIB 2BDNA 3A8IE 2F0OA 1I4PA 4LF4Q 2NN6I 1EWCA 3NXWA 1F2ZA 1VQDA 4E6IA 2QA4A 3TO9A 2YTXA 3M4PA 1GVPA 1ML0D 4X65Q 3G6JB 3I9V1 1QNUA 1CSPA 2L1BA 4JI4L 2B2YA 3L9AX 1GKHA 3A54A 3NSWA 5JVG3 4BBSG 4A3BB 1Q81C 3M85A 1PRTB 2X6GA 1XBTA 1E7ZA 4HN7A 2ZJRA 4NB3A 1R4PB 2BH2A 3F4MA 4KMUC 3AFQA 3F8TA 3H3VH 1TWCH 3GTLH 3E6ZX 2LKVA 5FO8B 2R7DA 1WTPA 2F4VL 4L5QA 1HNWQ 3TSSA 1OVOA 3A7AB 2W0TA 2JQOA 1NTGA 3OYYA 1A6XA 1KRTA 4DUZQ 1G91A 5IGDA 3DXJC 1VQ4A 1ZKOA 1RTNA 4X66Q 1PYBA 1Y1VH 1WTQA 2F6MB 3V96A 2A6ED 3HOYG 4ZKBB 4CJ1B 4ZUJA 2RHQB 4NP5A 1KHIA 1PFBA 4YHHQ 2PI2A 1M90C 2DNEA 4A3FG 4A3JG 1LTGD 1WCMB 5GAHC 1X3FA 4LF9Q 4HJ8A 2E5RA 3R5DA 2JBWA 2EJGC 4DN4M 4K6DA 3R5AA 1DOLA 3C1FA 5FK9C 7WGAA 3FRPB 2OTLA 4UY8C 5IIFA 4TQUS 3BU2A 1OMTA 5I9OA 3VYTA 3I4LA 4I65A 4Z9CB 2ENZA 1KDAA 2JA8B 2JEAI 2KHJA 4A3GH 1OXUA 4GNXC 1RL2A 3HGBA 1VQLA 1H9SB 1U5KA 1Q1EA 1TWFH 3CKIB 3WOFA 5C4XH 2VRWB 1RIPA 1VQFA 1UNSA 5LHY1 2KMRA 5M5WB 3GTMH 2F0EA 3KFUA 4JI2L 3Q24A 5F2DA 2KCXA 1CQVA 3SK8A 2WKCA 3DWAA 5T1IA 4HIDA 2P5ZX 1CT2I 4B3TQ 4OELB 1Q90A 1E0BA 1PTOD 1B53A 4IFDG 2WAQG 1UWVA 1ZEQX 2XSCA 4DR2Q 2J9RA 1LR7A 1B2TA 3HOZG 5C44G 4FKDA 3J80i 2XN9C 2B8GA 5M3MB 1WGCA 2K7VA 3HOWH 5IYBH 2Z1CA 2F0UA 1XMOQ 3M7GA 1FNUA 4B3SQ 4JI0Q 2ZW3A 1EZ8A 1I4QA 2HGKA 4HMJA 3PO2H 3J81j 2Z8LA 1SFOH 5IGCA 4R4IA 3OTOQ 5EX3A 2F0IA 1RKNA 3A7LA 1XNRL 3ER0A 1Q8IA 5A35A 1HNXQ 2JE6I 2QPOA 3SR1A 5C3EG 1HPTA 4A3EG 1UE1A 4EQPA 2NU2I 1B9MA 1NE3A 1D5XC 5JPNC 3E3XA 3ND8A 2V4DA 2JB1A 4BBSB 1PLFA 1QG7A 2FXQA 2JSOA 1YTPA 4OAVB 2JYOA 3PUVA 5AJ3Q 4A3LH 1DGSA 4AIMA 3V05A 4A3IH 1TBQR 1BO0A 5BR8L 3WOEA 3VDUA 1A15A 1CKMA 4DK3C 1TS5A 1QUQB 2X3TA 3TN2A 1JWSD 1A63A 5CMDA 2A6HC 1PMRA 5ISRA 2HCIA 3H6MA 1LTID 4DV1L 2QQCA 1KIXA 1YNND 1F2YA 1C0AA 5C0XI 2ETDA 3JC66 3PIOA 3GP7A 3HOYB 4H44C 4DAPA 1N34Q 2QZGA 4TRDA 2NU3I 3SE0A 2Q8RE 5EBCA 4ZK9B 4KHPL 1EL0A 4O1OA 4A3FB 4A93H 2H4OA 4EGVA 3QAHA 1T9HA 4A3JB 2HUGA 4Z7HA 2IX1A 9WGAA 5JAVA 5JEAG 3K57A 4A3MH 3CC4A 1SDFA 3S15H 2JZMA 3K81C 1BBUA 1UE5A 2EY5A 2F0HA 4DV0Q 3G7LA 3GTPB 5CBAE 3T1YL 4WJ4A 2L15A 2Q2UA 2CW0C 1RTOA 5J39A 3FEWX 2MHVA 3RZDH 4OL7A 4KN7C 4IURA 5IE8A 3M3YB 3N52A 2JA9A 2RSNA 5CV5A 1N33L 1XA6A 4NMZA 1JOOA 3I56A 1TUSA 4OAUC 5KGUA 4CJ0B 4JI1L 2CKZB 1O7LA 2WP8J 5EJWA 3A5ZB 2FJ2A 5E1FA 2DJGC 5JEAJ 1BUSA 1J5EQ 2Q8TA 1EY8A 4LF7Q 1F9QA 5EKIA 1X3EA 4G76A 1JQOA 4Z7GA 4L5RC 2F0WA 3EN2A 3P20A 4KJOA 1MKHA 2JA5G 3KF6B 1K8MA 2ID0A 1S5CD 3GTKB 3FPUB 1B9NA 1MD2D 3TDQA 3I91A 2Z4HA 4KY5A 4BS9A 4IJHA 1FJGL 2WAQB 1I3QB 5LMNQ 2TSSA 5EQ0A 1ET9A 3S16H 3MEFA 4ZAIA 2AWOA 2MFIA 5JVH3 1TWHB 3BYTB 3RUZA 3HOZB 1U4RA 5C44B 3ND9A 5M5YH 2GN5A 4LNQA 2RLDA 3U50C 5C3WA 1V1HA 2GVAA 1S72A 1IW7D 1EOTA 3J81c 1AFPA 2B0UC 1EIHA 1FYCA 1IKLA 4LWCA 3FP9A 4EQ5A 3AEVA 2CH4A 4K0KL 3HS0C 1IBLQ 1YHAA 4YWKA 1XTDA 4F87A 1FGBD 2K5NA 1QVCA 3VR2A 2NVXB 1H9MA 1X6OA 3J80E 1EWIA 4CDFC 4LAAA 1NJIC 4DR4L 5C3EB 3NWSA 4A3EB 4XT1B 1TGSI 2VXWA 3T56B 1KLGD 3TS2A 2M9VA 3RLNA 1WFQA 1TWGB 1SGYI 2DNCA 2VW9A 2WAQE 1DJRD 4HSPA 4EX5A 3MHBA 1SJ8A 1VQKA 4JBJA 3NENA 2UUCL 3KDFA 4ZLTF 1QWYA 1V1PA 4HIMA 1Q46A 4K5XA 1IY5A 2NVQH 2AQ1B 1KTKA 2KJXA 1NUCA 4IUTA 3D00A 1IL2A 3MC0B 4RWSC 3DEOA 1PRTC 2F3VA 1TT2A 4MTNA 2KOLA 2E2IB 2XWBB 4RHRA 4IOCA 2UXDL 3OWEB 5L37A 4X64L 2EY6A 1H9JA 2A2DA 2VS1A 4A3KH 3JAMi 4ZRZA 1WD0A 3CRKC 1LTAD 4NDXA 1HJPA 1S3OA 2J7ZA 1XPOA 3A8KE 5DM63 5FUXA 2PZTA 1EUJA 4DGZA 3NBHA 2ASBA 2F0FA 1RCVD 1JB3A 1QZGA 3GTQH 3T16A 4XT3B 2RADA 3LJ1A 3L2PA 3H3VI 3TP6A 1Q9BA 3S1NB 2C35B 2ZM6L 5E3RA 2BL7A 4AH6A 2E8GA 3E59A 5J1ZA 3PMFA 4IUVA 1KAAA 1F77A 4R8NA 3SDJA 5D65A 4C3IH 3ULLA 5KNCA 1JOKA 1S20A 1SNMA 1DZ1A 2K03A 1XMQQ 2KMQA 2ODDA 1OYVI 2MJ8A 2Y0MA 3R5CA 3S1RH 2JYYA 1K83B 2DY8A 1PH5A 2HHHL 2SGFI 1KDBA 1G51A 4GNXB 1ASZA 2ATWA 4JI8L 4FP5D 1ZYRC 2QF7A 5K36G 1PFNA 3H0GH 4UAIA 3RZOB 1RF2D 4YZDA 4SGBI 4FF1A 1JMCA 2EZVA 3TQYA 2JA5B 2BA1A 2DN8A 4DFAA 5C4ZA 2FNFX 2CWGA 2NZ1D 4P71A 5ELFA 4YY3Q 1TKWB 2YV5A 4FDBA 2F0SA 2RA4A 5DAEA 3MXNA 2B8TA 1X32A 4FXGC 1QB5D 4DXGA 1ULNA 5CV8A 3RN5A 1LYLA 4DR7L 3T51B 2HQEA 4JI7Q 4AYBG 2M5XA 2QEXA 2VZAA 1WTVA 1ESRA 2K1BA 4BY1H 2GKRI 1L0XB 1SJED 4QGUA 3I70A 4A3CG 4G57A 5E7NA 2JA6H 1JC7A 1PH6A 3KF8B 2QILA 4QJFA 4A75A 4NXML 1BCPF 5JPMC 1SYBA 1SE3A 2ICIA 2IW3A 1JB7A 2F4VQ 3KLRA 4P73A 1X3GA 4NKLA 3PF5A 1IBKL 1I50B 4A3DH 1LTTD 4EVOA 4DA2A 2YUUA 3F2UA 1TBNA 4KY7A 1Y1CA 3Q22A 4IO9A 4C3HG 3P7JA 1XX8A 1FY7A 2OU2A 2QEJC 3J81L 1C4QA 1A3UA 4G7HC 2K75A 2QQDA 3O13A 3OPOA 2D0OA 1UEBA 3CMEA 1I4GA 1NR4A 4O2DA 2VQEL 4LF6L 2RCFA 5A2QL 1EY7A 1EQRA 1HR0L 3VA9A 5M3FH 1E1TA 2WINB 3MWYW 4XQNA 3HOVH 2B2TA 2QKIC 4MIUA 2M2LA 3P23A 3AFPA 1O7ZA 2E5LL 5JJIA 1J8IA 1PZID 4DV4Q 1W6KA 1R9TB 1WGTA 4K8IA 4IUUA 3SK6A 3ONAB 5I9PA 4O0AA 1PTOH 1I4RA 2ENBA 3D4RA 1LACA 2QGQA 5G3LD 1TS2A 4KLKA 1TIHA 2NU1I 4JC0A 5ELNA 5CGKA 4JI5Q 4GLVB 5JJLA 2E75C 1A3TA 2KVMA 5HGQA 3J7AF 3FBVA 3SGIA 3AQQA 3CCJA 1CTMA 2MQHA 3CHBD 3JAME 2DB6A 4DAYB 1ILPA 4X62L 2V1CC 4C1NK 4JI2Q 2UU9L 4GKJQ 1CKNA 2PQAA 3OMGA 3RMHA 4B9XA 1LR8A 2R93G 1MSGA 4JV5Q 3ULJA 2QCPX 4BA1I 1STEA 3DWQA 5DM73 1KLUD 2X6LA 5C5LA 5JJZA 3F2CA 3D6CA 1ET6A 3B55A 3R8BA 1NR2A 3B6YA 1A3VA 4RMFA 2F52A 3RD4A 2IL8A 3BZCA 3W2DA 1VF5C 4J8QA 3UEJA 5CV4A 1BUVT 4C3JH 5BN3A 1IYUA 5CCLA 3PUYA 1PH1A 5FUWA 1CHPD 2YYZA 1BKBA 1SGQI 4GN5A 2N1AB 3PUWA 2Z9HA 1VQGA 5LL6X 2AWNA 4ALPA 4DWLA 4GZYC 1GUTA 3UI2A 2LB7A 2EE1A 1PH3A 1VQHA 2E2HB 4LUVA 3PSIA 5J22A 1EY0A 4GN3B 4LUZA 1JE4A 1OXTA 3HOUG 4AYBB 2JA7G 4LK1C 4LMQD 1TOTA 3RLFA 3FKIH 3NK9A 3RLOA 4H0LC 5C4XG 1CT0I 3S1MB 2ZT9C 2E73A 2GA4B 2F0PA 3BJIA 1K3RA 2IT1A 3CCSA 1GD7A 5FJ8G 1D6EC 1XJVA 1QVFA 1D5ZC 1SE2A 5KYIA 1G6PA 1Y8NB 4IJLA 4PL5A 3SEKC 3CQZB 3PQIA 2KEEA 1STNA 3ERSX 1W6JA 4RGMA 4EQOA 1C7YA 1TWAH 1U0LA 3FHWA 1GUWA 2Q8IB 4C3HB 4DK0A 1HRJA 3UGIA 1GO3E 1M4VA 1LTRD 3K7AH 5M5XB 1ULMA 1U9RA 4BBRG 2NVYB 2G9DA 2DUDA 4BY7H 3PO3G 4PZ6A 1I94Q 2PO4A 5IYBG 4C1NI 1KL9A 1SNQA 4AYBE 4G7OC 3CRLC 3MEKA 3U9OA 1I6HB 4L5SA 1CA5A 4ILWA 4OIJA 1OXVA 2E2JB 1SRUA 2WVJA 2NZOA 1YBYA 4GS3A 5GADC 1PV4A 3LGJA 1WVLA 2A5HA 3PO2G 1SLJA 3QO2A 4O1PA 1BF4A 3STBD 1AE3A 1EQQA 4NW2A 1ESFA 2N8NA 2EYPA 3VYRA 3Q6SA 3R2TA 1WD1A 1EFWA 2A68D 2JJQA 5I6WA 3TRZA 5FUYA 3CCVA 2ORVA 4R8IA 5IY0A 1B44D 3E9HA 1L1OA 5FO7B 2EY1A 4A3IG 3QG1A 1N32L 1GXDC 4M1UB 1Z7KB 1N13A 4B3MQ 1SNPA 2I0QA 4DUYL 3T13A 2YU9B 1HTPA 1TWCB 1FARA 1JWMD 2R93B 1YVCA 2AUKA 3PCOB 4GLAC 5BN4A 2CVRA 1EU3A 1ASYA 1WCMH 2JB2A 2NWGA 1RDPD 5FLXE 4B6DA 3FNBA 1TY0A 1VQEA 1STAA 4GKKL 1JJGA 1KNEA 4K2LA 5CORA 1EY6A 2AKWB 1KXLA 5GAGC 3I4NG 2BOSA 2JA8H 1SNCA 1YHBA 1HZAA 1RHPA 1V1QA 2ICEC 1VDZA 4X3TA 3SEBA 3SK5A 4DR3L 1QZHA 2OQ0A 4K0KQ 3FVQA 4JPBW 3E0JA 4JOIC 4DXFA 1K7TA 2EYFA 3L7ZC 1QVGA 1EIFA 1KBFA 2BCOA 1MJBA 3SXHA 3STBC 3Q8DA 5J3BA 2BA0A 2R3ZA 4JI3L 1VQ6A 1JWUD 4N8X1 5C6AA 1P9GA 4MTKA 2PW5A 3IAS1 3RN2A 1CHOI 2K32A 2RQXA 3HOUB 1IKMA 2JA7B 3TJQA 2A68C 2KCNA 3OW2A 4HMIA 4H02A 2A74C 1XNQL 4Q5VA 4GLXA 2ROWA 2A6HD 1TBOA 2XRCA 1VQCA 5C4XB 2L0CA 2SOBA 3M4QA 3GO5A 2Z6BA 1A62A 5EGTA 5HURA 2MP1A 2F3CI 1WJJA 5D3IB 3GTMB 2FEFA 1HEVA 1Y8OB 3B4VC 1HR0W 2VB3X 3K0YA 5M3MH 1E22A 1Q7YC 3OHXC 3GQBA 2RF4A 3DEPA 1U4MA 2HDMA 2KHSA 3U4VA 3QIAA 5DNFA 4BA2I 4YZCA 1Y1BA 1F9RA 1TQOA 4RHSA 4DAMA 1PPFI 3MXPA 2B2WA 3TP5A 4U68A 3CXLA 4BBRB 4IFDJ 5IYCG 3A55A 2K5HA 4X3UA 3KDFB 3TOAA 4QB4A 4UPAA 2CW0D 5I4DA 3PO3B 4DNCA 2XTRA 2B2YC 5C4JH 2MPMA 3W1GA 1BQQT 1ULKA 4XQQA 1EY5A 4WORA 2ZM6Q 1LTBD 1IHZA 2EDGA 4OX9L 1KQSA 2EYOA 4QIWB 1FAQA 5CV6A 4BBSH 3PO2B 1U4PA 3K6OA 1TDPA 2NN6G 4OHJA 4ZKCB 1ICFB 1Z6HA 2OWOA 5IP9G 1PJUA 3EQLC 2SGEI 4HEA1 1JR0D 2ES2A 1HFGA 4CBVA 2UVOA 3F2BA 3K5NA 5E4WC 3WDNA 1W2BA 3OVOA 1VQAA 1HA6A 3NBHB 2K6AA 1YIJA 4AQYQ 3TO6A 3IRBA 1L1OC 3ZJYC 3EIVA 1KC8C 2F3IA 1FL0A 4KD3A 5ELCA 1UHAA 3S14B 4UP7A 1PH9A 3I7FA 2R92H 1IBMQ 1Q8KA 3I2ZA 4A3IB 1PDQA 4LFBQ 4C2MH 3AJFA 1KRSA 1V1OA 5FOBB 2A2CA 3HOYH 2EXDA 4DR5Q 1VQIA 3S9WA 1D5MC 4A3FH 3OIPA 2ERWA 1SYEA 4A3JH 1V8QA 4PMBA 4QIWE 2CCZA 2K05A 3BDCA 5EKLA 1C9OA 4DR1Q 3G4SA 5GROA 4POGA 1LO5D 4DR6L 3CCRA 1BCPC 1WTHA 3EROA 4JI6L 2Q2HA 1YNJD 4RKBA 5HI7A 3I4NB 5IWAQ 4O42A 4DR7Q 4G75A 2OT2A 4DKAC 3KK7A 4MZ9A 1S4ZA 4LJZC 5I2YA 4WP4A 4LF4L 4HGUA 1B70B 4NXNQ 1UE7A 4G4KA 4APVA 4N8FA 1MGSA 2GKVA 2RSOA 4X65L 3LNNA 2BE5C 2CFMA 4HJ7A 2IWHA 2L1LB 3MXNB 3UDIA 4H13C 4XDXA 1SE8A 5E4XA 1P9ZA 3D31A 2A69D 1MI2A 1WYDA 3NQIA 5IT9E 3I4MH 2VQFQ 3GTKH 2A20A 2RC4A 1PRTD 3CPWA 1NMGA 1B3AA 4X3KA 1K28A 3MFYA 3GTGH 3KLWA 4IFDH 1I3QH 4X6AH 2Z6KA 1SYGA 3TS0A 3I3CA 4BXXG 2F0LA 1TWHH 1BBWA 2RHSB 3Q23A 4DUZL 2VQEQ 3HOZH 4CDDC 4DV7Q 4B08A 4X66L 2NVTH 1G6ZA 2KKMA 3BG3A 3EJIA 4DNRB 1HR0Q 1AZPA 2B2WC 1HZBA 4PZ8A 4KV6A 2KBNA 2E5LQ 3LWEA 1ILQA 3SK4A 4KD4A 1Y1WH 4HJ5A 3AMUA 1K0SA 1PZJD 1YJNA 4LF9L 1CFMA 1D1KA 4DV3L 4LF5L 5M5YB 1L2FA 5FLMH 1YNJC 2NVXH 4HFVA 5KNBA 2OEOA 3RR5A 4IUPA 1I4XA 2JA1A 1SR3A 3RU0A 5C3EH 2K4KA 5CC4A 5CBEE 2UUBQ 1HQRD 4KHZA 4DU9A 3NWTA 1B3QA 2K5VA 3UEYA 5IP7H 4K5VA 4PZ7A 2J87A 5DEHA 1W3SA 3J7ZC 1ENAA 2UU9Q 3SGBI 3HOXG 1X54A 1HUNA 3C2PA 1BXTA 4YCWA 3PGZA 4X3SA 1STHA 1ZYRD 1CHQD 1S40A 2MO1A 2A69C 3VR5A 1Y69U 3FDTA 1X3QA 4DV2L 2KECA 2JAEA 2CQOA 3HKZG 3OXGA 1Q86C 2HIVA 3GTOH 1GHJA 4DAVA 1R0RI 4A3DG 2UXCL 2GSCA 2ZTDA 3KLSX 4OONA 3CCEA 4FYDA 1F9PA 1AH9A 4GOPA 4G7ZC 3EBEA 1J6QA 3S2HB 2NU0I 2K04A 1XYIA 4LFCQ 4DR2L 4RAUC 3G6EA 1LV9A 4ME3A 1CKNB 2L9HA 1SGPI 2R7ZH 2YFAA 2Z4IA 3OOCA 3IKJA 4CGYB 2LXKA 1FD7D 1JE5A 4JYAQ 2MUYA 1ENCA 1EZ6A 1X56A 4BWGB 3I8ZA 4OO1H 5I2XA 1IXRA 5C0XG 2E74C 1HQMC 4TVAB 5JEAH 1XMOL 2DIPA 3H3VC 5ELBA 3S1NH 1EQTA 4B3SL 2CWAA 