1W3SA

The crystal structure of reco from deinococcus radiodurans.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
230
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and DNA-Binding Analysis of Reco from Deinococcus Radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna repair
molecule keywords HYPOTHETICAL PROTEIN DR0819
total genus 53
structure length 230
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1w3sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1w3sA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1w3sA03
1UE6A 1WYDA 1V9PA 2I5MX 2UUCQ 3HOWH 4DR6L 1TWHH 2QGQA 3TREA 5EAYA 1EUJA 4HIDA 4A93H 2K5NA 1HZAA 3K7UC 4OO1I 5GAHC 1S3OA 1HNZQ 5K36G 4LF7Q 4GLVB 1XNQL 1VQIA 1LUZA 1YIJA 1X9NA 1I94L 2C35B 1VQAA 4B3RL 4MZ9A 2EIFA 4GKJL 1N9WA 3W1BA 4JV5L 2MFIA 4DNIA 5IYCG 4DR5L 1QVFA 1VQKA 3S2HH 3RZDH 4DR4Q 3IRBA 3CCRA 2I0QA 2AMCB 1HNWQ 4OXPA 2UU9Q 1XPUA 1JE5A 2VUMH 4X6AH 5AJ3Q 2VW9A 1X3EA 2MO0A 1E1TA 3H15A 4DR6Q 1L1OA 4DV6L 4JI8Q 3M4PA 4LUVA 1PH6A 5M5XH 3VDYA 1Q8KA 1IYJB 1U0LA 3EBEA 4QL5A 4A3FG 2UXBQ 4JV5Q 3HKZE 5IYCH 1L1OC 2JA7G 3CC2A 1N36Q 2PQAB 2AKWB 1Q1BA 4JI3L 3KFUA 4KHPQ 3OTOQ 3GDEA 1JJ2A 4KLKA 4C3IH 4GOPB 4DV2L 4IOCA 4Y7NH 2HHHL 2Y0SG 2UUAL 1YJWA 1PYSB 2ZTCA 1JMCA 4JI5Q 4A93G 1KHIA 4A3CH 2OCEA 1E7ZA 2UUBL 1CUKA 2K14A 4AH6A 3PF5A 1QZHA 1JJCB 4K0KL 2UXCQ 1TWAH 1PHJA 1SN8A 3I7FA 4GKKQ 3HFZB 4IPHA 1NBWA 2VNUD 1SR3A 4O0AA 4DV6Q 4JI0Q 1PA6A 1V43A 3ZJYC 4LWCA 1KQSA 1YEZA 3RLOA 4YY3Q 4TQUS 3HOZH 3WWVA 2BA0A 4IPCA 1HNWL 2E2IH 2JA6G 1EOVA 1SRUA 1K0RA 3FP9A 1YITA 4WJ3M 1H95A 4R4QA 4L5RC 2KCMA 3KJOA 2D62A 4JI1L 3KYHC 2Q2IA 3CCQA 2OWOA 4PG3A 1AE2A 3PUYA 1K73C 5IE8A 1WCMH 2JA6H 1CKNA 4YWMA 4YHHQ 1KC8C 1CKNB 3BZKA 3F8TA 1S40A 4B3MQ 2E2JH 1E22A 5M3MH 2WAQE 1PV4A 4YWLA 4YHHL 4JI0L 1C7YA 1IBKL 3MXNB 1J5EL 3M3YH 4DR3Q 2A8VA 4YWKA 1YNXA 3L2PA 1HZBA 2D0PA 3UDGA 4GNXA 1UE7A 2WB1E 3KLWA 4DK6C 1TWCH 3ER0A 5FLMG 1FVIA 3GTGH 4DV5L 3K8AA 1RL2A 3J80i 2Q2UA 2Z0SA 3F2CA 1PYBA 4DV5Q 1A0IA 3T1HQ 1XNRL 1VQ8A 2RCNA 3KF6A 3KOJA 2KENA 5C3EG 5C4JH 3RNUA 4POGA 2JA7H 3J81j 4JI2L 1YBYA 3G48A 3CF5A 1I5FA 3BU2A 5IWAL 1PVOA 5M3FG 1E1OA 1XPOA 5BR8L 2R7ZH 1T9HA 4DV7L 5IP9H 4X66L 1O7IA 1IBKQ 4A76A 1MKHA 1LTLA 2B3GA 5C0XI 2RHSB 4HJ9A 2NVXH 1PH7A 4PZ7A 5LMNL 3FHWA 3S2DH 4J15A 1I50H 4YCUA 1D8LA 2JK8A 4BA1I 4DV4Q 4HJ5A 1HR0L 4JI3Q 2VUMG 4A3GH 4X62Q 1ASZA 2CCZA 1HR0W 5LMUQ 1GD7A 4IJLA 4A3KH 2UXBL 4GN5A 4JOIC 2ZTDA 3PO2G 2OQKA 1VQHA 4OWTB 3HOUH 3DM3A 3K80C 3J81i 1Q1EA 3CCLA 3W1GA 1N32L 3AYHB 4AQYL 2BH2A 4DV4L 2JEAI 1FL0A 3GTLH 2ALYB 1JB7A 2EQSA 4GLAC 4UP8A 3HOVG 1Y14B 3M85A 2UU9L 4C2MH 1BBUA 1XMOL 4X66Q 3HOYH 2R92H 3GTPH 1K83H 3CCSA 1B8AA 1IXRA 2NZOA 3H0GH 1VQMA 2F4VL 3H3VI 3HOWG 4JYAL 3T1YQ 3BZCA 1N33Q 3KJPA 1SMXA 2H5XA 2DUDA 3DLLA 2AWNA 4AYBE 1HH2P 2K52A 1C9OA 2L15A 2PI2A 3RN2A 3ULPA 1MJCA 3M9BA 4DR5Q 4BBSH 4GS3A 1NJIC 4BY7G 3G4SA 1LYLA 5LMNW 1E3PA 1U5KA 4A3JH 4OWWB 4OO1G 3SGIA 1UEBA 1L2FA 2K5HA 1PH8A 3T1YL 4R4OA 2DGYA 4GOPA 2UUBQ 1N33L 1JJGA 3PO3G 3S1QH 3E9IA 1EYGA 3A5UA 3I4NG 2JJQA 2JEBI 3NELA 2EXDA 1XJVA 4POFA 4L5SA 2JA8G 1OXTA 5C44G 3TEHB 2XGTA 2R7FA 1N32Q 1VQGA 2YU9H 2F3IA 1B70B 4YY3L 5HY6A 1VQOA 1WFQA 1G51A 1X6OA 2MO1A 4MTNA 4HIMA 1V1QA 3PUZA 2ZJPA 5C4XH 2E8GA 2HIVA 1MIUA 1Y1WG 2VY3A 2Z6KC 4IOAA 2UXDL 3STBC 1Y1VG 5FJ8H 2B29A 2IX0A 4PMWA 1QVCA 1TXYA 2A19A 2WB1G 4YCWA 1CKOA 1SLJA 2WFWA 2IY5B 2VQEQ 1EQQA 1HZCA 2PMZE 1X65A 3K7AH 4YCVA 