2KUMA 1EYCA 1S5FD 2PW7A 4Y7NB 3K5MA 3KY9A 2KMOA 2GIVA 5K5PA 3A5UA 3M7NA 4FXKC 3OTOL 1HNZQ 3S1QB 2UUAQ 4R4OA 1HNXL 4HJ9A 5C5MA 1MSHA 3BJUA 5CCMA 3M9BA 5NUCA 5C0XJ 4B3RL 2JP1A 4KKTA 3OIQA 1C8CA 3ZYYX 2WGCA 3D4WA 2A73B 4DV6L 2B63H 5FKAC 1SYFA 3RZOH 1QJOA 4K14A 1TURA 4GXTA 3PIO3 2SEBD 5E3FA 2RVLA 1U4LA 3HKSA 3HH2C 5IYDG 5LMUQ 1AP0A 4KI0A 3Q0AA 1BBXC 4L63B 3C46A 2EJMA 1I4HA 2QGMA 1QNKA 1WOCA 2KQ3A 3MXGA 3QB3A 3A8JE 3PIPA 4U673 1CUKA 2OD1A 2MNAA 3FSYA 3PF4A 4HAEA 2K9HA 2F66B 1A2TA 3R5BA 2IJ0A 4JI4Q 2WB1G 1N34L 2F3WA 2B2VA 2EY2A 2E2DC 5LNK1 5EBDA 1PTOF 3TREA 1A0IA 3U9SA 1PYWD 1XXGA 3TP8A 2SGQI 1UEAB 1UVFA 3DMUA 4DV0L 2IHEA 1F9SA 4OXPA 1Q82C 2K5QA 3HP3A 3KJPA 3J80L 5J8FA 1LABA 4IPDA 2CJSC 4I7ZC 2XTQA 4KHVA 1X55A 3E2IA 4FF3A 4CJ2C 2OXPA 3QR8A 4DV5L 2F03A 3VDPA 4I1TA 2QQEA 1MJAA 3HOXB 2K5DA 1N32Q 2VY3A 1EFID 1X4SA 4KKUA 4DUYQ 2EQSA 3UGLA 1Q3LA 5CR3A 1J5EL 4YZ9A 4LF7L 3DM3A 3U4ZA 3HKZB 4NV2A 4J1MA 1VQ9A 1IY6A 3SDZA 3CU7A 1A8VA 2HIXA 4GOPC 4FXDA 3TOBA 3JAMc 4A3DB 3I55A 2JW6A 3W3AA 3GD7A 4OWWB 1SMXA 3FMCA 1BR9A 1HHVA 2UXBL 4OWXB 2AQ2B 4JBMA 1HJAI 4N9TA 1XPUA 2O5JC 4DK1A 4ME5A 1R9TH 5LMNL 3BVGA 1L1OB 4WRDA 1SE4A 3NTIA 1O78A 3DUZA 4V0BA 3AU7A 4BY7G 3BDLA 5TSSA 1L0WA 3UITA 3X3MA 2X52A 4XQJA 2FUG1 3AYHB 1SYDA 2IX3A 1VCIA 1GUNA 4UP9A 2SNSA 1BMOA 1SBBB 2LXJA 4HR7B 3J7AV 1AN1I 1EQVA 4JVZA 1KAWA 1I6VC 3G71A 2EYHA 4E1PA 2K50A 1NMFA 1VMCA 1DYQA 4HSVA 3HKZE 1JCKB 1HDLA 3KJOA 4QL5A 4PQXA 4UXJA 4XXEA 3S2DB 2FFKB 5JOBA 1EYAA 1BCPB 4DNTB 1V1IA 4YWLA 1UUCA 3E9IA 3AB9A 1SROA 4PNYA 3GTJB 1GHKA 3QJYA 2D62A 2I5HA 2C9OA 4CHTB 4AMLA 1Y1VG 1F2LA 4H7BA 3H15A 2HQLA 3DLLA 3F2DA 3K5OA 1H95A 2EPBA 1H9KA 1TVXA 4F88A 1LTLA 2PI2E 2Z0SA 4IN3A 1PH7A 1QE6A 2I46A 1XNRQ 2XIWA 2K19A 1ICWA 1Z47A 1HXYD 1Z9FA 3UDXA 2F4IA 2K33A 4WFN3 1XWEA 2EYLA 2L12A 4MHEA 3PDNA 4A3GG 2F0MA 2LMCB 2E2HH 3VYSA 2WB1B 4XTCS 1Q1BA 2O2LD 2NBFA 1CSOI 1PRTF 1VQJA 2M00A 2TMPA 1NXUA 3NEMA 4GNXA 4A3CH 2BDOA 3K59A 3S17H 1HPCA 3S1MH 2OZUA 5BR8Q 1FR3A 4IFDI 4OVOA 3DA3A 1IYJB 2CAZB 2KCCA 2I5MX 1R79A 1GJXA 3PUZA 4HCEA 5CYUA 1D1IA 1XPRA 3CQZH 4QF4A 3U58A 1XMQL 2CWFA 1SN8A 4DV1Q 1DOKA 1WTJA 1K7VA 1HTLD 1PH8A 1QILA 2VUMH 3BYYB 1AEXA 2IY5B 1BDOA 1LT3D 1E2ZA 1FGUA 2NVYH 4KHPQ 2B2TC 3A56A 2D9UA 3UE0A 5I6YA 1Y8PB 1STYA 3HOWG 1K7UA 2WB1E 1YJWA 1TWAB 4IUQA 1I6HH 1RODA 1G291 2E2JH 3T1YQ 3NTHA 2D2CC 1CT4I 1ENFA 1SNOA 3NBIA 1M1KC 4A3BH 3M4OB 1M8BA 4K6LA 4YCUA 3NP8A 4YY3L 2HD3A 2RDFA 1N33Q 4BY7B 4RCOA 5ELDA 3E0EA 1AE2A 2G5DA 4ID6A 1CA6A 5E3QA 1VQ7A 3IFDA 2G9HD 1EEID 5FLXc 1G2SA 4HCSA 4JI1Q 3NE5B 4UXIA 2XGTA 1SMYC 3G48A 1LTSD 2RDGA 5D3DA 4TKOB 2P6AC 2HCCA 3QWNA 1TY2A 4LF8L 1VQPA 4JI7L 2WIIB 4NV5A 2KA7A 1DS2I 1B4OA 4A3LG 2LSSA 3JAML 2C5CA 4LW1A 3FSXA 3BZDB 2YQPA 2YU9H 2LEOA 3GTLB 2IP6A 3UDGA 1WTOA 1FJGQ 2R93H 2H1EA 4POFA 1KD1C 2PZWA 1P8LA 1K8OA 1AW7A 3UE1A 3GOXA 1FNWA 5J8CA 3C1EA 2O5IC 3T1HL 2FU2A 1DCZA 1Y1VB 2PNHA 4L8JA 3I73A 5KRUA 4OO1I 2R92G 1HZ9A 3D4DA 5FO9B 3L0IA 1LT6D 4R1JA 3TEHB 3SGQI 3OMCA 2B2UA 2WV6D 3J7YW 3CPFA 3FC3A 1OXXK 3VR4A 1B50A 2CHBD 2XRSD 4A93G 1RD9D 3TP7A 2K52A 2IHFA 4L5TA 4QUFA 3MA2B 4KKSA 4A3MG 4A24A 4DV3Q 4LF5Q 1HCZA 4PV1C 1MJCA 4P2CB 3VA5A 4DAYA 5IOCA 1VQNA 1JOQA 2XTIA 3P75A 2J4XA 2MGSA 2OQKA 2FINB 3URYA 2L4NA 4DV4L 3ICEA 4DR4Q 3VDYA 3HG9A 5M5WH 2JB3A 4A3GB 1IW4A 4HEDA 4OEMB 3UFFA 4MN3A 2YTVA 5EKKA 3HOUH 3F1ZA 2JA7H 3VYUA 3D0FA 3X3NA 1TWFB 3BS1A 2UUCQ 1DOMA 3W1BA 4JI5L 2PMZB 3D8GA 2ALYB 4E1RA 4C56C 1MBYA 2NYZD 2L55A 3K80C 3S24A 4RKLA 1MHWC 2FMMA 4DV2Q 1BNZA 1YO7A 5FJ8H 4KN4C 4ABNA 4LFAL 2UXDQ 2E76C 2KCTA 1PYSB 2UXCQ 4X64Q 2JN4A 4IUNA 3CC7A 3I4MG 1EIGA 4IPHA 4GKJL 2KCMA 2SGPI 2JEBI 2QDBA 4HTHA 4QQBX 2KEDA 1SJHD 1EWHA 3MXUA 4AS2A 2DGYA 4JV5L 5LMNW 4PMCA 3KBXA 2B29A 4FF4A 2H5XA 3GV3A 2EJFC 4BBRH 3CCUA 3UGDA 1N36L 1V1PB 1MJ9A 5DLQE 2A6EC 1BCPD 3R3OA 3CCQA 1N8RC 3PO3H 2LUYA 4J15A 3L3OC 3HOWB 4UXHA 1K73C 1YEZA 2XNAC 3D3RA 5KEEA 2F1MA 4O1NA 1XX6A 1JICA 4QY7A 1Y1WG 4M8AA 1CGJI 3D6WA 2LY7A 2PMZE 4YCVA 3J81i 4HIOA 1BOSA 3K7UC 1SFOB 1NCVA 4CDEC 4GOPB 2BE5D 1E2WA 1PA6A 2N3SA 2NZHA 5IGGA 5FLMG 5KNDA 1L0YB 5C4JB 2A8VA 4B9WA 5JJKA 3T53B 1AZQA 2N52A 2PCFB 3CMAA 2HHHQ 4CKEA 5IP7G 5EPLA 4B3RQ 4UHVA 1JJCB 4JI8Q 5CV9A 2ZXOA 1EIYB 1NSNS 3QWPA 4R4CA 5T1GA 3S14H 5EPJA 4DV6Q 5FUVA 3KLSA 1LM0A 3H09A 2SDFA 4K8JA 2ZXRA 1N9WA 1EU4A 1KABA 5IGBA 5G3LF 2OF1A 3TO7A 2MO0A 2AHOB 1PTOC 2SGDI 2V53A 1GUSA 2B2UC 2I5LX 3WWVA 4A3KG 4IOAA 4QUCA 5IT9c 1LT4D 2A1AA 2R92B 1YHQA 3VR6A 5FLXL 3UDFA 4C2MB 3GTPH 3HZXA 1VMPA 4MNOA 3LJ0A 2SNMA 4HIKA 1O7IA 4KK7A 3M3YH 2PQ8A 2XWJB 3I4NH 5GQOA 2R7ZG 4PL4A 4A93B 1D7QA 1TIID 3BZKA 2CQAA 4PL3A 1S5DD 4RGTA 4CKCA 4OIKA 1I94L 1SXTA 2RCNA 4OO1G 1UVGA 4A3MB 1PHJA 3S15B 2HDLA 3BVZA 3EVQA 1NNXA 2WCYA 2L11A 4PG3A 3C3LA 4NXMQ 1FVIA 2R7FA 3RZDB 1NAPA 1JT8A 1IL8A 3CAMA 4C3IG 1B7YB 1IBKQ 1AN8A 1WTXA 2EVBA 5DAUA 1X74A 3BVMA 3MVVA 4DV5Q 2L7XA 1STBA 4IALA 1PXUA 4GN4B 4F8MA 3TMEA 3J80c 4P74A 1EY9A 2F0QA 1KBEA 1HNWL 4ZUIA 1QOHA 3ITPA 2VNUD 3EA6A 2F0TA 3NELA 3H0GG 5C44H 4JCVE 2B63G 4LF6Q 2VB2X 4S3SA 3I4MB 2EXZA 2KMPA 4DNIA 1H9SA 4B3ML 2UXBQ 1M8AA 1E2VA 3GTGB 4YHHL 1SSOA 3CC2A 2CWPA 3S16B 1PH4A 1Y8FA 1YNNC 4J6HA 2NUCA 3QTLD 1G8ZD 5IYCH 4UP8A 1S5BD 2RIOA 2Y0SG 2QDLA 2PPBC 2NVTB 1A2UA 3R93A 2AMCB 2RBMA 3OL0A 1VQBA 4A3EH 4WJ3M 1Z7TA 1Y1WB 5KYLA 2GVIA 1MJEA 4XIGS 3IL8A 4Q9VA 2WFWA 1TWGH 4BY1G 2QQ0A 5IODA 1YNXA 4P72A 4X62Q 1SGEI 2JA6G 1RJTA 3OSOA 4DK6C 5H1SE 2NN6H 4ZYSA 2NTSA 1SGNI 3LWUA 2YFBA 1TS3A 4RCNA 5IP9H 5BN5A 2PNRC 3VR3A 2P22B 2R61A 2WKDA 1JORA 1CQFA 1Z2IA 2E2IH 1S5ED 1SGDI 1V9PA 2F0JA 2ENNA 3J81E 1I5FA 3BDOA 1KDCA 4HJAA 4YIJA 4B3TL 1YJ9A 1IZ6A 2OCEA 2A19A 3I72A 3RNUA 3S2HH 1E1OA 2NVQB 1CI3M 2N88A 2F0VA 2NTTA 5A2QE 1X9NA 2FHTA 3IFTA 3KOJA 1GM5A 4FF2A 2DKVA 2K5WA 2PQAB 2ARPF 3GTOB 4DF7A 4Q0FA 3JSBA 2RKSA 2K28A 5M3FG 3HOVG 1IYVA 3EFXD 1H9RA 4L9MA 4ZCKA 3K58A 4WJWA 4A3KB 1J9OA 2ORWA 3LX0A 1FYBA 1CGII 4JI0L 3NPPA 3K8AA 1OTCA 2XMXA 5HQ8A 1ONLA 1EEFD 1K8AC 1TS4A 3H94A 3ERQA 1JQYD 4Y7NH 1R4QB 1IW7C 2VL6A 4Y52H 2R7ZB 4JK1C 3OXLA 1V43A 1QUQA 2B39A 4KJNA 3GTQB 1PTQA 3OXFA 2LS01 3S1QH 5EAYA 3ULPA 1X65A 3UOEA 3K5LA 1PZKD 3NQTA 1VQ8A 4QCLA 4RGOS 1K83H 3NTKA 4IZ8A 4K2KA 4K5WA 5IGFA 2GVBA 4R9WA 4A76A 4C3IB 3TZUA 2ZJQA 2DY7A 1EY4A 5AJ3L 1VQMA 4RFBA 3DM1A 2JA5H 1B8AA 1CK1A 4F7XA 4IPCA 3VA7A 2Z6KC 1X3PA 3S1RB 2BH8A 2V1CA 5IT9L 1UE6A 2UZ3A 3DHQA 5HY6A 4AQYL 1HUMA 1O80A 2KENA 3KBGA 1TBRR 1K9MC 1K8GA 1KMAA 5D14A 4BXXH 2Q2TA 3H0GB 1YI2A 1PFSA 1YZ6A 2B63B 3L0OA 5C3XA 3SHLA 1F2MA 3K0XA 1OMUA 2N71A 2JK8A 1IBML 2O4XA 3N6RA 1NY4A 1YITA 4LFBL 1CKOA 3CF5A 3A74A 3MEHA 4C3JG 4RA8A 4DR5L 1PVOA 3CW2C 1CSQA 2XRQD 3HFZB 2EYMA 5C4HA 1UAPA 5GAEC 1K0RA 2N49A 4R4QA 2KHIA 1VQ5A 4JBKA 2Y0SB 4RH6A 2K01A 4DR1L 3KP9A 2XVSA 4P75A 2RIJA 1NUBA 3MFGA 3IAYA 4PMWA 3KF6A 3DO9A 1E24A 1Y14B 3QOJA 1G2TA 4IQZA 2PQEA 3SVMA 2EIFA 5IWAL 2NB0A 4LF8Q 1C48A 2L8EA 1I50H 4EQNA 5JHWC 5ELOA 1HFNA 3FKIG 5M9OA 2F0KA 4BY1B 4ZQ3A 4NXNL 2JA6B 2AUJD 4QMGA 3HOXH 4I7AA 4NPSA 3LJ2A 3CXCA 1P16A 1LUZA 3GDEA 5ELEA 3PV0A 4FVMA 2RDHA 3KYHC 3V2TA 3J7A5 2YTYA 1EYDA 2IX0A 4V190 4U6RA 1TXYA 1CT1D 3T1HQ 2EYJA 2ZRRA 2VQFL 3CD6A 3HRZC 4GKKQ 2N78A 1MT1A 3CCLA 2VUMG 2J0TD 2V6EA 5COYA 1PFMA 2Q2IA 1LLRD 2Y0SE 4OWTB 3KUPA 3DWPA 3M4YA 4ULLA 1D2BA 1HZCA 1DXMA 2ZTEA 4DR3Q 4XYOA 2MJFB 4RGNA 5EPKA 4DV7L 1VS0A 4CDCC 1KNAA 5M3FB 2L5TA 3HOVB 1E3PA 3W5OA 2X69A
chains in the Genus database with same CATH topology
1D8LA 1RFHA 1M8CA 4A3BG 3PUXA 4JI3Q 2B3GA 1PTRA 1IBLL 5EX0A 1XNQQ 4R4TA 1Q12A 3S2DH 1H0ZA 4JBWA 4A4IA 2UUBL 2ZJPA 3GTJH 1PCEA 1SGRI 4DPGA 4LFAQ 1YU6C 1OXSC 2OVOA 1LR9A 3I4OA 1MIUA 1VDDA 2GKTI 1CE3A 1WCMG 5IYDH 4IPGA 1EYGA 1JJ2A 1N36Q 1PH2A 2ELIA 1DS3I 2BUSA 3DA4A 5HGIA 1BVSA 4LFCL 2JA8G 4OX9Q 3CCMA 1NBWA 3VE5A 4GI3C 1VQOA 4JYAL 2HT1A 4LUOA 2R6GA 4JOIA 1EOVA 2K14A 1WI5A 2ZTCA 1W4RA 4AS3A 1HNZL 4YWMA 2UUAL 2NU4I 2D0PA 4C3HH 2OTJA 5M5XH 4RG1A 5M3MG 3IAM1 4JG2A 1HH2P 3A0JA 4DR6Q 4JI6Q 3M4OH 5LMUL 2N17A 3CP0A 2JXDA 4LF4Q 2NN6I 1VQDA 2QA4A 2YTXA 3M4PA 1GVPA 4X65Q 3I9V1 1CSPA 4JI4L 1GKHA 4BBSG 1Q81C 3M85A 1XBTA 1E7ZA 2ZJRA 4NB3A 2BH2A 3F4MA 3AFQA 3F8TA 3H3VH 1TWCH 3GTLH 2R7DA 2F4VL 4L5QA 1HNWQ 1OVOA 2W0TA 2JQOA 1NTGA 3OYYA 1KRTA 4DUZQ 1VQ4A 4X66Q 1PYBA 1Y1VH 2F6MB 3HOYG 2RHQB 1KHIA 4YHHQ 2PI2A 1M90C 4A3FG 4A3JG 5GAHC 1X3FA 4LF9Q 4HJ8A 2E5RA 2OTLA 4UY8C 4TQUS 3BU2A 1OMTA 2ENZA 2JEAI 2KHJA 4A3GH 1OXUA 4GNXC 1RL2A 1VQLA 1U5KA 1Q1EA 1TWFH 5C4XH 2VRWB 1RIPA 1VQFA 2KMRA 3GTMH 3KFUA 4JI2L 2KCXA 4HIDA 1CT2I 4B3TQ 4IFDG 2WAQG 1UWVA 4DR2Q 2J9RA 1LR7A 3HOZG 5C44G 4FKDA 3J80i 3HOWH 5IYBH 1XMOQ 4B3SQ 4JI0Q 3PO2H 3J81j 1SFOH 4R4IA 3OTOQ 5EX3A 1XNRL 3ER0A 1HNXQ 2JE6I 2QPOA 5C3EG 1HPTA 4A3EG 1UE1A 2NU2I 1NE3A 2JB1A 2FXQA 1YTPA 4OAVB 3PUVA 5AJ3Q 4A3LH 1DGSA 4AIMA 4A3IH 1TBQR 5BR8L 3VDUA 1CKMA 4DK3C 1QUQB 1A63A 4DV1L 2QQCA 1KIXA 1C0AA 5C0XI 3JC66 3PIOA 1N34Q 2NU3I 4KHPL 4O1OA 4A93H 1T9HA 4Z7HA 2IX1A 5JEAG 4A3MH 3CC4A 3S15H 2JZMA 3K81C 1BBUA 1UE5A 4DV0Q 3T1YL 4WJ4A 2L15A 2Q2UA 3RZDH 5IE8A 2JA9A 1N33L 1XA6A 3I56A 1TUSA 4OAUC 4JI1L 2CKZB 2WP8J 3A5ZB 5JEAJ 1BUSA 1J5EQ 4LF7Q 1X3EA 4G76A 4Z7GA 4L5RC 3EN2A 1MKHA 2JA5G 3KF6B 2ID0A 1FJGL 4IJHA 5LMNQ 3S16H 3MEFA 2AWOA 2MFIA 5M5YH 2GN5A 4LNQA 3U50C 1V1HA 2GVAA 1S72A 3J81c 2B0UC 4LWCA 3FP9A 4EQ5A 3AEVA 4K0KL 1IBLQ 1YHAA 4YWKA 1XTDA 2K5NA 1QVCA 1X6OA 1EWIA 1NJIC 4DR4L 1TGSI 3TS2A 3RLNA 1WFQA 1SGYI 2VW9A 2WAQE 4EX5A 1SJ8A 1VQKA 4JBJA 3NENA 2UUCL 3KDFA 4HIMA 1Q46A 1IY5A 2NVQH 3D00A 1IL2A 4MTNA 4IOCA 2UXDL 4X64L 2A2DA 2VS1A 4A3KH 