4DV2Q 1IBMQ 3NEMA 3KDFB 3Q8DA 1IBLQ 3UDFA 3S1MH 3AQQA 4H02A 3HKZG 3D0FA 3J7A5 1NMGA 3MEFA 2MQHA 4B3TQ 2AHOB 4A3LH 5LMUL 4Y52H 5C0XG 4JI5L 4KHZA 1GM5A 2VS1A 4DUZQ 4PZ8A 1IBML 4UP7A 1K8GA 4PZ6A 5C0XJ 4BY1H 1XTDA 2HQLA 1KRSA 3W5OA 4DV7Q 1QUQB 5JJKA 4A3EG 1IL2A 4B3SQ 3RLNA 3RN5A 3HOXH 2JA5H 3D31A 1NE3A 1IBLL 1FJGL 4DR3L 5IP7G 4KI0A 4HJ8A 4LFBL 2VQFQ 2GN5A 5ELOA 3ULLA 5IYDH 3JC66 1VS0A 3G71A 1CSQA 3CP0A 2Q2TA 2IX1A 4A3BG 4C3JH 1Q46A 2VQFL 1YHQA 3CCJA 4IFDJ 2UUCL 4P72A 2RF4A 4C3HH 4A3MG 3PGZA 1AE3A 1I3QH 4LFCQ 3J81c 3GTMH 4DR7Q 4B3ML 1VQCA 3RR5A 2IT1A 3GTQH 3CXCA 4A4IA 4XTCS 1BBWA 4LF6Q 2GVAA 2YV5A 2JE6I 1UWVA 4P71A 3U58A 2R93G 4IPDA 2WP8J 4TVAB 3A0JA 1VCIA 5GROA 1FJGQ 1VQ6A 1WOCA 2PI2E 3G6EA 1PH3A 3H3VH 1J6QA 1X3FA 1YVCA 2PQAA 3GO5A 3UE0A 4NXML 2YYZA 4ALPA 1KIXA 5IYBG 2F4VQ 3UDXA 2OTJA 4A3BH 2B63H 1PH1A 4LW1A 4LF6L 1HZ9A 4GN4B 1SROA 3CCEA 1QZGA 1KXLA 4JI4Q 4A3DG 4DPGA 2I5LX 1HR0Q 2LXKA 1K9MC 3STBD 1Q12A 5IWAQ 2VQEL 4A3DH 3TS0A 1EQRA 1X56A 3EN2A 4LUZA 4BBRH 1PH4A 1PH9A 4JI1Q 4A3EH 3TRZA 3CCVA 3GTOH 1A8VA 4P74A 2UXCL 1XMOQ 3S14H 3CPWA 1HNZL 3ICEA 2CKZB 2V1CC 4X62L 4A3IH 4P73A 1PH5A 5C4XG 4AQYQ 3FKIH 1N36L 1EFWA 3GTJH 2E5LL 4BXXG 2UXDQ 3OTOL 1YHBA 2JQOA 4NPSA 2K50A 3I4OA 3RZOH 4BA2I 2ZJRA 1GVPA 2VZAA 4DR4L 4GKKL 4LUOA 1VQDA 1W2BA 3PF4A 1JT8A 1L1OB 4O2DA 5M5YH 1DGSA 3KF6B 5GAEC 4BXXH 4DK3C 1UE5A 1Q7YC 2NVYH 3JAMi 1PH2A 2QA4A 4DUZL 4MNOA 2VL6A 2XTIA 3U4ZA 4NXNQ 3I4MH 1VQFA 3OYYA 3AFPA 4NB3A 5FJ8G 4DV0L 3TS2A 5IYDG 1A63A 2ZM6L 2OQ0A 1HNXL 4DV1Q 4IO9A 1OXXK 2NVTH 4DR2Q 3M4OH 4JBWA 3E0EA 1VQ7A 2MNAA 1OXUA 3OW2A 1EIFA 3HOXG 3KDFA 3T1HL 3K0XA 1Q81C 2K75A 5C44H 2OTLA 1VQNA 2NZHA 3S24A 3CW2C 2AWOA 3I2ZA 2IHEA 1KRTA 2YTXA 2ES2A 1BKBA 