3JAMi 1HJPA 1S3OA 1XPOA 5FUXA 1EUJA 2ASBA 1QZGA 3GTQH 3LJ1A 3L2PA 3H3VI 2C35B 2ZM6L 4AH6A 3E59A 2E8GA 3SDJA 4C3IH 3ULLA 1XMQQ 2KMQA 2ODDA 1OYVI 3S1RH 2JYYA 2HHHL 1PH5A 2SGFI 1G51A 4GNXB 1ASZA 2ATWA 4JI8L 5K36G 3H0GH 4SGBI 4YZDA 1JMCA 3TQYA 2BA1A 2FNFX 4P71A 4YY3Q 2YV5A 4FDBA 5DAEA 2B8TA 3RN5A 1LYLA 4DR7L 4JI7Q 4AYBG 2M5XA 2QEXA 2VZAA 4BY1H 2GKRI 4QGUA 4A3CG 5E7NA 2JA6H 1PH6A 3KF8B 4QJFA 4A75A 4NXML 1JB7A 2F4VQ 4P73A 1X3GA 3PF5A 1IBKL 4A3DH 2YUUA 1TBNA 1Y1CA 4IO9A 2QQDA 2K75A 2D0OA 1UEBA 3CMEA 4O2DA 2VQEL 4LF6L 1EQRA 1HR0L 3VA9A 5M3FH 1E1TA 3HOVH 3P23A 3AFPA 2E5LL 5JJIA 4DV4Q 4O0AA 2QGQA 1TIHA 4KLKA 2NU1I 4JC0A 5ELNA 4JI5Q 4GLVB 5JJLA 5HGQA 3FBVA 3SGIA 3AQQA 3CCJA 2MQHA 2DB6A 4DAYB 4X62L 2V1CC 4JI2Q 2UU9L 4GKJQ 1CKNA 2PQAA 1LR8A 2R93G 4JV5Q 3ULJA 4BA1I 3F2CA 4RMFA 3B6YA 2F52A 3BZCA 3UEJA 4C3JH 5CCLA 3PUYA 1PH1A 5FUWA 2YYZA 1BKBA 1SGQI 4GN5A 2N1AB 3PUWA 1VQGA 2AWNA 4ALPA 4DWLA 1PH3A 1VQHA 4LUVA 3PSIA 4GN3B 4LUZA 1OXTA 3HOUG 2JA7G 1TOTA 3RLFA 3FKIH 3RLOA 1CT0I 5C4XG 2E73A 3BJIA 1K3RA 2IT1A 3CCSA 1GD7A 5FJ8G 1XJVA 1QVFA 1G6PA 4IJLA 4PL5A 3SEKC 3ERSX 1C7YA 1TWAH 1U0LA 3FHWA 3UGIA 1GO3E 3K7AH 4BBRG 2DUDA 4BY7H 3PO3G 4PZ6A 1I94Q 5IYBG 1KL9A 4AYBE 3MEKA 4L5SA 1OXVA 1SRUA 2WVJA 2NZOA 1YBYA 4GS3A 5GADC 1PV4A 3LGJA 3PO2G 1SLJA 4O1PA 3STBD 1AE3A 1EQQA 2N8NA 1EFWA 2JJQA 3TRZA 5FUYA 3CCVA 2ORVA 5IY0A 3E9HA 1L1OA 4A3IG 1N32L 1Z7KB 1N13A 4B3MQ 2I0QA 4DUYL 1FARA 1YVCA 3PCOB 4GLAC 1ASYA 1WCMH 2JB2A 4B6DA 4GKKL 1VQEA 1JJGA 1KXLA 2AKWB 5GAGC 3I4NG 2JA8H 1YHBA 1HZAA 1V1QA 4DR3L 1QZHA 1TURA 2OQ0A 4K0KQ 4JOIC 3L7ZC 1QVGA 1EIFA 1KBFA 3STBC 3Q8DA 5J3BA 2BA0A 4JI3L 1VQ6A 3RN2A 3IAS1 1CHOI 3TJQA 3OW2A 1XNQL 4H02A 4GLXA 2ROWA 1TBOA 2XRCA 1VQCA 3M4QA 3GO5A 1A62A 2F3CI 1WJJA 3B4VC 1HR0W 5M3MH 1E22A 1Q7YC 2RF4A 3U4VA 4BA2I 4YZCA 1Y1BA 4DAMA 1PPFI 3CXLA 4IFDJ 5IYCG 2K5HA 3KDFB 4UPAA 2XTRA 5C4JH 3W1GA 2ZM6Q 4OX9L 1KQSA 1FAQA 4BBSH 2NN6G 2OWOA 5IP9G 1PJUA 2SGEI 4HEA1 2ES2A 3F2BA 3OVOA 1W2BA 1VQAA 3NBHB 1YIJA 4AQYQ 3IRBA 1L1OC 3ZJYC 3EIVA 1KC8C 2F3IA 1FL0A 4UP7A 1PH9A 3I7FA 2R92H 1IBMQ 1Q8KA 3I2ZA 4LFBQ 4C2MH 3AJFA 1KRSA 2A2CA 3HOYH 2EXDA 4DR5Q 1VQIA 4A3FH 2ERWA 4A3JH 4QIWE 2CCZA 1C9OA 4DR1Q 3G4SA 5GROA 4POGA 4DR6L 3CCRA 4JI6L 2Q2HA 5HI7A 5IWAQ 4DR7Q 4G75A 4DKAC 4MZ9A 4LF4L 4HGUA 1B70B 4NXNQ 1UE7A 4APVA 2GKVA 4X65L 2CFMA 4HJ7A 2L1LB 3MXNB 3UDIA 1SE8A 3D31A 1WYDA 3I4MH 2VQFQ 3GTKH 2A20A 3CPWA 1NMGA 3GTGH 3KLWA 1I3QH 4X6AH 2Z6KA 3TS0A 4BXXG 2RHSB 1TWHH 1BBWA 4DUZL 3HOZH 2VQEQ 4DV7Q 4X66L 2NVTH 2KKMA 1HR0Q 1HZBA 4PZ8A 2KBNA 2E5LQ 1Y1WH 4HJ5A 1YJNA 4LF9L 4DV3L 4LF5L 1L2FA 5FLMH 2NVXH 4HFVA 3RR5A 2JA1A 1SR3A 3RU0A 5C3EH 2K4KA 2UUBQ 4KHZA 3UEYA 2K5VA 5IP7H 4PZ7A 2J87A 1W3SA 3J7ZC 2UU9Q 3SGBI 3HOXG 1X54A 4YCWA 3PGZA 1S40A 2MO1A 4DV2L 2JAEA 2CQOA 3HKZG 3OXGA 1Q86C 2HIVA 3GTOH 1R0RI 4A3DG 2UXCL 2ZTDA 4OONA 3CCEA 1AH9A 4GOPA 3EBEA 1J6QA 2NU0I 4LFCQ 4DR2L 3G6EA 4ME3A 1CKNB 1SGPI 2R7ZH 2YFAA 2LXKA 1JE5A 4JYAQ 1X56A 1IXRA 5C0XG 4TVAB 1XMOL 2DIPA 3S1NH 4B3SL 2CWAA 3KY9A 2KMOA 3A5UA 3M7NA 3OTOL 1HNZQ 2UUAQ 4R4OA 1HNXL 4HJ9A 3BJUA 5CCMA 3M9BA 5C0XJ 4B3RL 4DV6L 2B63H 3RZOH 4GXTA 3HKSA 3HH2C 5IYDG 5LMUQ 4KI0A 1WOCA 3PIPA 1CUKA 2OD1A 2MNAA 3PF4A 2K9HA 2F66B 4JI4Q 2WB1G 1N34L 5LNK1 3TREA 1A0IA 2SGQI 1UVFA 4DV0L 2IHEA 4OXPA 1Q82C 3KJPA 4IPDA 2CJSC 2XTQA 1X55A 3E2IA 4DV5L 3VDPA 4I1TA 2QQEA 1N32Q 2VY3A 1X4SA 4DUYQ 2EQSA 3UGLA 1J5EL 4YZ9A 4LF7L 3DM3A 3U4ZA 4NV2A 1VQ9A 1IY6A 1A8VA 2HIXA 4GOPC 3JAMc 2JW6A 3I55A 3GD7A 4OWWB 1SMXA 2UXBL 4OWXB 4JBMA 1HJAI 1XPUA 1R9TH 5LMNL 1L1OB 4BY7G 1L0WA 3UITA 2FUG1 3AYHB 1VCIA 4UP9A 1BMOA 2LXJA 1AN1I 1KAWA 3G71A 4E1PA 2K50A 1NMFA 3HKZE 1HDLA 3KJOA 4QL5A 4UXJA 1V1IA 4YWLA 1UUCA 3E9IA 1SROA 2D62A 2I5HA 1Y1VG 3H15A 2HQLA 3DLLA 3F2DA 1H95A 1LTLA 2PI2E 2Z0SA 1PH7A 1XNRQ 2K19A 1Z47A 1Z9FA 3UDXA 3PDNA 4A3GG 2E2HH 4XTCS 1Q1BA 1CSOI 1VQJA 3NEMA 4GNXA 4A3CH 3S17H 3S1MH 5BR8Q 4IFDI 4OVOA 3DA3A 1IYJB 2CAZB 2I5MX 1R79A 3PUZA 1XPRA 3CQZH 3U58A 1XMQL 1SN8A 4DV1Q 1PH8A 2VUMH 2IY5B 1FGUA 2NVYH 4KHPQ 3UE0A 3HOWG 2WB1E 1YJWA 1I6HH 1G291 2E2JH 3T1YQ 1CT4I 1M1KC 4A3BH 1M8BA 4YCUA 4YY3L 1N33Q 3E0EA 1AE2A 1VQ7A 5FLXc 4JI1Q 4UXIA 2XGTA 3G48A 2P6AC 4LF8L 1VQPA 4JI7L 4NV5A 1DS2I 4A3LG 2LSSA 4LW1A 2YQPA 2YU9H 2LEOA 2IP6A 3UDGA 1FJGQ 2R93H 4POFA 1KD1C 1P8LA 3UE1A 3GOXA 3T1HL 2PNHA 4OO1I 2R92G 1HZ9A 3L0IA 4R1JA 3TEHB 3SGQI 3CPFA 3FC3A 1OXXK 4A93G 2K52A 2IHFA 4L5TA 4A3MG 4A24A 4DV3Q 4LF5Q 1MJCA 1VQNA 2XTIA 2OQKA 4DV4L 3ICEA 4DR4Q 3VDYA 5M5WH 2JB3A 1IW4A 3UFFA 2YTVA 3HOUH 3F1ZA 2JA7H 3D0FA 2UUCQ 3W1BA 4JI5L 2ALYB 4E1RA 3S24A 3K80C 4DV2Q 1YO7A 5FJ8H 4LFAL 2UXDQ 2KCTA 1PYSB 2UXCQ 4X64Q 3CC7A 3I4MG 4IPHA 4GKJL 2KCMA 2SGPI 2JEBI 4QQBX 4AS2A 2DGYA 4JV5L 5LMNW 2B29A 2H5XA 4BBRH 3CCUA 3UGDA 1N36L 5DLQE 3CCQA 1N8RC 3PO3H 2LUYA 4J15A 4UXHA 1K73C 1YEZA 1XX6A 4QY7A 1Y1WG 1CGJI 2PMZE 4YCVA 3J81i 4HIOA 3K7UC 4GOPB 1PA6A 2N3SA 2NZHA 5FLMG 2A8VA 5JJKA 2N52A 3CMAA 2HHHQ 5IP7G 4B3RQ 1JJCB 4JI8Q 1EIYB 3QWPA 4R4CA 3S14H 4DV6Q 5FUVA 1LM0A 1N9WA 2MO0A 2AHOB 2SGDI 2V53A 2I5LX 3WWVA 4A3KG 4IOAA 5IT9c 2A1AA 1YHQA 3UDFA 3GTPH 4MNOA 3LJ0A 4HIKA 1O7IA 3M3YH 3I4NH 5GQOA 2R7ZG 4PL4A 1D7QA 3BZKA 4PL3A 1I94L 2RCNA 4OO1G 1UVGA 1PHJA 2WCYA 4PG3A 4NXMQ 1FVIA 2R7FA 1JT8A 3CAMA 1B7YB 1IBKQ 1X74A 4DV5Q 2L7XA 4GN4B 3J80c 4P74A 1KBEA 1HNWL 2VNUD 3NELA 3H0GG 5C44H 4JCVE 2B63G 4LF6Q 2KMPA 4DNIA 4B3ML 2UXBQ 4YHHL 3CC2A 2CWPA 1PH4A 1Y8FA 3QTLD 5IYCH 4UP8A 2RIOA 2Y0SG 2AMCB 3OL0A 1VQBA 4A3EH 4WJ3M 2GVIA 1MJEA 4XIGS 4Q9VA 2WFWA 1TWGH 4BY1G 2QQ0A 4X62Q 1YNXA 4P72A 1SGEI 2JA6G 5H1SE 4DK6C 1SGNI 5IP9H 2YFBA 2P22B 2E2IH 1SGDI 1V9PA 2ENNA 1I5FA 4HJAA 4B3TL 1YJ9A 1IZ6A 2OCEA 2A19A 3RNUA 3S2HH 1E1OA 1X9NA 3KOJA 1GM5A 2PQAB 2ARPF 3JSBA 5M3FG 3HOVG 4L9MA 2ORWA 1FYBA 1CGII 4JI0L 3K8AA 1OTCA 2XMXA 5HQ8A 1K8AC 4Y7NH 2VL6A 4Y52H 3OXLA 1V43A 1QUQA 1PTQA 3OXFA 3S1QH 5EAYA 3ULPA 1X65A 1VQ8A 1K83H 2GVBA 4A76A 2ZJQA 5AJ3L 1VQMA 2JA5H 1B8AA 4IPCA 2Z6KC 2BH8A 2V1CA 1UE6A 2UZ3A 5HY6A 4AQYL 2KENA 1TBRR 1K9MC 1K8GA 1KMAA 4BXXH 2Q2TA 1YI2A 1PFSA 1YZ6A 3L0OA 1OMUA 2N71A 3K0XA 2JK8A 1IBML 1NY4A 1YITA 4LFBL 1CKOA 3CF5A 3A74A 1PVOA 4DR5L 3CW2C 1CSQA 3HFZB 5GAEC 1K0RA 2N49A 4R4QA 2KHIA 1VQ5A 4JBKA 4DR1L 3KP9A 4P75A 1NUBA 4PMWA 3KF6A 3DO9A 1E24A 1Y14B 2EIFA 5IWAL 4LF8Q 2L8EA 1I50H 5JHWC 5ELOA 3FKIG 4NXNL 3HOXH 4NPSA 3LJ2A 3CXCA 1P16A 1LUZA 3GDEA 3PV0A 3KYHC 3J7A5 2YTYA 2IX0A 4U6RA 1TXYA 3T1HQ 3CD6A 2ZRRA 2VQFL 4GKKQ 2N78A 1MT1A 3CCLA 2VUMG 2V6EA 2Q2IA 2Y0SE 4OWTB 1HZCA 2ZTEA 4DR3Q 2MJFB 4DV7L 1VS0A 1E3PA 3W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O C;  3G48 A;  3ZJY C;  4X64 L;  3EIV A;  1KC8 C;  2F3I A;  1D8L A;  1FL0 A;  4LF8 L;  2VS1 A;  1VQP A;  4JI7 L;  4A3K H;  4A3B G;  4UP7 A;  1PH9 A;  3PUX A;  4JI3 Q;  3I7F A;  3JAM i;  2B3G A;  2R92 H;  1IBM Q;  1IBL L;  1HJP A;  1Q8K A;  1S3O A;  2LSS A;  3I2Z A;  4A3L G;  4LFB Q;  4C2M H;  1XPO A;  1KRS A;  4LW1 A;  3HOY H;  2EXD A;  4DR5 Q;  2YU9 H;  1VQI A;  1XNQ Q;  1EUJ A;  3UDG A;  1FJG Q;  2ASB A;  4R4T A;  2R93 H;  1Q12 A;  3S2D H;  4POF A;  1KD1 C;  4A3F H;  1QZG A;  1P8L A;  4JBW A;  3GTQ H;  4A4I A;  3UE1 A;  4A3J H;  3L2P A;  3H3V I;  2UUB L;  4QIW E;  2ZJP A;  2CCZ A;  2C35 B;  2ZM6 L;  1C9O A;  3GTJ H;  4DR1 Q;  3G4S A;  3T1H L;  2PNH A;  4AH6 A;  4OO1 I;  2E8G A;  5GRO A;  2R92 G;  1HZ9 A;  4DPG A;  4LFA Q;  4POG A;  4DR6 L;  3CCR A;  4R1J A;  4JI6 L;  3TEH B;  2Q2H A;  4C3I H;  1OXS C;  3ULL A;  3CPF A;  5IWA Q;  4DR7 Q;  3I4O A;  4DKA C;  1OXX K;  1MIU A;  1XMQ Q;  4MZ9 A;  4A93 G;  4LF4 L;  2K52 A;  3S1R H;  1B70 B;  4NXN Q;  2IHF A;  1UE7 A;  4L5T A;  4APV A;  1WCM G;  5IYD H;  4A3M G;  4DV3 Q;  4LF5 Q;  2HHH L;  4IPG A;  1PH5 A;  4X65 L;  1JJ2 A;  1N36 Q;  1EYG A;  1G51 A;  4GNX B;  1MJC A;  2CFM A;  1ASZ A;  2ATW A;  1PH2 A;  1VQN A;  2XTI A;  4JI8 L;  4HJ7 A;  2OQK A;  3MXN B;  3UDI A;  4DV4 L;  3ICE A;  4DR4 Q;  5K36 G;  3VDY A;  1SE8 A;  3H0G H;  5M5W H;  3D31 A;  1JMC A;  3TQY A;  2BA1 A;  1WYD A;  1BVS A;  4LFC L;  2JA8 G;  4OX9 Q;  3I4M H;  2VQF Q;  3GTK H;  3CCM A;  2YTV A;  1NBW A;  3HOU H;  3F1Z A;  2JA7 H;  3D0F A;  3CPW A;  1NMG A;  2UUC Q;  4P71 A;  4JI5 L;  3W1B A;  3KLW A;  4YY3 Q;  3GTG H;  1I3Q H;  1VQO A;  4JYA L;  2ALY B;  4X6A H;  2YV5 A;  3K80 C;  4FDB A;  2Z6K A;  3S24 A;  2HT1 A;  3TS0 A;  4BXX G;  2RHS B;  1TWH H;  1BBW A;  2R6G A;  4LUO A;  4JOI A;  2VQE Q;  4DUZ L;  4DV2 Q;  5FJ8 H;  3HOZ H;  4DV7 Q;  1EOV A;  4X66 L;  2K14 A;  1WI5 A;  2NVT H;  4LFA L;  2ZTC A;  2UXD Q;  1HR0 Q;  2KCT A;  3RN5 A;  1PYS B;  2UXC Q;  4X64 Q;  3CC7 A;  3I4M G;  1HZB A;  1LYL A;  4PZ8 A;  4IPH A;  2KBN A;  4GKJ L;  2KCM A;  2E5L Q;  4DR7 L;  2JEB I;  4JI7 Q;  4AYB G;  1HNZ L;  4QQB X;  4YWM A;  1Y1W H;  4HJ5 A;  2QEX A;  2VZA A;  2DGY A;  2UUA L;  4BY1 H;  5LMN W;  4JV5 L;  4QGU A;  4A3C G;  2B29 A;  1YJN A;  2D0P A;  4LF9 L;  4C3H H;  2H5X A;  5E7N A;  2OTJ A;  2JA6 H;  4DV3 L;  5M5X H;  1E3P A;  4BBR H;  3CCU A;  4LF5 L;  1PH6 A;  1L2F A;  3KF8 B;  5FLM H;  1N36 L;  2NVX H;  5DLQ E;  4QJF A;  4RG1 A;  3CCQ A;  4A75 A;  1N8R C;  4NXM L;  3PO3 H;  3RR5 A;  4J15 A;  5M3M G;  1JB7 A;  2F4V Q;  4P73 A;  1SR3 A;  1K73 C;  1X3G A;  5C3E H;  3PF5 A;  1IBK L;  2K4K A;  1YEZ A;  2UUB Q;  4KHZ A;  4A3D H;  2K5V A;  4JG2 A;  4QY7 A;  5IP7 H;  1Y1W G;  1HH2 P;  3A0J A;  4PZ7 A;  2PMZ E;  4YCV A;  3J81 i;  4HIO A;  4DR6 Q;  4IO9 A;  1W3S A;  3K7U C;  3J7Z C;  2UU9 Q;  4JI6 Q;  3M4O H;  3HOX G;  1X54 A;  5LMU L;  4GOP B;  1PA6 A;  2N3S A;  2NZH A;  4YCW A;  3PGZ A;  5FLM G;  3CP0 A;  2K75 A;  1S40 A;  2MO1 A;  2D0O A;  2A8V A;  1UEB A;  3CME A;  4O2D A;  2NN6 I;  4DV2 L;  4LF4 Q;  2CQO A;  2VQE L;  3HKZ G;  5JJK A;  1Q86 C;  1VQD A;  2HIV A;  2QA4 A;  4LF6 L;  2YTX A;  3GTO H;  3M4P A;  1EQR A;  1GVP A;  3CMA A;  1HR0 L;  4A3D G;  5M3F H;  2HHH Q;  1E1T A;  4X65 Q;  3HOV H;  5IP7 G;  2UXC L;  4B3R Q;  1CSP A;  4JI4 L;  3AFP A;  1JJC B;  1GKH A;  2ZTD A;  4OON A;  4JI8 Q;  3CCE A;  2E5L L;  5JJI A;  4BBS G;  1EIY B;  4DV4 Q;  4R4C A;  3S14 H;  1Q81 C;  1AH9 A;  3M85 A;  4GOP A;  4DV6 Q;  3EBE A;  1J6Q A;  1E7Z A;  1LM0 A;  2ZJR A;  4NB3 A;  4LFC Q;  2BH2 A;  4DR2 L;  4O0A A;  3G6E A;  1N9W A;  4ME3 A;  3AFQ A;  1CKN B;  2QGQ A;  3F8T A;  4KLK A;  3H3V H;  2R7Z H;  1TWC H;  3GTL H;  4JC0 A;  5ELN A;  2LXK A;  4JI5 Q;  1JE5 A;  2R7D A;  4GLV B;  2F4V L;  4L5Q A;  4JYA Q;  5JJL A;  2MO0 A;  1X56 A;  2AHO B;  1HNW Q;  1IXR A;  5HGQ A;  5C0X G;  2JQO A;  1NTG A;  3AQQ A;  3OYY A;  4TVA B;  2I5L X;  1KRT A;  3SGI A;  3WWV A;  3CCJ A;  4DUZ Q;  4A3K G;  1VQ4 A;  2MQH A;  5IT9 c;  4B3S L;  2A1A A;  2CWA A;  4IOA A;  4X66 Q;  1YHQ A;  1PYB A;  1Y1V H;  4DAY B;  3UDF A;  4X62 L;  3GTP H;  2V1C C;  4JI2 Q;  2UU9 L;  4MNO A;  3A5U A;  4HIK A;  3HOY G;  1O7I A;  3M7N A;  1CKN A;  3M3Y H;  2PQA A;  4GKJ Q;  2RHQ B;  3OTO L;  5GQO A;  1KHI A;  3I4N H;  1HNZ Q;  2R7Z G;  1D7Q A;  3BZK A;  2R93 G;  4YHH Q;  2PI2 A;  1M90 C;  4A3F G;  2UUA Q;  4JV5 Q;  4R4O A;  3ULJ A;  1I94 L;  1HNX L;  4HJ9 A;  4A3J G;  5GAH C;  2RCN A;  4OO1 G;  1X3F A;  4BA1 I;  4HJ8 A;  4LF9 Q;  1PHJ A;  3BJU A;  3M9B A;  5C0X J;  2OTL A;  4B3R L;  4PG3 A;  4UY8 C;  4NXM Q;  1FVI A;  4TQU S;  3BU2 A;  2R7F A;  3F2C A;  1JT8 A;  3CAM A;  4DV6 L;  1B7Y B;  2B63 H;  1IBK Q;  3RZO H;  2JEA I;  4RMF A;  3B6Y A;  2KHJ A;  2F52 A;  4A3G H;  1OXU A;  3BZC A;  1RL2 A;  4GNX C;  1VQL A;  4DV5 Q;  4C3J H;  3HKS A;  3PUY A;  1PH1 A;  4GN4 B;  1U5K A;  1Q1E A;  5IYD G;  3J80 c;  5LMU Q;  1TWF H;  2YYZ A;  1BKB A;  4KI0 A;  4P74 A;  3S1N H;  4GN5 A;  5C4X H;  1HNW L;  3PUW A;  1RIP A;  1VQG A;  1VQF A;  2AWN A;  2VNU D;  4ALP A;  1WOC A;  3PIP A;  3NEL A;  3GTM H;  3H0G G;  1CUK A;  4JCV E;  5C44 H;  2MNA A;  2B63 G;  4LF6 Q;  1PH3 A;  3PF4 A;  3KFU A;  1VQH A;  4LUV A;  3PSI A;  4JI2 L;  4GN3 B;  4LUZ A;  4JI4 Q;  2WB1 G;  4DNI A;  4B3M L;  2UXB Q;  1OXT A;  1N34 L;  3HOU G;  4HID A;  2JA7 G;  4B3T Q;  3RLF A;  4YHH L;  3FKI H;  3CC2 A;  4IFD G;  2CWP A;  2WAQ G;  1UWV A;  3RLO A;  3TRE A;  1PH4 A;  1A0I A;  5C4X G;  4DR2 Q;  5IYC H;  4UP8 A;  1K3R A;  2IT1 A;  3CCS A;  3HOZ G;  1GD7 A;  2Y0S G;  5FJ8 G;  5C44 G;  1XJV A;  4DV0 L;  3J80 i;  2IHE A;  4OXP A;  1QVF A;  2AMC B;  1G6P A;  4IJL A;  1Q82 C;  3KJP A;  3HOW H;  1VQB A;  5IYB H;  4A3E H;  3ERS X;  4WJ3 M;  4IPD A;  1XMO Q;  1C7Y A;  1X55 A;  1TWA H;  4B3S Q;  4JI0 Q;  1U0L A;  1MJE A;  4XIG S;  4DV5 L;  2WFW A;  3FHW A;  1TWG H;  4BY1 G;  4X62 Q;  1YNX A;  4P72 A;  1GO3 E;  1N32 Q;  3K7A H;  2VY3 A;  2JA6 G;  3J81 j;  5H1S E;  4DK6 C;  1SFO H;  4BBR G;  3PO2 H;  4DUY Q;  4R4I A;  2EQS A;  3OTO Q;  5IP9 H;  2DUD A;  1XNR L;  1J5E L;  3PO3 G;  4LF7 L;  4BY7 H;  3ER0 A;  4PZ6 A;  3DM3 A;  3U4Z A;  1VQ9 A;  1I94 Q;  1HNX Q;  2JE6 I;  1A8V A;  2HIX A;  5IYB G;  5C3E G;  4GOP C;  1UE1 A;  4A3E G;  3JAM c;  3I55 A;  1KL9 A;  2E2I H;  1NE3 A;  4AYB E;  3GD7 A;  4OWW B;  1SMX A;  4L5S A;  1OXV A;  1V9P A;  2UXB L;  4OWX B;  1SRU A;  1I5F A;  4JBM A;  2FXQ A;  2NZO A;  1YBY A;  4GS3 A;  5GAD C;  4HJA A;  3LGJ A;  1PV4 A;  4B3T L;  1XPU A;  3PO2 G;  1YJ9 A;  1R9T H;  1IZ6 A;  5LMN L;  1SLJ A;  2OCE A;  2A19 A;  3PUV A;  5AJ3 Q;  3RNU A;  3S2H H;  1E1O A;  4A3L H;  1L1O B;  1DGS A;  3STB D;  4AIM A;  4A3I H;  4BY7 G;  1AE3 A;  1X9N A;  3KOJ A;  1L0W A;  1EQQ A;  1GM5 A;  2N8N A;  5BR8 L;  2PQA B;  1CKM A;  4DK3 C;  3AYH B;  1QUQ B;  1EFW A;  5M3F G;  1VCI A;  3HOV G;  1A63 A;  2JJQ A;  4UP9 A;  3TRZ A;  2LXJ A;  3CCV A;  4DV1 L;  4JI0 L;  1KIX A;  3K8A A;  5IY0 A;  1OTC A;  1KAW A;  3E9H A;  1C0A A;  5C0X I;  3G71 A;  1L1O A;  3JC6 6;  1K8A C;  3PIO A;  2K50 A;  1NMF A;  4Y7N H;  4A3I G;  1N32 L;  2VL6 A;  2I0Q A;  4B3M Q;  4DUY L;  4Y52 H;  3HKZ E;  1N34 Q;  3KJO A;  4QL5 A;  4KHP L;  1V43 A;  1QUQ A;  1YVC A;  4A93 H;  3S1Q H;  1T9H A;  3PCO B;  4GLA C;  5EAY A;  3ULP A;  1ASY A;  2IX1 A;  4YWL A;  1X65 A;  1WCM H;  3E9I A;  5JEA G;  4A3M H;  1SRO A;  1VQ8 A;  3CC4 A;  3S15 H;  3K81 C;  1BBU A;  1UE5 A;  2D62 A;  2I5H A;  1K83 H;  4DV0 Q;  1Y1V G;  4GKK L;  1VQE A;  2GVB A;  3T1Y L;  4WJ4 A;  2L15 A;  3H15 A;  2HQL A;  3DLL A;  4A76 A;  2Q2U A;  3F2D A;  1JJG A;  3RZD H;  2ZJQ A;  5IE8 A;  1KXL A;  2AKW B;  5AJ3 L;  1H95 A;  2JA9 A;  5GAG C;  1VQM A;  2JA5 H;  1N33 L;  3I4N G;  1B8A A;  2JA8 H;  1YHB A;  1HZA A;  1V1Q A;  3I56 A;  4DR3 L;  4IPC A;  1QZH A;  2Z6K C;  1LTL A;  2BH8 A;  2OQ0 A;  2PI2 E;  2Z0S A;  4K0K Q;  4JOI C;  1UE6 A;  4JI1 L;  2CKZ B;  2WP8 J;  3A5Z B;  3L7Z C;  5HY6 A;  1EIF A;  1QVG A;  4AQY L;  1PH7 A;  5JEA J;  2KEN A;  1XNR Q;  1J5E Q;  1K9M C;  1K8G A;  4LF7 Q;  4BXX H;  1X3E A;  3STB C;  2Q2T A;  3Q8D A;  1YI2 A;  1Z47 A;  5J3B A;  1PFS A;  1YZ6 A;  1Z9F A;  2BA0 A;  3L0O A;  4JI3 L;  3UDX A;  3K0X A;  4L5R C;  1VQ6 A;  2JK8 A;  1IBM L;  3EN2 A;  1MKH A;  3RN2 A;  1NY4 A;  3KF6 B;  1YIT A;  2JA5 G;  1CKO A;  4A3G G;  2E2H H;  4LFB L;  2ID0 A;  4XTC S;  3CF5 A;  1Q1B A;  3A74 A;  1PVO A;  4DR5 L;  3OW2 A;  1XNQ L;  3CW2 C;  4H02 A;  1VQJ A;  1CSQ A;  4GLX A;  4IJH A;  1FJG L;  3HFZ B;  3NEM A;  5LMN Q;  1VQC A;  4GNX A;  4A3C H;  3S16 H;  3MEF A;  2AWO A;  2MFI A;  3M4Q A;  1K0R A;  2N49 A;  1A62 A;  3GO5 A;  5GAE C;  4R4Q A;  2KHI A;  1WJJ A;  1VQ5 A;  4JBK A;  3S17 H;  3S1M H;  5BR8 Q;  4DR1 L;  4IFD I;  5M5Y H;  4P75 A;  2GN5 A;  4LNQ A;  1IYJ B;  3U50 C;  4PMW A;  2GVA A;  3KF6 A;  2I5M X;  1E24 A;  1S72 A;  1HR0 W;  1Y14 B;  5M3M H;  3J81 c;  1E22 A;  1Q7Y C;  3PUZ A;  1XPR A;  2EIF A;  3CQZ H;  2RF4 A;  5IWA L;  3U58 A;  4LF8 Q;  1I50 H;  4LWC A;  1XMQ L;  1SN8 A;  4DV1 Q;  5ELO A;  3U4V A;  4BA2 I;  3FKI G;  3FP9 A;  4EQ5 A;  3AEV A;  4K0K L;  4NXN L;  4DAM A;  1PH8 A;  1IBL Q;  2VUM H;  1YHA A;  4YWK A;  1XTD A;  3HOX H;  4IFD J;  5IYC G;  2K5H A;  2K5N A;  1QVC A;  3KDF B;  4NPS A;  2IY5 B;  3CXC A;  1P16 A;  1FGU A;  1X6O A;  2NVY H;  1LUZ A;  4UPA A;  4KHP Q;  1EWI A;  3UE0 A;  5C4J H;  3GDE A;  1NJI C;  3PV0 A;  4DR4 L;  3KYH C;  3J7A 5;  3HOW G;  2YTY A;  2WB1 E;  2IX0 A;  3W1G A;  1YJW A;  1TXY A;  3TS2 A;  2ZM6 Q;  3T1H Q;  4OX9 L;  3RLN A;  1WFQ A;  1KQS A;  2VQF L;  3CD6 A;  1I6H H;  2VW9 A;  4GKK Q;  1G29 1;  2WAQ E;  2N78 A;  2E2J H;  4EX5 A;  3T1Y Q;  3CCL A;  4BBS H;  2VUM G;  1M1K C;  4A3B H;  1VQK A;  4JBJ A;  3NEN A;  1XMO L;  2UUC L;  4YCU A;  3KDF A;  2NN6 G;  2Q2I A;  4YY3 L;  4HIM A;  2Y0S E;  4OWT B;  2OWO A;  1Q46 A;  1N33 Q;  5IP9 G;  2NVQ H;  3E0E A;  1AE2 A;  1HZC A;  2ZTE A;  4DR3 Q;  2ES2 A;  1VQ7 A;  3F2B A;  5FLX c;  1W2B A;  1IL2 A;  4DV7 L;  1VQA A;  1VS0 A;  4JI1 Q;  3NBH B;  4MTN A;  4IOC A;  2UXD L;  2XGT A;  1YIJ A;  4AQY Q;  3W5O A;  3IRB A; 
#chains in the Genus database with same CATH topology
 3FVV A;  1D8L A;  1RFH A;  2PZU A;  5C0X H;  1WTR A;  1M8C A;  1WTW A;  4A3B G;  3PUX A;  2QW7 A;  4JI3 Q;  4FO2 A;  2B3G A;  1PTR A;  1IBL L;  2CWH A;  1PTO B;  2D5D A;  5EX0 A;  4FNF A;  2PYK A;  1XNQ Q;  3E5S A;  3OWF A;  4R4T A;  1Q12 A;  5AFW A;  4L6T B;  2F0D A;  3S2D H;  1H0Z A;  4JBW A;  3FPP A;  4A4I A;  3NUC A;  2UUB L;  2ZJP A;  5E3P A;  1K3B C;  3GTJ H;  1PCE A;  1SGR I;  4DPG A;  3R2I A;  4LFA Q;  1XTC D;  1YU6 C;  5K36 H;  4TSS A;  1OXS C;  2OVO A;  2I07 B;  1LR9 A;  4OGQ C;  3I4O A;  1MIU A;  1VDD A;  2GKT I;  1DD2 A;  1CE3 A;  1CZW A;  1O7Y A;  1WCM G;  3P1H A;  1T5E A;  4CKB A;  5IYD H;  3MZ5 A;  4UDU C;  4IPG A;  1EYG A;  1JJ2 A;  1N36 Q;  1UUP A;  4JW0 A;  1PH2 A;  4MPI A;  5LL6 S;  2ELI A;  1DS3 I;  4XYQ A;  1SND A;  1T5X D;  2B8F A;  2B2V C;  1SAP A;  2BUS A;  3DA4 A;  5HGI A;  2EOT A;  1SYC A;  1GUG A;  1BVS A;  4KTA A;  4LFC L;  2JA8 G;  5CV7 A;  4OX9 Q;  4C3J B;  3CCM A;  3MAQ A;  1NBW A;  1HA5 A;  1SMY D;  3VE5 A;  4GI3 C;  1VQO A;  2CH4 W;  4JYA L;  1CZG A;  2DJF C;  3GV6 A;  2HT1 A;  1GUO A;  4LUO A;  2R6G A;  4JOI A;  1TU2 B;  1OO9 B;  1TR5 A;  1EOV A;  2K14 A;  1WI5 A;  2WAC A;  1SEB D;  2ZTC A;  1W4R A;  4ODG A;  1DM0 B;  1QCB D;  3OW7 A;  2N55 A;  3I90 A;  1DON A;  4AS3 A;  2IPK D;  1HNZ L;  3FKI B;  4YWM A;  5HGT A;  2UUA L;  1VF7 A;  2NU4 I;  2F0G A;  2D0P A;  3S17 B;  4C3H H;  3MTS A;  2OTJ A;  3HEJ A;  5M5X H;  5IGE A;  4RG1 A;  2F0N A;  5KIX A;  2QSB A;  2ZXP A;  3IAM 1;  5M3M G;  3H91 A;  4N9P A;  3PIP 3;  1ZXT A;  3T4A C;  2BL8 A;  1GOZ A;  3NHH A;  4JG2 A;  1FNV A;  1LT5 D;  3QOL A;  2LFN A;  1HH2 P;  3A0J A;  1CM9 A;  1II3 A;  2VUM B;  4DR6 Q;  3K7A B;  1STG A;  2FMC A;  4KY6 A;  4JI6 Q;  3M4O H;  2JXM B;  1B1Z A;  5LMU L;  2N17 A;  3KF8 A;  3TZD A;  3CP0 A;  2JXD A;  2AQ3 B;  1WKX A;  3TBI B;  2BDN A;  3A8I E;  2F0O A;  1I4P A;  4LF4 Q;  2NN6 I;  1EWC A;  3NXW A;  1F2Z A;  1VQD A;  4E6I A;  2QA4 A;  3TO9 A;  2YTX A;  3M4P A;  1GVP A;  1ML0 D;  4X65 Q;  3G6J B;  3I9V 1;  1QNU A;  1CSP A;  2L1B A;  4JI4 L;  2B2Y A;  3L9A X;  1GKH A;  3A54 A;  3NSW A;  5JVG 3;  4BBS G;  4A3B B;  1Q81 C;  3M85 A;  1PRT B;  2X6G A;  1XBT A;  1E7Z A;  4HN7 A;  2ZJR A;  4NB3 A;  1R4P B;  2BH2 A;  3F4M A;  4KMU C;  3AFQ A;  3F8T A;  3H3V H;  1TWC H;  3GTL H;  3E6Z X;  2LKV A;  5FO8 B;  2R7D A;  1WTP A;  2F4V L;  4L5Q A;  1HNW Q;  3TSS A;  1OVO A;  3A7A B;  2W0T A;  2JQO A;  1NTG A;  3OYY A;  1A6X A;  1KRT A;  4DUZ Q;  1G91 A;  5IGD A;  3DXJ C;  1VQ4 A;  1ZKO A;  1RTN A;  4X66 Q;  1PYB A;  1Y1V H;  1WTQ A;  2F6M B;  3V96 A;  2A6E D;  3HOY G;  4ZKB B;  4CJ1 B;  4ZUJ A;  2RHQ B;  4NP5 A;  1KHI A;  1PFB A;  4YHH Q;  2PI2 A;  1M90 C;  2DNE A;  4A3F G;  4A3J G;  1LTG D;  1WCM B;  5GAH C;  1X3F A;  4LF9 Q;  4HJ8 A;  2E5R A;  3R5D A;  2JBW A;  2EJG C;  4DN4 M;  4K6D A;  3R5A A;  1DOL A;  3C1F A;  5FK9 C;  7WGA A;  3FRP B;  2OTL A;  4UY8 C;  5IIF A;  4TQU S;  3BU2 A;  1OMT A;  5I9O A;  3VYT A;  3I4L A;  4I65 A;  4Z9C B;  2ENZ A;  1KDA A;  2JA8 B;  2JEA I;  2KHJ A;  4A3G H;  1OXU A;  4GNX C;  1RL2 A;  3HGB A;  1VQL A;  1H9S B;  1U5K A;  1Q1E A;  1TWF H;  3CKI B;  3WOF A;  5C4X H;  2VRW B;  1RIP A;  1VQF A;  1UNS A;  5LHY 1;  2KMR A;  5M5W B;  3GTM H;  2F0E A;  3KFU A;  4JI2 L;  3Q24 A;  5F2D A;  2KCX A;  1CQV A;  3SK8 A;  2WKC A;  3DWA A;  5T1I A;  4HID A;  2P5Z X;  1CT2 I;  4B3T Q;  4OEL B;  1Q90 A;  1E0B A;  1PTO D;  1B53 A;  4IFD G;  2WAQ G;  1UWV A;  1ZEQ X;  2XSC A;  4DR2 Q;  2J9R A;  1LR7 A;  1B2T A;  3HOZ G;  5C44 G;  4FKD A;  3J80 i;  2XN9 C;  2B8G A;  5M3M B;  1WGC A;  2K7V A;  3HOW H;  5IYB H;  2Z1C A;  2F0U A;  1XMO Q;  3M7G A;  1FNU A;  4B3S Q;  4JI0 Q;  2ZW3 A;  1EZ8 A;  1I4Q A;  2HGK A;  4HMJ A;  3PO2 H;  3J81 j;  2Z8L A;  1SFO H;  5IGC A;  4R4I A;  3OTO Q;  5EX3 A;  2F0I A;  1RKN A;  3A7L A;  1XNR L;  3ER0 A;  1Q8I A;  5A35 A;  1HNX Q;  2JE6 I;  2QPO A;  3SR1 A;  5C3E G;  1HPT A;  4A3E G;  1UE1 A;  4EQP A;  2NU2 I;  1B9M A;  1NE3 A;  1D5X C;  5JPN C;  3E3X A;  3ND8 A;  2V4D A;  2JB1 A;  4BBS B;  1PLF A;  1QG7 A;  2FXQ A;  2JSO A;  1YTP A;  4OAV B;  2JYO A;  3PUV A;  5AJ3 Q;  4A3L H;  1DGS A;  4AIM A;  3V05 A;  4A3I H;  1TBQ R;  1BO0 A;  5BR8 L;  3WOE A;  3VDU A;  1A15 A;  1CKM A;  4DK3 C;  1TS5 A;  1QUQ B;  2X3T A;  3TN2 A;  1JWS D;  1A63 A;  5CMD A;  2A6H C;  1PMR A;  5ISR A;  2HCI A;  3H6M A;  1LTI D;  4DV1 L;  2QQC A;  1KIX A;  1YNN D;  1F2Y A;  1C0A A;  5C0X I;  2ETD A;  3JC6 6;  3PIO A;  3GP7 A;  3HOY B;  4H44 C;  4DAP A;  1N34 Q;  2QZG A;  4TRD A;  2NU3 I;  3SE0 A;  2Q8R E;  5EBC A;  4ZK9 B;  4KHP L;  1EL0 A;  4O1O A;  4A3F B;  4A93 H;  2H4O A;  4EGV A;  3QAH A;  1T9H A;  4A3J B;  2HUG A;  4Z7H A;  2IX1 A;  9WGA A;  5JAV A;  5JEA G;  3K57 A;  4A3M H;  3CC4 A;  1SDF A;  3S15 H;  2JZM A;  3K81 C;  1BBU A;  1UE5 A;  2EY5 A;  2F0H A;  4DV0 Q;  3G7L A;  3GTP B;  5CBA E;  3T1Y L;  4WJ4 A;  2L15 A;  2Q2U A;  2CW0 C;  1RTO A;  5J39 A;  3FEW X;  2MHV A;  3RZD H;  4OL7 A;  4KN7 C;  4IUR A;  5IE8 A;  3M3Y B;  3N52 A;  2JA9 A;  2RSN A;  5CV5 A;  1N33 L;  1XA6 A;  4NMZ A;  1JOO A;  3I56 A;  1TUS A;  4OAU C;  5KGU A;  4CJ0 B;  4JI1 L;  2CKZ B;  1O7L A;  2WP8 J;  5EJW A;  3A5Z B;  2FJ2 A;  5E1F A;  2DJG C;  5JEA J;  1BUS A;  1J5E Q;  2Q8T A;  1EY8 A;  4LF7 Q;  1F9Q A;  5EKI A;  1X3E A;  4G76 A;  1JQO A;  4Z7G A;  4L5R C;  2F0W A;  3EN2 A;  3P20 A;  4KJO A;  1MKH A;  2JA5 G;  3KF6 B;  1K8M A;  2ID0 A;  1S5C D;  3GTK B;  3FPU B;  1B9N A;  1MD2 D;  3TDQ A;  3I91 A;  2Z4H A;  4KY5 A;  4BS9 A;  4IJH A;  1FJG L;  2WAQ B;  1I3Q B;  5LMN Q;  2TSS A;  5EQ0 A;  1ET9 A;  3S16 H;  3MEF A;  4ZAI A;  2AWO A;  2MFI A;  5JVH 3;  1TWH B;  3BYT B;  3RUZ A;  3HOZ B;  1U4R A;  5C44 B;  3ND9 A;  5M5Y H;  2GN5 A;  4LNQ A;  2RLD A;  3U50 C;  5C3W A;  1V1H A;  2GVA A;  1S72 A;  1IW7 D;  1EOT A;  3J81 c;  1AFP A;  2B0U C;  1EIH A;  1FYC A;  1IKL A;  4LWC A;  3FP9 A;  4EQ5 A;  3AEV A;  2CH4 A;  4K0K L;  3HS0 C;  1IBL Q;  1YHA A;  4YWK A;  1XTD A;  4F87 A;  1FGB D;  2K5N A;  1QVC A;  3VR2 A;  2NVX B;  1H9M A;  1X6O A;  3J80 E;  1EWI A;  4CDF C;  4LAA A;  1NJI C;  4DR4 L;  5C3E B;  3NWS A;  4A3E B;  4XT1 B;  1TGS I;  2VXW A;  3T56 B;  1KLG D;  3TS2 A;  2M9V A;  3RLN A;  1WFQ A;  1TWG B;  1SGY I;  2DNC A;  2VW9 A;  2WAQ E;  1DJR D;  4HSP A;  4EX5 A;  3MHB A;  1SJ8 A;  1VQK A;  4JBJ A;  3NEN A;  2UUC L;  3KDF A;  4ZLT F;  1QWY A;  1V1P A;  4HIM A;  1Q46 A;  4K5X A;  1IY5 A;  2NVQ H;  2AQ1 B;  1KTK A;  2KJX A;  1NUC A;  4IUT A;  3D00 A;  1IL2 A;  3MC0 B;  4RWS C;  3DEO A;  1PRT C;  2F3V A;  1TT2 A;  4MTN A;  2KOL A;  2E2I B;  2XWB B;  4RHR A;  4IOC A;  2UXD L;  3OWE B;  5L37 A;  4X64 L;  2EY6 A;  1H9J A;  2A2D A;  2VS1 A;  4A3K H;  3JAM i;  4ZRZ A;  1WD0 A;  3CRK C;  1LTA D;  4NDX A;  1HJP A;  1S3O A;  2J7Z A;  1XPO A;  3A8K E;  5DM6 3;  5FUX A;  2PZT A;  1EUJ A;  4DGZ A;  3NBH A;  2ASB A;  2F0F A;  1RCV D;  1JB3 A;  1QZG A;  3GTQ H;  3T16 A;  4XT3 B;  2RAD A;  3LJ1 A;  3L2P A;  3H3V I;  3TP6 A;  1Q9B A;  3S1N B;  2C35 B;  2ZM6 L;  5E3R A;  2BL7 A;  4AH6 A;  2E8G A;  3E59 A;  5J1Z A;  3PMF A;  4IUV A;  1KAA A;  1F77 A;  4R8N A;  3SDJ A;  5D65 A;  4C3I H;  3ULL A;  5KNC A;  1JOK A;  1S20 A;  1SNM A;  1DZ1 A;  2K03 A;  1XMQ Q;  2KMQ A;  2ODD A;  1OYV I;  2MJ8 A;  2Y0M A;  3R5C A;  3S1R H;  2JYY A;  1K83 B;  2DY8 A;  1PH5 A;  2HHH L;  2SGF I;  1KDB A;  1G51 A;  4GNX B;  1ASZ A;  2ATW A;  4JI8 L;  4FP5 D;  1ZYR C;  2QF7 A;  5K36 G;  1PFN A;  3H0G H;  4UAI A;  3RZO B;  1RF2 D;  4YZD A;  4SGB I;  4FF1 A;  1JMC A;  2EZV A;  3TQY A;  2JA5 B;  2BA1 A;  2DN8 A;  4DFA A;  5C4Z A;  2FNF X;  2CWG A;  2NZ1 D;  4P71 A;  5ELF A;  4YY3 Q;  1TKW B;  2YV5 A;  4FDB A;  2F0S A;  2RA4 A;  5DAE A;  3MXN A;  2B8T A;  1X32 A;  4FXG C;  1QB5 D;  4DXG A;  1ULN A;  5CV8 A;  3RN5 A;  1LYL A;  4DR7 L;  3T51 B;  2HQE A;  4JI7 Q;  4AYB G;  2M5X A;  2QEX A;  2VZA A;  1WTV A;  1ESR A;  2K1B A;  4BY1 H;  2GKR I;  1L0X B;  1SJE D;  4QGU A;  3I70 A;  4A3C G;  4G57 A;  5E7N A;  2JA6 H;  1JC7 A;  1PH6 A;  3KF8 B;  2QIL A;  4QJF A;  4A75 A;  4NXM L;  1BCP F;  5JPM C;  1SYB A;  1SE3 A;  2ICI A;  2IW3 A;  1JB7 A;  2F4V Q;  3KLR A;  4P73 A;  1X3G A;  4NKL A;  3PF5 A;  1IBK L;  1I50 B;  4A3D H;  1LTT D;  4EVO A;  4DA2 A;  2YUU A;  3F2U A;  1TBN A;  4KY7 A;  1Y1C A;  3Q22 A;  4IO9 A;  4C3H G;  3P7J A;  1XX8 A;  1FY7 A;  2OU2 A;  2QEJ C;  3J81 L;  1C4Q A;  1A3U A;  4G7H C;  2K75 A;  2QQD A;  3O13 A;  3OPO A;  2D0O A;  1UEB A;  3CME A;  1I4G A;  1NR4 A;  4O2D A;  2VQE L;  4LF6 L;  2RCF A;  5A2Q L;  1EY7 A;  1EQR A;  1HR0 L;  3VA9 A;  5M3F H;  1E1T A;  2WIN B;  3MWY W;  4XQN A;  3HOV H;  2B2T A;  2QKI C;  4MIU A;  2M2L A;  3P23 A;  3AFP A;  1O7Z A;  2E5L L;  5JJI A;  1J8I A;  1PZI D;  4DV4 Q;  1W6K A;  1R9T B;  1WGT A;  4K8I A;  4IUU A;  3SK6 A;  3ONA B;  5I9P A;  4O0A A;  1PTO H;  1I4R A;  2ENB A;  3D4R A;  1LAC A;  2QGQ A;  5G3L D;  1TS2 A;  4KLK A;  1TIH A;  2NU1 I;  4JC0 A;  5ELN A;  5CGK A;  4JI5 Q;  4GLV B;  5JJL A;  2E75 C;  1A3T A;  2KVM A;  5HGQ A;  3J7A F;  3FBV A;  3SGI A;  3AQQ A;  3CCJ A;  1CTM A;  2MQH A;  3CHB D;  3JAM E;  2DB6 A;  4DAY B;  1ILP A;  4X62 L;  2V1C C;  4C1N K;  4JI2 Q;  2UU9 L;  4GKJ Q;  1CKN A;  2PQA A;  3OMG A;  3RMH A;  4B9X A;  1LR8 A;  2R93 G;  1MSG A;  4JV5 Q;  3ULJ A;  2QCP X;  4BA1 I;  1STE A;  3DWQ A;  5DM7 3;  1KLU D;  2X6L A;  5C5L A;  5JJZ A;  3F2C A;  3D6C A;  1ET6 A;  3B55 A;  3R8B A;  1NR2 A;  3B6Y A;  1A3V A;  4RMF A;  2F52 A;  3RD4 A;  2IL8 A;  3BZC A;  3W2D A;  1VF5 C;  4J8Q A;  3UEJ A;  5CV4 A;  1BUV T;  4C3J H;  5BN3 A;  1IYU A;  5CCL A;  3PUY A;  1PH1 A;  5FUW A;  1CHP D;  2YYZ A;  1BKB A;  1SGQ I;  4GN5 A;  2N1A B;  3PUW A;  2Z9H A;  1VQG A;  5LL6 X;  2AWN A;  4ALP A;  4DWL A;  4GZY C;  1GUT A;  3UI2 A;  2LB7 A;  2EE1 A;  1PH3 A;  1VQH A;  2E2H B;  4LUV A;  3PSI A;  5J22 A;  1EY0 A;  4GN3 B;  4LUZ A;  1JE4 A;  1OXT A;  3HOU G;  4AYB B;  2JA7 G;  4LK1 C;  4LMQ D;  1TOT A;  3RLF A;  3FKI H;  3NK9 A;  3RLO A;  4H0L C;  5C4X G;  1CT0 I;  3S1M B;  2ZT9 C;  2E73 A;  2GA4 B;  2F0P A;  3BJI A;  1K3R A;  2IT1 A;  3CCS A;  1GD7 A;  5FJ8 G;  1D6E C;  1XJV A;  1QVF A;  1D5Z C;  1SE2 A;  5KYI A;  1G6P A;  1Y8N B;  4IJL A;  4PL5 A;  3SEK C;  3CQZ B;  3PQI A;  2KEE A;  1STN A;  3ERS X;  1W6J A;  4RGM A;  4EQO A;  1C7Y A;  1TWA H;  1U0L A;  3FHW A;  1GUW A;  2Q8I B;  4C3H B;  4DK0 A;  1HRJ A;  3UGI A;  1GO3 E;  1M4V A;  1LTR D;  3K7A H;  5M5X B;  1ULM A;  1U9R A;  4BBR G;  2NVY B;  2G9D A;  2DUD A;  4BY7 H;  3PO3 G;  4PZ6 A;  1I94 Q;  2PO4 A;  5IYB G;  4C1N I;  1KL9 A;  1SNQ A;  4AYB E;  4G7O C;  3CRL C;  3MEK A;  3U9O A;  1I6H B;  4L5S A;  1CA5 A;  4ILW A;  4OIJ A;  1OXV A;  2E2J B;  1SRU A;  2WVJ A;  2NZO A;  1YBY A;  4GS3 A;  5GAD C;  1PV4 A;  3LGJ A;  1WVL A;  2A5H A;  3PO2 G;  1SLJ A;  3QO2 A;  4O1P A;  1BF4 A;  3STB D;  1AE3 A;  1EQQ A;  4NW2 A;  1ESF A;  2N8N A;  2EYP A;  3VYR A;  3Q6S A;  3R2T A;  1WD1 A;  1EFW A;  2A68 D;  2JJQ A;  5I6W A;  3TRZ A;  5FUY A;  3CCV A;  2ORV A;  4R8I A;  5IY0 A;  1B44 D;  3E9H A;  1L1O A;  5FO7 B;  2EY1 A;  4A3I G;  3QG1 A;  1N32 L;  1GXD C;  4M1U B;  1Z7K B;  1N13 A;  4B3M Q;  1SNP A;  2I0Q A;  4DUY L;  3T13 A;  2YU9 B;  1HTP A;  1TWC B;  1FAR A;  1JWM D;  2R93 B;  1YVC A;  2AUK A;  3PCO B;  4GLA C;  5BN4 A;  2CVR A;  1EU3 A;  1ASY A;  1WCM H;  2JB2 A;  2NWG A;  1RDP D;  5FLX E;  4B6D A;  3FNB A;  1TY0 A;  1VQE A;  1STA A;  4GKK L;  1JJG A;  1KNE A;  4K2L A;  5COR A;  1EY6 A;  2AKW B;  1KXL A;  5GAG C;  3I4N G;  2BOS A;  2JA8 H;  1SNC A;  1YHB A;  1HZA A;  1RHP A;  1V1Q A;  2ICE C;  1VDZ A;  4X3T A;  3SEB A;  3SK5 A;  4DR3 L;  1QZH A;  2OQ0 A;  4K0K Q;  3FVQ A;  4JPB W;  3E0J A;  4JOI C;  4DXF A;  1K7T A;  2EYF A;  3L7Z C;  1QVG A;  1EIF A;  1KBF A;  2BCO A;  1MJB A;  3SXH A;  3STB C;  3Q8D A;  5J3B A;  2BA0 A;  2R3Z A;  4JI3 L;  1VQ6 A;  1JWU D;  4N8X 1;  5C6A A;  1P9G A;  4MTK A;  2PW5 A;  3IAS 1;  3RN2 A;  1CHO I;  2K32 A;  2RQX A;  3HOU B;  1IKM A;  2JA7 B;  3TJQ A;  2A68 C;  2KCN A;  3OW2 A;  4HMI A;  4H02 A;  2A74 C;  1XNQ L;  4Q5V A;  4GLX A;  2ROW A;  2A6H D;  1TBO A;  2XRC A;  1VQC A;  5C4X B;  2L0C A;  2SOB A;  3M4Q A;  3GO5 A;  2Z6B A;  1A62 A;  5EGT A;  5HUR A;  2MP1 A;  2F3C I;  1WJJ A;  5D3I B;  3GTM B;  2FEF A;  1HEV A;  1Y8O B;  3B4V C;  1HR0 W;  2VB3 X;  3K0Y A;  5M3M H;  1E22 A;  1Q7Y C;  3OHX C;  3GQB A;  2RF4 A;  3DEP A;  1U4M A;  2HDM A;  2KHS A;  3U4V A;  3QIA A;  5DNF A;  4BA2 I;  4YZC A;  1Y1B A;  1F9R A;  1TQO A;  4RHS A;  4DAM A;  1PPF I;  3MXP A;  2B2W A;  3TP5 A;  4U68 A;  3CXL A;  4BBR B;  4IFD J;  5IYC G;  3A55 A;  2K5H A;  4X3U A;  3KDF B;  3TOA A;  4QB4 A;  4UPA A;  2CW0 D;  5I4D A;  3PO3 B;  4DNC A;  2XTR A;  2B2Y C;  5C4J H;  2MPM A;  3W1G A;  1BQQ T;  1ULK A;  4XQQ A;  1EY5 A;  4WOR A;  2ZM6 Q;  1LTB D;  1IHZ A;  2EDG A;  4OX9 L;  1KQS A;  2EYO A;  4QIW B;  1FAQ A;  5CV6 A;  4BBS H;  3PO2 B;  1U4P A;  3K6O A;  1TDP A;  2NN6 G;  4OHJ A;  4ZKC B;  1ICF B;  1Z6H A;  2OWO A;  5IP9 G;  1PJU A;  3EQL C;  2SGE I;  4HEA 1;  1JR0 D;  2ES2 A;  1HFG A;  4CBV A;  2UVO A;  3F2B A;  3K5N A;  5E4W C;  3WDN A;  1W2B A;  3OVO A;  1VQA A;  1HA6 A;  3NBH B;  2K6A A;  1YIJ A;  4AQY Q;  3TO6 A;  3IRB A;  1L1O C;  3ZJY C;  3EIV A;  1KC8 C;  2F3I A;  1FL0 A;  4KD3 A;  5ELC A;  1UHA A;  3S14 B;  4UP7 A;  1PH9 A;  3I7F A;  2R92 H;  1IBM Q;  1Q8K A;  3I2Z A;  4A3I B;  1PDQ A;  4LFB Q;  4C2M H;  3AJF A;  1KRS A;  1V1O A;  5FOB B;  2A2C A;  3HOY H;  2EXD A;  4DR5 Q;  1VQI A;  3S9W A;  1D5M C;  4A3F H;  3OIP A;  2ERW A;  1SYE A;  4A3J H;  1V8Q A;  4PMB A;  4QIW E;  2CCZ A;  2K05 A;  3BDC A;  5EKL A;  1C9O A;  4DR1 Q;  3G4S A;  5GRO A;  4POG A;  1LO5 D;  4DR6 L;  3CCR A;  1BCP C;  1WTH A;  3ERO A;  4JI6 L;  2Q2H A;  1YNJ D;  4RKB A;  5HI7 A;  3I4N B;  5IWA Q;  4O42 A;  4DR7 Q;  4G75 A;  2OT2 A;  4DKA C;  3KK7 A;  4MZ9 A;  1S4Z A;  4LJZ C;  5I2Y A;  4WP4 A;  4LF4 L;  4HGU A;  1B70 B;  4NXN Q;  1UE7 A;  4G4K A;  4APV A;  4N8F A;  1MGS A;  2GKV A;  2RSO A;  4X65 L;  3LNN A;  2BE5 C;  2CFM A;  4HJ7 A;  2IWH A;  2L1L B;  3MXN B;  3UDI A;  4H13 C;  4XDX A;  1SE8 A;  5E4X A;  1P9Z A;  3D31 A;  2A69 D;  1MI2 A;  1WYD A;  3NQI A;  5IT9 E;  3I4M H;  2VQF Q;  3GTK H;  2A20 A;  2RC4 A;  1PRT D;  3CPW A;  1NMG A;  1B3A A;  4X3K A;  1K28 A;  3MFY A;  3GTG H;  3KLW A;  4IFD H;  1I3Q H;  4X6A H;  2Z6K A;  1SYG A;  3TS0 A;  3I3C A;  4BXX G;  2F0L A;  1TWH H;  1BBW A;  2RHS B;  3Q23 A;  4DUZ L;  2VQE Q;  3HOZ H;  4CDD C;  4DV7 Q;  4B08 A;  4X66 L;  2NVT H;  1G6Z A;  2KKM A;  3BG3 A;  3EJI A;  4DNR B;  1HR0 Q;  1AZP A;  2B2W C;  1HZB A;  4PZ8 A;  4KV6 A;  2KBN A;  2E5L Q;  3LWE A;  1ILQ A;  3SK4 A;  4KD4 A;  1Y1W H;  4HJ5 A;  3AMU A;  1K0S A;  1PZJ D;  1YJN A;  4LF9 L;  1CFM A;  1D1K A;  4DV3 L;  4LF5 L;  5M5Y B;  1L2F A;  5FLM H;  1YNJ C;  2NVX H;  4HFV A;  5KNB A;  2OEO A;  3RR5 A;  4IUP A;  1I4X A;  2JA1 A;  1SR3 A;  3RU0 A;  5C3E H;  2K4K A;  5CC4 A;  5CBE E;  2UUB Q;  1HQR D;  4KHZ A;  4DU9 A;  3NWT A;  1B3Q A;  2K5V A;  3UEY A;  5IP7 H;  4K5V A;  4PZ7 A;  2J87 A;  5DEH A;  1W3S A;  3J7Z C;  1ENA A;  2UU9 Q;  3SGB I;  3HOX G;  1X54 A;  1HUN A;  3C2P A;  1BXT A;  4YCW A;  3PGZ A;  4X3S A;  1STH A;  1ZYR D;  1CHQ D;  1S40 A;  2MO1 A;  2A69 C;  3VR5 A;  1Y69 U;  3FDT A;  1X3Q A;  4DV2 L;  2KEC A;  2JAE A;  2CQO A;  3HKZ G;  3OXG A;  1Q86 C;  2HIV A;  3GTO H;  1GHJ A;  4DAV A;  1R0R I;  4A3D G;  2UXC L;  2GSC A;  2ZTD A;  3KLS X;  4OON A;  3CCE A;  4FYD A;  1F9P A;  1AH9 A;  4GOP A;  4G7Z C;  3EBE A;  1J6Q A;  3S2H B;  2NU0 I;  2K04 A;  1XYI A;  4LFC Q;  4DR2 L;  4RAU C;  3G6E A;  1LV9 A;  4ME3 A;  1CKN B;  2L9H A;  1SGP I;  2R7Z H;  2YFA A;  2Z4I A;  3OOC A;  3IKJ A;  4CGY B;  2LXK A;  1FD7 D;  1JE5 A;  4JYA Q;  2MUY A;  1ENC A;  1EZ6 A;  1X56 A;  4BWG B;  3I8Z A;  4OO1 H;  5I2X A;  1IXR A;  5C0X G;  2E74 C;  1HQM C;  4TVA B;  5JEA H;  1XMO L;  2DIP A;  3H3V C;  5ELB A;  3S1N H;  1EQT A;  4B3S L;  2CWA A;  2KUM A;  1EYC A;  1S5F D;  2PW7 A;  4Y7N B;  3K5M A;  3KY9 A;  2KMO A;  2GIV A;  5K5P A;  3A5U A;  3M7N A;  4FXK C;  3OTO L;  1HNZ Q;  3S1Q B;  2UUA Q;  4R4O A;  1HNX L;  4HJ9 A;  5C5M A;  1MSH A;  3BJU A;  5CCM A;  3M9B A;  5NUC A;  5C0X J;  4B3R L;  2JP1 A;  4KKT A;  3OIQ A;  1C8C A;  3ZYY X;  2WGC A;  3D4W A;  2A73 B;  4DV6 L;  2B63 H;  5FKA C;  1SYF A;  3RZO H;  1QJO A;  4K14 A;  1TUR A;  4GXT A;  3PIO 3;  2SEB D;  5E3F A;  2RVL A;  1U4L A;  3HKS A;  3HH2 C;  5IYD G;  5LMU Q;  1AP0 A;  4KI0 A;  3Q0A A;  1BBX C;  4L63 B;  3C46 A;  2EJM A;  1I4H A;  2QGM A;  1QNK A;  1WOC A;  2KQ3 A;  3MXG A;  3QB3 A;  3A8J E;  3PIP A;  4U67 3;  1CUK A;  2OD1 A;  2MNA A;  3FSY A;  3PF4 A;  4HAE A;  2K9H A;  2F66 B;  1A2T A;  3R5B A;  2IJ0 A;  4JI4 Q;  2WB1 G;  1N34 L;  2F3W A;  2B2V A;  2EY2 A;  2E2D C;  5LNK 1;  5EBD A;  1PTO F;  3TRE A;  1A0I A;  3U9S A;  1PYW D;  1XXG A;  3TP8 A;  2SGQ I;  1UEA B;  1UVF A;  3DMU A;  4DV0 L;  2IHE A;  1F9S A;  4OXP A;  1Q82 C;  2K5Q A;  3HP3 A;  3KJP A;  3J80 L;  5J8F A;  1LAB A;  4IPD A;  2CJS C;  4I7Z C;  2XTQ A;  4KHV A;  1X55 A;  3E2I A;  4FF3 A;  4CJ2 C;  2OXP A;  3QR8 A;  4DV5 L;  2F03 A;  3VDP A;  4I1T A;  2QQE A;  1MJA A;  3HOX B;  2K5D A;  1N32 Q;  2VY3 A;  1EFI D;  1X4S A;  4KKU A;  4DUY Q;  2EQS A;  3UGL A;  1Q3L A;  5CR3 A;  1J5E L;  4YZ9 A;  4LF7 L;  3DM3 A;  3U4Z A;  3HKZ B;  4NV2 A;  4J1M A;  1VQ9 A;  1IY6 A;  3SDZ A;  3CU7 A;  1A8V A;  2HIX A;  4GOP C;  4FXD A;  3TOB A;  3JAM c;  4A3D B;  3I55 A;  2JW6 A;  3W3A A;  3GD7 A;  4OWW B;  1SMX A;  3FMC A;  1BR9 A;  1HHV A;  2UXB L;  4OWX B;  2AQ2 B;  4JBM A;  1HJA I;  4N9T A;  1XPU A;  2O5J C;  4DK1 A;  4ME5 A;  1R9T H;  5LMN L;  3BVG A;  1L1O B;  4WRD A;  1SE4 A;  3NTI A;  1O78 A;  3DUZ A;  4V0B A;  3AU7 A;  4BY7 G;  3BDL A;  5TSS A;  1L0W A;  3UIT A;  3X3M A;  2X52 A;  4XQJ A;  2FUG 1;  3AYH B;  1SYD A;  2IX3 A;  1VCI A;  1GUN A;  4UP9 A;  2SNS A;  1BMO A;  1SBB B;  2LXJ A;  4HR7 B;  3J7A V;  1AN1 I;  1EQV A;  4JVZ A;  1KAW A;  1I6V C;  3G71 A;  2EYH A;  4E1P A;  2K50 A;  1NMF A;  1VMC A;  1DYQ A;  4HSV A;  3HKZ E;  1JCK B;  1HDL A;  3KJO A;  4QL5 A;  4PQX A;  4UXJ A;  4XXE A;  3S2D B;  2FFK B;  5JOB A;  1EYA A;  1BCP B;  4DNT B;  1V1I A;  4YWL A;  1UUC A;  3E9I A;  3AB9 A;  1SRO A;  4PNY A;  3GTJ B;  1GHK A;  3QJY A;  2D62 A;  2I5H A;  2C9O A;  4CHT B;  4AML A;  1Y1V G;  1F2L A;  4H7B A;  3H15 A;  2HQL A;  3DLL A;  3F2D A;  3K5O A;  1H95 A;  2EPB A;  1H9K A;  1TVX A;  4F88 A;  1LTL A;  2PI2 E;  2Z0S A;  4IN3 A;  1PH7 A;  1QE6 A;  2I46 A;  1XNR Q;  2XIW A;  2K19 A;  1ICW A;  1Z47 A;  1HXY D;  1Z9F A;  3UDX A;  2F4I A;  2K33 A;  4WFN 3;  1XWE A;  2EYL A;  2L12 A;  4MHE A;  3PDN A;  4A3G G;  2F0M A;  2LMC B;  2E2H H;  3VYS A;  2WB1 B;  4XTC S;  1Q1B A;  2O2L D;  2NBF A;  1CSO I;  1PRT F;  1VQJ A;  2M00 A;  2TMP A;  1NXU A;  3NEM A;  4GNX A;  4A3C H;  2BDO A;  3K59 A;  3S17 H;  1HPC A;  3S1M H;  2OZU A;  5BR8 Q;  1FR3 A;  4IFD I;  4OVO A;  3DA3 A;  1IYJ B;  2CAZ B;  2KCC A;  2I5M X;  1R79 A;  1GJX A;  3PUZ A;  4HCE A;  5CYU A;  1D1I A;  1XPR A;  3CQZ H;  4QF4 A;  3U58 A;  1XMQ L;  2CWF A;  1SN8 A;  4DV1 Q;  1DOK A;  1WTJ A;  1K7V A;  1HTL D;  1PH8 A;  1QIL A;  2VUM H;  3BYY B;  1AEX A;  2IY5 B;  1BDO A;  1LT3 D;  1E2Z A;  1FGU A;  2NVY H;  4KHP Q;  2B2T C;  3A56 A;  2D9U A;  3UE0 A;  5I6Y A;  1Y8P B;  1STY A;  3HOW G;  1K7U A;  2WB1 E;  1YJW A;  1TWA B;  4IUQ A;  1I6H H;  1ROD A;  1G29 1;  2E2J H;  3T1Y Q;  3NTH A;  2D2C C;  1CT4 I;  1ENF A;  1SNO A;  3NBI A;  1M1K C;  4A3B H;  3M4O B;  1M8B A;  4K6L A;  4YCU A;  3NP8 A;  4YY3 L;  2HD3 A;  2RDF A;  1N33 Q;  4BY7 B;  4RCO A;  5ELD A;  3E0E A;  1AE2 A;  2G5D A;  4ID6 A;  1CA6 A;  5E3Q A;  1VQ7 A;  3IFD A;  2G9H D;  1EEI D;  5FLX c;  1G2S A;  4HCS A;  4JI1 Q;  3NE5 B;  4UXI A;  2XGT A;  1SMY C;  3G48 A;  1LTS D;  2RDG A;  5D3D A;  4TKO B;  2P6A C;  2HCC A;  3QWN A;  1TY2 A;  4LF8 L;  1VQP A;  4JI7 L;  2WII B;  4NV5 A;  2KA7 A;  1DS2 I;  1B4O A;  4A3L G;  2LSS A;  3JAM L;  2C5C A;  4LW1 A;  3FSX A;  3BZD B;  2YQP A;  2YU9 H;  2LEO A;  3GTL B;  2IP6 A;  3UDG A;  1WTO A;  1FJG Q;  2R93 H;  2H1E A;  4POF A;  1KD1 C;  2PZW A;  1P8L A;  1K8O A;  1AW7 A;  3UE1 A;  3GOX A;  1FNW A;  5J8C A;  3C1E A;  2O5I C;  3T1H L;  2FU2 A;  1DCZ A;  1Y1V B;  2PNH A;  4L8J A;  3I73 A;  5KRU A;  4OO1 I;  2R92 G;  1HZ9 A;  3D4D A;  5FO9 B;  3L0I A;  1LT6 D;  4R1J A;  3TEH B;  3SGQ I;  3OMC A;  2B2U A;  2WV6 D;  3J7Y W;  3CPF A;  3FC3 A;  1OXX K;  3VR4 A;  1B50 A;  2CHB D;  2XRS D;  4A93 G;  1RD9 D;  3TP7 A;  2K52 A;  2IHF A;  4L5T A;  4QUF A;  3MA2 B;  4KKS A;  4A3M G;  4A24 A;  4DV3 Q;  4LF5 Q;  1HCZ A;  4PV1 C;  1MJC A;  4P2C B;  3VA5 A;  4DAY A;  5IOC A;  1VQN A;  1JOQ A;  2XTI A;  3P75 A;  2J4X A;  2MGS A;  2OQK A;  2FIN B;  3URY A;  2L4N A;  4DV4 L;  3ICE A;  4DR4 Q;  3VDY A;  3HG9 A;  5M5W H;  2JB3 A;  4A3G B;  1IW4 A;  4HED A;  4OEM B;  3UFF A;  4MN3 A;  2YTV A;  5EKK A;  3HOU H;  3F1Z A;  2JA7 H;  3VYU A;  3D0F A;  3X3N A;  1TWF B;  3BS1 A;  2UUC Q;  1DOM A;  3W1B A;  4JI5 L;  2PMZ B;  3D8G A;  2ALY B;  4E1R A;  4C56 C;  1MBY A;  2NYZ D;  2L55 A;  3K80 C;  3S24 A;  4RKL A;  1MHW C;  2FMM A;  4DV2 Q;  1BNZ A;  1YO7 A;  5FJ8 H;  4KN4 C;  4ABN A;  4LFA L;  2UXD Q;  2E76 C;  2KCT A;  1PYS B;  2UXC Q;  4X64 Q;  2JN4 A;  4IUN A;  3CC7 A;  3I4M G;  1EIG A;  4IPH A;  4GKJ L;  2KCM A;  2SGP I;  2JEB I;  2QDB A;  4HTH A;  4QQB X;  2KED A;  1SJH D;  1EWH A;  3MXU A;  4AS2 A;  2DGY A;  4JV5 L;  5LMN W;  4PMC A;  3KBX A;  2B29 A;  4FF4 A;  2H5X A;  3GV3 A;  2EJF C;  4BBR H;  3CCU A;  3UGD A;  1N36 L;  1V1P B;  1MJ9 A;  5DLQ E;  2A6E C;  1BCP D;  3R3O A;  3CCQ A;  1N8R C;  3PO3 H;  2LUY A;  4J15 A;  3L3O C;  3HOW B;  4UXH A;  1K73 C;  1YEZ A;  2XNA C;  3D3R A;  5KEE A;  2F1M A;  4O1N A;  1XX6 A;  1JIC A;  4QY7 A;  1Y1W G;  4M8A A;  1CGJ I;  3D6W A;  2LY7 A;  2PMZ E;  4YCV A;  3J81 i;  4HIO A;  1BOS A;  3K7U C;  1SFO B;  1NCV A;  4CDE C;  4GOP B;  2BE5 D;  1E2W A;  1PA6 A;  2N3S A;  2NZH A;  5IGG A;  5FLM G;  5KND A;  1L0Y B;  5C4J B;  2A8V A;  4B9W A;  5JJK A;  3T53 B;  1AZQ A;  2N52 A;  2PCF B;  3CMA A;  2HHH Q;  4CKE A;  5IP7 G;  5EPL A;  4B3R Q;  4UHV A;  1JJC B;  4JI8 Q;  5CV9 A;  2ZXO A;  1EIY B;  1NSN S;  3QWP A;  4R4C A;  5T1G A;  3S14 H;  5EPJ A;  4DV6 Q;  5FUV A;  3KLS A;  1LM0 A;  3H09 A;  2SDF A;  4K8J A;  2ZXR A;  1N9W A;  1EU4 A;  1KAB A;  5IGB A;  5G3L F;  2OF1 A;  3TO7 A;  2MO0 A;  2AHO B;  1PTO C;  2SGD I;  2V53 A;  1GUS A;  2B2U C;  2I5L X;  3WWV A;  4A3K G;  4IOA A;  4QUC A;  5IT9 c;  1LT4 D;  2A1A A;  2R92 B;  1YHQ A;  3VR6 A;  5FLX L;  3UDF A;  4C2M B;  3GTP H;  3HZX A;  1VMP A;  4MNO A;  3LJ0 A;  2SNM A;  4HIK A;  1O7I A;  4KK7 A;  3M3Y H;  2PQ8 A;  2XWJ B;  3I4N H;  5GQO A;  2R7Z G;  4PL4 A;  4A93 B;  1D7Q A;  1TII D;  3BZK A;  2CQA A;  4PL3 A;  1S5D D;  4RGT A;  4CKC A;  4OIK A;  1I94 L;  1SXT A;  2RCN A;  4OO1 G;  1UVG A;  4A3M B;  1PHJ A;  3S15 B;  2HDL A;  3BVZ A;  3EVQ A;  1NNX A;  2WCY A;  2L11 A;  4PG3 A;  3C3L A;  4NXM Q;  1FVI A;  2R7F A;  3RZD B;  1NAP A;  1JT8 A;  1IL8 A;  3CAM A;  4C3I G;  1B7Y B;  1IBK Q;  1AN8 A;  1WTX A;  2EVB A;  5DAU A;  1X74 A;  3BVM A;  3MVV A;  4DV5 Q;  2L7X A;  1STB A;  4IAL A;  1PXU A;  4GN4 B;  4F8M A;  3TME A;  3J80 c;  4P74 A;  1EY9 A;  2F0Q A;  1KBE A;  1HNW L;  4ZUI A;  1QOH A;  3ITP A;  2VNU D;  3EA6 A;  2F0T A;  3NEL A;  3H0G G;  5C44 H;  4JCV E;  2B63 G;  4LF6 Q;  2VB2 X;  4S3S A;  3I4M B;  2EXZ A;  2KMP A;  4DNI A;  1H9S A;  4B3M L;  2UXB Q;  1M8A A;  1E2V A;  3GTG B;  4YHH L;  1SSO A;  3CC2 A;  2CWP A;  3S16 B;  1PH4 A;  1Y8F A;  1YNN C;  4J6H A;  2NUC A;  3QTL D;  1G8Z D;  5IYC H;  4UP8 A;  1S5B D;  2RIO A;  2Y0S G;  2QDL A;  2PPB C;  2NVT B;  1A2U A;  3R93 A;  2AMC B;  2RBM A;  3OL0 A;  1VQB A;  4A3E H;  4WJ3 M;  1Z7T A;  1Y1W B;  5KYL A;  2GVI A;  1MJE A;  4XIG S;  3IL8 A;  4Q9V A;  2WFW A;  1TWG H;  4BY1 G;  2QQ0 A;  5IOD A;  1YNX A;  4P72 A;  4X62 Q;  1SGE I;  2JA6 G;  1RJT A;  3OSO A;  4DK6 C;  5H1S E;  2NN6 H;  4ZYS A;  2NTS A;  1SGN I;  3LWU A;  2YFB A;  1TS3 A;  4RCN A;  5IP9 H;  5BN5 A;  2PNR C;  3VR3 A;  2P22 B;  2R61 A;  2WKD A;  1JOR A;  1CQF A;  1Z2I A;  2E2I H;  1S5E D;  1SGD I;  1V9P A;  2F0J A;  2ENN A;  3J81 E;  1I5F A;  3BDO A;  1KDC A;  4HJA A;  4YIJ A;  4B3T L;  1YJ9 A;  1IZ6 A;  2OCE A;  2A19 A;  3I72 A;  3RNU A;  3S2H H;  1E1O A;  2NVQ B;  1CI3 M;  2N88 A;  2F0V A;  2NTT A;  5A2Q E;  1X9N A;  2FHT A;  3IFT A;  3KOJ A;  1GM5 A;  4FF2 A;  2DKV A;  2K5W A;  2PQA B;  2ARP F;  3GTO B;  4DF7 A;  4Q0F A;  3JSB A;  2RKS A;  2K28 A;  5M3F G;  3HOV G;  1IYV A;  3EFX D;  1H9R A;  4L9M A;  4ZCK A;  3K58 A;  4WJW A;  4A3K B;  1J9O A;  2ORW A;  3LX0 A;  1FYB A;  1CGI I;  4JI0 L;  3NPP A;  3K8A A;  1OTC A;  2XMX A;  5HQ8 A;  1ONL A;  1EEF D;  1K8A C;  1TS4 A;  3H94 A;  3ERQ A;  1JQY D;  4Y7N H;  1R4Q B;  1IW7 C;  2VL6 A;  4Y52 H;  2R7Z B;  4JK1 C;  3OXL A;  1V43 A;  1QUQ A;  2B39 A;  4KJN A;  3GTQ B;  1PTQ A;  3OXF A;  2LS0 1;  3S1Q H;  5EAY A;  3ULP A;  1X65 A;  3UOE A;  3K5L A;  1PZK D;  3NQT A;  1VQ8 A;  4QCL A;  4RGO S;  1K83 H;  3NTK A;  4IZ8 A;  4K2K A;  4K5W A;  5IGF A;  2GVB A;  4R9W A;  4A76 A;  4C3I B;  3TZU A;  2ZJQ A;  2DY7 A;  1EY4 A;  5AJ3 L;  1VQM A;  4RFB A;  3DM1 A;  2JA5 H;  1B8A A;  1CK1 A;  4F7X A;  4IPC A;  3VA7 A;  2Z6K C;  1X3P A;  3S1R B;  2BH8 A;  2V1C A;  5IT9 L;  1UE6 A;  2UZ3 A;  3DHQ A;  5HY6 A;  4AQY L;  1HUM A;  1O80 A;  2KEN A;  3KBG A;  1TBR R;  1K9M C;  1K8G A;  1KMA A;  5D14 A;  4BXX H;  2Q2T A;  3H0G B;  1YI2 A;  1PFS A;  1YZ6 A;  2B63 B;  3L0O A;  5C3X A;  3SHL A;  1F2M A;  3K0X A;  1OMU A;  2N71 A;  2JK8 A;  1IBM L;  2O4X A;  3N6R A;  1NY4 A;  1YIT A;  4LFB L;  1CKO A;  3CF5 A;  3A74 A;  3MEH A;  4C3J G;  4RA8 A;  4DR5 L;  1PVO A;  3CW2 C;  1CSQ A;  2XRQ D;  3HFZ B;  2EYM A;  5C4H A;  1UAP A;  5GAE C;  1K0R A;  2N49 A;  4R4Q A;  2KHI A;  1VQ5 A;  4JBK A;  2Y0S B;  4RH6 A;  2K01 A;  4DR1 L;  3KP9 A;  2XVS A;  4P75 A;  2RIJ A;  1NUB A;  3MFG A;  3IAY A;  4PMW A;  3KF6 A;  3DO9 A;  1E24 A;  1Y14 B;  3QOJ A;  1G2T A;  4IQZ A;  2PQE A;  3SVM A;  2EIF A;  5IWA L;  2NB0 A;  4LF8 Q;  1C48 A;  2L8E A;  1I50 H;  4EQN A;  5JHW C;  5ELO A;  1HFN A;  3FKI G;  5M9O A;  2F0K A;  4BY1 B;  4ZQ3 A;  4NXN L;  2JA6 B;  2AUJ D;  4QMG A;  3HOX H;  4I7A A;  4NPS A;  3LJ2 A;  3CXC A;  1P16 A;  1LUZ A;  3GDE A;  5ELE A;  3PV0 A;  4FVM A;  2RDH A;  3KYH C;  3V2T A;  3J7A 5;  2YTY A;  1EYD A;  2IX0 A;  4V19 0;  4U6R A;  1TXY A;  1CT1 D;  3T1H Q;  2EYJ A;  2ZRR A;  2VQF L;  3CD6 A;  3HRZ C;  4GKK Q;  2N78 A;  1MT1 A;  3CCL A;  2VUM G;  2J0T D;  2V6E A;  5COY A;  1PFM A;  2Q2I A;  1LLR D;  2Y0S E;  4OWT B;  3KUP A;  3DWP A;  3M4Y A;  4ULL A;  1D2B A;  1HZC A;  1DXM A;  2ZTE A;  4DR3 Q;  4XYO A;  2MJF B;  4RGN A;  5EPK A;  4DV7 L;  1VS0 A;  4CDC C;  1KNA A;  5M3F B;  2L5T A;  3HOV B;  1E3P A;  3W5O A;  2X69 A; 
#chains in the Genus database with same CATH homology
 1D8L A;  1RFH A;  1M8C A;  4A3B G;  3PUX A;  4JI3 Q;  2B3G A;  1PTR A;  1IBL L;  5EX0 A;  1XNQ Q;  4R4T A;  1Q12 A;  3S2D H;  1H0Z A;  4JBW A;  4A4I A;  2UUB L;  2ZJP A;  3GTJ H;  1PCE A;  1SGR I;  4DPG A;  4LFA Q;  1YU6 C;  1OXS C;  2OVO A;  1LR9 A;  3I4O A;  1MIU A;  1VDD A;  2GKT I;  1CE3 A;  1WCM G;  5IYD H;  4IPG A;  1EYG A;  1JJ2 A;  1N36 Q;  1PH2 A;  2ELI A;  1DS3 I;  2BUS A;  3DA4 A;  5HGI A;  1BVS A;  4LFC L;  2JA8 G;  4OX9 Q;  3CCM A;  1NBW A;  3VE5 A;  4GI3 C;  1VQO A;  4JYA L;  2HT1 A;  4LUO A;  2R6G A;  4JOI A;  1EOV A;  2K14 A;  1WI5 A;  2ZTC A;  1W4R A;  4AS3 A;  1HNZ L;  4YWM A;  2UUA L;  2NU4 I;  2D0P A;  4C3H H;  2OTJ A;  5M5X H;  4RG1 A;  5M3M G;  3IAM 1;  4JG2 A;  1HH2 P;  3A0J A;  4DR6 Q;  4JI6 Q;  3M4O H;  5LMU L;  2N17 A;  3CP0 A;  2JXD A;  4LF4 Q;  2NN6 I;  1VQD A;  2QA4 A;  2YTX A;  3M4P A;  1GVP A;  4X65 Q;  3I9V 1;  1CSP A;  4JI4 L;  1GKH A;  4BBS G;  1Q81 C;  3M85 A;  1XBT A;  1E7Z A;  2ZJR A;  4NB3 A;  2BH2 A;  3F4M A;  3AFQ A;  3F8T A;  3H3V H;  1TWC H;  3GTL H;  2R7D A;  2F4V L;  4L5Q A;  1HNW Q;  1OVO A;  2W0T A;  2JQO A;  1NTG A;  3OYY A;  1KRT A;  4DUZ Q;  1VQ4 A;  4X66 Q;  1PYB A;  1Y1V H;  2F6M B;  3HOY G;  2RHQ B;  1KHI A;  4YHH Q;  2PI2 A;  1M90 C;  4A3F G;  4A3J G;  5GAH C;  1X3F A;  4LF9 Q;  4HJ8 A;  2E5R A;  2OTL A;  4UY8 C;  4TQU S;  3BU2 A;  1OMT A;  2ENZ A;  2JEA I;  2KHJ A;  4A3G H;  1OXU A;  4GNX C;  1RL2 A;  1VQL A;  1U5K A;  1Q1E A;  1TWF H;  5C4X H;  2VRW B;  1RIP A;  1VQF A;  2KMR A;  3GTM H;  3KFU A;  4JI2 L;  2KCX A;  4HID A;  1CT2 I;  4B3T Q;  4IFD G;  2WAQ G;  1UWV A;  4DR2 Q;  2J9R A;  1LR7 A;  3HOZ G;  5C44 G;  4FKD A;  3J80 i;  3HOW H;  5IYB H;  1XMO Q;  4B3S Q;  4JI0 Q;  3PO2 H;  3J81 j;  1SFO H;  4R4I A;  3OTO Q;  5EX3 A;  1XNR L;  3ER0 A;  1HNX Q;  2JE6 I;  2QPO A;  5C3E G;  1HPT A;  4A3E G;  1UE1 A;  2NU2 I;  1NE3 A;  2JB1 A;  2FXQ A;  1YTP A;  4OAV B;  3PUV A;  5AJ3 Q;  4A3L H;  1DGS A;  4AIM A;  4A3I H;  1TBQ R;  5BR8 L;  3VDU A;  1CKM A;  4DK3 C;  1QUQ B;  1A63 A;  4DV1 L;  2QQC A;  1KIX A;  1C0A A;  5C0X I;  3JC6 6;  3PIO A;  1N34 Q;  2NU3 I;  4KHP L;  4O1O A;  4A93 H;  1T9H A;  4Z7H A;  2IX1 A;  5JEA G;  4A3M H;  3CC4 A;  3S15 H;  2JZM A;  3K81 C;  1BBU A;  1UE5 A;  4DV0 Q;  3T1Y L;  4WJ4 A;  2L15 A;  2Q2U A;  3RZD H;  5IE8 A;  2JA9 A;  1N33 L;  1XA6 A;  3I56 A;  1TUS A;  4OAU C;  4JI1 L;  2CKZ B;  2WP8 J;  3A5Z B;  5JEA J;  1BUS A;  1J5E Q;  4LF7 Q;  1X3E A;  4G76 A;  4Z7G A;  4L5R C;  3EN2 A;  1MKH A;  2JA5 G;  3KF6 B;  2ID0 A;  1FJG L;  4IJH A;  5LMN Q;  3S16 H;  3MEF A;  2AWO A;  2MFI A;  5M5Y H;  2GN5 A;  4LNQ A;  3U50 C;  1V1H A;  2GVA A;  1S72 A;  3J81 c;  2B0U C;  4LWC A;  3FP9 A;  4EQ5 A;  3AEV A;  4K0K L;  1IBL Q;  1YHA A;  4YWK A;  1XTD A;  2K5N A;  1QVC A;  1X6O A;  1EWI A;  1NJI C;  4DR4 L;  1TGS I;  3TS2 A;  3RLN A;  1WFQ A;  1SGY I;  2VW9 A;  2WAQ E;  4EX5 A;  1SJ8 A;  1VQK A;  4JBJ A;  3NEN A;  2UUC L;  3KDF A;  4HIM A;  1Q46 A;  1IY5 A;  2NVQ H;  3D00 A;  1IL2 A;  4MTN A;  4IOC A;  2UXD L;  4X64 L;  2A2D A;  2VS1 A;  4A3K H;  3JAM i;  1HJP A;  1S3O A;  1XPO A;  5FUX A;  1EUJ A;  2ASB A;  1QZG A;  3GTQ H;  3LJ1 A;  3L2P A;  3H3V I;  2C35 B;  2ZM6 L;  4AH6 A;  3E59 A;  2E8G A;  3SDJ A;  4C3I H;  3ULL A;  1XMQ Q;  2KMQ A;  2ODD A;  1OYV I;  3S1R H;  2JYY A;  2HHH L;  1PH5 A;  2SGF I;  1G51 A;  4GNX B;  1ASZ A;  2ATW A;  4JI8 L;  5K36 G;  3H0G H;  4SGB I;  4YZD A;  1JMC A;  3TQY A;  2BA1 A;  2FNF X;  4P71 A;  4YY3 Q;  2YV5 A;  4FDB A;  5DAE A;  2B8T A;  3RN5 A;  1LYL A;  4DR7 L;  4JI7 Q;  4AYB G;  2M5X A;  2QEX A;  2VZA A;  4BY1 H;  2GKR I;  4QGU A;  4A3C G;  5E7N A;  2JA6 H;  1PH6 A;  3KF8 B;  4QJF A;  4A75 A;  4NXM L;  1JB7 A;  2F4V Q;  4P73 A;  1X3G A;  3PF5 A;  1IBK L;  4A3D H;  2YUU A;  1TBN A;  1Y1C A;  4IO9 A;  2QQD A;  2K75 A;  2D0O A;  1UEB A;  3CME A;  4O2D A;  2VQE L;  4LF6 L;  1EQR A;  1HR0 L;  3VA9 A;  5M3F H;  1E1T A;  3HOV H;  3P23 A;  3AFP A;  2E5L L;  5JJI A;  4DV4 Q;  4O0A A;  2QGQ A;  1TIH A;  4KLK A;  2NU1 I;  4JC0 A;  5ELN A;  4JI5 Q;  4GLV B;  5JJL A;  5HGQ A;  3FBV A;  3SGI A;  3AQQ A;  3CCJ A;  2MQH A;  2DB6 A;  4DAY B;  4X62 L;  2V1C C;  4JI2 Q;  2UU9 L;  4GKJ Q;  1CKN A;  2PQA A;  1LR8 A;  2R93 G;  4JV5 Q;  3ULJ A;  4BA1 I;  3F2C A;  4RMF A;  3B6Y A;  2F52 A;  3BZC A;  3UEJ A;  4C3J H;  5CCL A;  3PUY A;  1PH1 A;  5FUW A;  2YYZ A;  1BKB A;  1SGQ I;  4GN5 A;  2N1A B;  3PUW A;  1VQG A;  2AWN A;  4ALP A;  4DWL A;  1PH3 A;  1VQH A;  4LUV A;  3PSI A;  4GN3 B;  4LUZ A;  1OXT A;  3HOU G;  2JA7 G;  1TOT A;  3RLF A;  3FKI H;  3RLO A;  1CT0 I;  5C4X G;  2E73 A;  3BJI A;  1K3R A;  2IT1 A;  3CCS A;  1GD7 A;  5FJ8 G;  1XJV A;  1QVF A;  1G6P A;  4IJL A;  4PL5 A;  3SEK C;  3ERS X;  1C7Y A;  1TWA H;  1U0L A;  3FHW A;  3UGI A;  1GO3 E;  3K7A H;  4BBR G;  2DUD A;  4BY7 H;  3PO3 G;  4PZ6 A;  1I94 Q;  5IYB G;  1KL9 A;  4AYB E;  3MEK A;  4L5S A;  1OXV A;  1SRU A;  2WVJ A;  2NZO A;  1YBY A;  4GS3 A;  5GAD C;  1PV4 A;  3LGJ A;  3PO2 G;  1SLJ A;  4O1P A;  3STB D;  1AE3 A;  1EQQ A;  2N8N A;  1EFW A;  2JJQ A;  3TRZ A;  5FUY A;  3CCV A;  2ORV A;  5IY0 A;  3E9H A;  1L1O A;  4A3I G;  1N32 L;  1Z7K B;  1N13 A;  4B3M Q;  2I0Q A;  4DUY L;  1FAR A;  1YVC A;  3PCO B;  4GLA C;  1ASY A;  1WCM H;  2JB2 A;  4B6D A;  4GKK L;  1VQE A;  1JJG A;  1KXL A;  2AKW B;  5GAG C;  3I4N G;  2JA8 H;  1YHB A;  1HZA A;  1V1Q A;  4DR3 L;  1QZH A;  1TUR A;  2OQ0 A;  4K0K Q;  4JOI C;  3L7Z C;  1QVG A;  1EIF A;  1KBF A;  3STB C;  3Q8D A;  5J3B A;  2BA0 A;  4JI3 L;  1VQ6 A;  3RN2 A;  3IAS 1;  1CHO I;  3TJQ A;  3OW2 A;  1XNQ L;  4H02 A;  4GLX A;  2ROW A;  1TBO A;  2XRC A;  1VQC A;  3M4Q A;  3GO5 A;  1A62 A;  2F3C I;  1WJJ A;  3B4V C;  1HR0 W;  5M3M H;  1E22 A;  1Q7Y C;  2RF4 A;  3U4V A;  4BA2 I;  4YZC A;  1Y1B A;  4DAM A;  1PPF I;  3CXL A;  4IFD J;  5IYC G;  2K5H A;  3KDF B;  4UPA A;  2XTR A;  5C4J H;  3W1G A;  2ZM6 Q;  4OX9 L;  1KQS A;  1FAQ A;  4BBS H;  2NN6 G;  2OWO A;  5IP9 G;  1PJU A;  2SGE I;  4HEA 1;  2ES2 A;  3F2B A;  3OVO A;  1W2B A;  1VQA A;  3NBH B;  1YIJ A;  4AQY Q;  3IRB A;  1L1O C;  3ZJY C;  3EIV A;  1KC8 C;  2F3I A;  1FL0 A;  4UP7 A;  1PH9 A;  3I7F A;  2R92 H;  1IBM Q;  1Q8K A;  3I2Z A;  4LFB Q;  4C2M H;  3AJF A;  1KRS A;  2A2C A;  3HOY H;  2EXD A;  4DR5 Q;  1VQI A;  4A3F H;  2ERW A;  4A3J H;  4QIW E;  2CCZ A;  1C9O A;  4DR1 Q;  3G4S A;  5GRO A;  4POG A;  4DR6 L;  3CCR A;  4JI6 L;  2Q2H A;  5HI7 A;  5IWA Q;  4DR7 Q;  4G75 A;  4DKA C;  4MZ9 A;  4LF4 L;  4HGU A;  1B70 B;  4NXN Q;  1UE7 A;  4APV A;  2GKV A;  4X65 L;  2CFM A;  4HJ7 A;  2L1L B;  3MXN B;  3UDI A;  1SE8 A;  3D31 A;  1WYD A;  3I4M H;  2VQF Q;  3GTK H;  2A20 A;  3CPW A;  1NMG A;  3GTG H;  3KLW A;  1I3Q H;  4X6A H;  2Z6K A;  3TS0 A;  4BXX G;  2RHS B;  1TWH H;  1BBW A;  4DUZ L;  3HOZ H;  2VQE Q;  4DV7 Q;  4X66 L;  2NVT H;  2KKM A;  1HR0 Q;  1HZB A;  4PZ8 A;  2KBN A;  2E5L Q;  1Y1W H;  4HJ5 A;  1YJN A;  4LF9 L;  4DV3 L;  4LF5 L;  1L2F A;  5FLM H;  2NVX H;  4HFV A;  3RR5 A;  2JA1 A;  1SR3 A;  3RU0 A;  5C3E H;  2K4K A;  2UUB Q;  4KHZ A;  3UEY A;  2K5V A;  5IP7 H;  4PZ7 A;  2J87 A;  1W3S A;  3J7Z C;  2UU9 Q;  3SGB I;  3HOX G;  1X54 A;  4YCW A;  3PGZ A;  1S40 A;  2MO1 A;  4DV2 L;  2JAE A;  2CQO A;  3HKZ G;  3OXG A;  1Q86 C;  2HIV A;  3GTO H;  1R0R I;  4A3D G;  2UXC L;  2ZTD A;  4OON A;  3CCE A;  1AH9 A;  4GOP A;  3EBE A;  1J6Q A;  2NU0 I;  4LFC Q;  4DR2 L;  3G6E A;  4ME3 A;  1CKN B;  1SGP I;  2R7Z H;  2YFA A;  2LXK A;  1JE5 A;  4JYA Q;  1X56 A;  1IXR A;  5C0X G;  4TVA B;  1XMO L;  2DIP A;  3S1N H;  4B3S L;  2CWA A;  3KY9 A;  2KMO A;  3A5U A;  3M7N A;  3OTO L;  1HNZ Q;  2UUA Q;  4R4O A;  1HNX L;  4HJ9 A;  3BJU A;  5CCM A;  3M9B A;  5C0X J;  4B3R L;  4DV6 L;  2B63 H;  3RZO H;  4GXT A;  3HKS A;  3HH2 C;  5IYD G;  5LMU Q;  4KI0 A;  1WOC A;  3PIP A;  1CUK A;  2OD1 A;  2MNA A;  3PF4 A;  2K9H A;  2F66 B;  4JI4 Q;  2WB1 G;  1N34 L;  5LNK 1;  3TRE A;  1A0I A;  2SGQ I;  1UVF A;  4DV0 L;  2IHE A;  4OXP A;  1Q82 C;  3KJP A;  4IPD A;  2CJS C;  2XTQ A;  1X55 A;  3E2I A;  4DV5 L;  3VDP A;  4I1T A;  2QQE A;  1N32 Q;  2VY3 A;  1X4S A;  4DUY Q;  2EQS A;  3UGL A;  1J5E L;  4YZ9 A;  4LF7 L;  3DM3 A;  3U4Z A;  4NV2 A;  1VQ9 A;  1IY6 A;  1A8V A;  2HIX A;  4GOP C;  3JAM c;  2JW6 A;  3I55 A;  3GD7 A;  4OWW B;  1SMX A;  2UXB L;  4OWX B;  4JBM A;  1HJA I;  1XPU A;  1R9T H;  5LMN L;  1L1O B;  4BY7 G;  1L0W A;  3UIT A;  2FUG 1;  3AYH B;  1VCI A;  4UP9 A;  1BMO A;  2LXJ A;  1AN1 I;  1KAW A;  3G71 A;  4E1P A;  2K50 A;  1NMF A;  3HKZ E;  1HDL A;  3KJO A;  4QL5 A;  4UXJ A;  1V1I A;  4YWL A;  1UUC A;  3E9I A;  1SRO A;  2D62 A;  2I5H A;  1Y1V G;  3H15 A;  2HQL A;  3DLL A;  3F2D A;  1H95 A;  1LTL A;  2PI2 E;  2Z0S A;  1PH7 A;  1XNR Q;  2K19 A;  1Z47 A;  1Z9F A;  3UDX A;  3PDN A;  4A3G G;  2E2H H;  4XTC S;  1Q1B A;  1CSO I;  1VQJ A;  3NEM A;  4GNX A;  4A3C H;  3S17 H;  3S1M H;  5BR8 Q;  4IFD I;  4OVO A;  3DA3 A;  1IYJ B;  2CAZ B;  2I5M X;  1R79 A;  3PUZ A;  1XPR A;  3CQZ H;  3U58 A;  1XMQ L;  1SN8 A;  4DV1 Q;  1PH8 A;  2VUM H;  2IY5 B;  1FGU A;  2NVY H;  4KHP Q;  3UE0 A;  3HOW G;  2WB1 E;  1YJW A;  1I6H H;  1G29 1;  2E2J H;  3T1Y Q;  1CT4 I;  1M1K C;  4A3B H;  1M8B A;  4YCU A;  4YY3 L;  1N33 Q;  3E0E A;  1AE2 A;  1VQ7 A;  5FLX c;  4JI1 Q;  4UXI A;  2XGT A;  3G48 A;  2P6A C;  4LF8 L;  1VQP A;  4JI7 L;  4NV5 A;  1DS2 I;  4A3L G;  2LSS A;  4LW1 A;  2YQP A;  2YU9 H;  2LEO A;  2IP6 A;  3UDG A;  1FJG Q;  2R93 H;  4POF A;  1KD1 C;  1P8L A;  3UE1 A;  3GOX A;  3T1H L;  2PNH A;  4OO1 I;  2R92 G;  1HZ9 A;  3L0I A;  4R1J A;  3TEH B;  3SGQ I;  3CPF A;  3FC3 A;  1OXX K;  4A93 G;  2K52 A;  2IHF A;  4L5T A;  4A3M G;  4A24 A;  4DV3 Q;  4LF5 Q;  1MJC A;  1VQN A;  2XTI A;  2OQK A;  4DV4 L;  3ICE A;  4DR4 Q;  3VDY A;  5M5W H;  2JB3 A;  1IW4 A;  3UFF A;  2YTV A;  3HOU H;  3F1Z A;  2JA7 H;  3D0F A;  2UUC Q;  3W1B A;  4JI5 L;  2ALY B;  4E1R A;  3S24 A;  3K80 C;  4DV2 Q;  1YO7 A;  5FJ8 H;  4LFA L;  2UXD Q;  2KCT A;  1PYS B;  2UXC Q;  4X64 Q;  3CC7 A;  3I4M G;  4IPH A;  4GKJ L;  2KCM A;  2SGP I;  2JEB I;  4QQB X;  4AS2 A;  2DGY A;  4JV5 L;  5LMN W;  2B29 A;  2H5X A;  4BBR H;  3CCU A;  3UGD A;  1N36 L;  5DLQ E;  3CCQ A;  1N8R C;  3PO3 H;  2LUY A;  4J15 A;  4UXH A;  1K73 C;  1YEZ A;  1XX6 A;  4QY7 A;  1Y1W G;  1CGJ I;  2PMZ E;  4YCV A;  3J81 i;  4HIO A;  3K7U C;  4GOP B;  1PA6 A;  2N3S A;  2NZH A;  5FLM G;  2A8V A;  5JJK A;  2N52 A;  3CMA A;  2HHH Q;  5IP7 G;  4B3R Q;  1JJC B;  4JI8 Q;  1EIY B;  3QWP A;  4R4C A;  3S14 H;  4DV6 Q;  5FUV A;  1LM0 A;  1N9W A;  2MO0 A;  2AHO B;  2SGD I;  2V53 A;  2I5L X;  3WWV A;  4A3K G;  4IOA A;  5IT9 c;  2A1A A;  1YHQ A;  3UDF A;  3GTP H;  4MNO A;  3LJ0 A;  4HIK A;  1O7I A;  3M3Y H;  3I4N H;  5GQO A;  2R7Z G;  4PL4 A;  1D7Q A;  3BZK A;  4PL3 A;  1I94 L;  2RCN A;  4OO1 G;  1UVG A;  1PHJ A;  2WCY A;  4PG3 A;  4NXM Q;  1FVI A;  2R7F A;  1JT8 A;  3CAM A;  1B7Y B;  1IBK Q;  1X74 A;  4DV5 Q;  2L7X A;  4GN4 B;  3J80 c;  4P74 A;  1KBE A;  1HNW L;  2VNU D;  3NEL A;  3H0G G;  5C44 H;  4JCV E;  2B63 G;  4LF6 Q;  2KMP A;  4DNI A;  4B3M L;  2UXB Q;  4YHH L;  3CC2 A;  2CWP A;  1PH4 A;  1Y8F A;  3QTL D;  5IYC H;  4UP8 A;  2RIO A;  2Y0S G;  2AMC B;  3OL0 A;  1VQB A;  4A3E H;  4WJ3 M;  2GVI A;  1MJE A;  4XIG S;  4Q9V A;  2WFW A;  1TWG H;  4BY1 G;  2QQ0 A;  4X62 Q;  1YNX A;  4P72 A;  1SGE I;  2JA6 G;  5H1S E;  4DK6 C;  1SGN I;  5IP9 H;  2YFB A;  2P22 B;  2E2I H;  1SGD I;  1V9P A;  2ENN A;  1I5F A;  4HJA A;  4B3T L;  1YJ9 A;  1IZ6 A;  2OCE A;  2A19 A;  3RNU A;  3S2H H;  1E1O A;  1X9N A;  3KOJ A;  1GM5 A;  2PQA B;  2ARP F;  3JSB A;  5M3F G;  3HOV G;  4L9M A;  2ORW A;  1FYB A;  1CGI I;  4JI0 L;  3K8A A;  1OTC A;  2XMX A;  5HQ8 A;  1K8A C;  4Y7N H;  2VL6 A;  4Y52 H;  3OXL A;  1V43 A;  1QUQ A;  1PTQ A;  3OXF A;  3S1Q H;  5EAY A;  3ULP A;  1X65 A;  1VQ8 A;  1K83 H;  2GVB A;  4A76 A;  2ZJQ A;  5AJ3 L;  1VQM A;  2JA5 H;  1B8A A;  4IPC A;  2Z6K C;  2BH8 A;  2V1C A;  1UE6 A;  2UZ3 A;  5HY6 A;  4AQY L;  2KEN A;  1TBR R;  1K9M C;  1K8G A;  1KMA A;  4BXX H;  2Q2T A;  1YI2 A;  1PFS A;  1YZ6 A;  3L0O A;  1OMU A;  2N71 A;  3K0X A;  2JK8 A;  1IBM L;  1NY4 A;  1YIT A;  4LFB L;  1CKO A;  3CF5 A;  3A74 A;  1PVO A;  4DR5 L;  3CW2 C;  1CSQ A;  3HFZ B;  5GAE C;  1K0R A;  2N49 A;  4R4Q A;  2KHI A;  1VQ5 A;  4JBK A;  4DR1 L;  3KP9 A;  4P75 A;  1NUB A;  4PMW A;  3KF6 A;  3DO9 A;  1E24 A;  1Y14 B;  2EIF A;  5IWA L;  4LF8 Q;  2L8E A;  1I50 H;  5JHW C;  5ELO A;  3FKI G;  4NXN L;  3HOX H;  4NPS A;  3LJ2 A;  3CXC A;  1P16 A;  1LUZ A;  3GDE A;  3PV0 A;  3KYH C;  3J7A 5;  2YTY A;  2IX0 A;  4U6R A;  1TXY A;  3T1H Q;  3CD6 A;  2ZRR A;  2VQF L;  4GKK Q;  2N78 A;  1MT1 A;  3CCL A;  2VUM G;  2V6E A;  2Q2I A;  2Y0S E;  4OWT B;  1HZC A;  2ZTE A;  4DR3 Q;  2MJF B;  4DV7 L;  1VS0 A;  1E3P A;  3W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...