3B6YA 4LF8Q 4OX9Q 2YTYA 4GLXA 5IYBH 4A75A 3I4NH 4WJ4A 3I4MG 3NBHB 1WI5A 3PCOB 4DAMA 2BA1A 3CAMA 5GADC 1SE8A 4ME3A 1N34L 1KL9A 3J80c 3HKSA 3F2BA 2ZJQA 4LF9Q 2ASBA 2KBNA 2HT1A 3PUXA 1J5EQ 2Q2HA 1D7QA 3TQYA 5H1SE 2N8NA 4JI7L 5GQOA 4DV1L 5JJIA 3PIOA 1QUQA 1P8LA 4UY8C 4IJHA 4LFBQ 3FKIG 3BJUA 2R6GA 4A3IG 1EWIA 2BH8A 4EQ5A 2R92G 2RHQB 4AIMA 3PSIA 3RLFA 4JI8L 3CPFA 1Y1WH 1S72A 1OXSC 2CFMA 3UDIA 1HJPA 1WJJA 3LGJA 4AYBG 2K4KA 4BBRG 2E2HH 4LNQA 3L0OA 3CC4A 4X65L 4LF5L 4GNXB 3CQZH 2GVBA 1K3RA 4R4CA 4XIGS 5BR8Q 1NY4A 4L5QA 4DUYL 2JA5G 3PIPA 1VQ4A 2ID0A 1MJEA 3PO2H 3EIVA 2B63G 5IY0A 4QQBX 2KHJA 1OXVA 4DR7L 3S16H 4LF9L 3KF8B 3PO3H 2KHIA 1E24A 2NN6I 3PV0A 5AJ3L 4A3GG 4UP9A 1K8AC 1Q86C 4B3RQ 1OTCA 2CQOA 1XNRQ 4GKJQ 1N8RC 2CWAA 4JOIA 5LMNQ 3CMEA 3CD6A 1NTGA 4DUYQ 1FGUA 4A3JG 5IP9G 3K81C 1XMQL 2R93H 2Z6KA 2N78A 1PFSA 1I6HH 4GNXC 1CKMA 1EIYB 1G291 1Q82C 2HIXA 1M90C 1GKHA 5C3EH 3GD7A 3S1RH 4JC0A 5GAGC 2PNHA 2JA9A 2D0OA 3M4QA 3E9HA 2QEXA 2ZTEA 1HNXQ 4L5TA 1XNQQ 1VQ5A 3GTKH 5JJLA 4A3MH 3H0GG 4FDBA 4JI4L 4QY7A 2NVQH 2WAQG 4JI6L 3NENA 4NXNL 1Y1VH 1LM0A 4JBMA 1KAWA 4RG1A 2FXQA 3CCUA 4GOPC 4JCVE 1QVGA 4X64Q 4R4IA 4LF8L 1GO3E 4EX5A 5IP7H 4P75A 4DV3L 1YJNA 1BVSA 2CWPA 4OONA 1YJ9A 4B3TL 4X64L 4JBJA 4RMFA 1RIPA 5M3MG 4DV3Q 3S15H 1N34Q 2JA8H 2IHFA 1KD1C 1M1KC 5J3BA 5JEAG 4JI6Q 3ERSX 4DKAC 2ZM6Q 4BY1G 2E5LQ 1G6PA 1IZ6A 3ULJA 2A1AA 4APVA 1YHAA 3U4VA 4IFDI 4R4TA 1VQPA 1XMQQ 3S17H 5JEAJ 3M7NA 5E7NA 4KHPL 4K0KQ 1P16A 4B3SL 1AH9A 4A3LG 1TWFH 2N49A 3AFQA 3JAMc 2R7ZG 2R7DA 3U50C 4BY7H 4HIKA 5M3FH 2HHHQ 2UUAQ 4BBSG 2ATWA 3F1ZA 4IPGA 4QJFA 5DLQE 4HJ7A 1TWGH 2F52A 2Y0SE 4LF4L 4LFAQ 1VQEA 4HIOA 1XPRA 3PUWA 4QIWE 3CCMA 3PUVA 4LFAL 4UPAA 2I5HA 4X65Q 4LF5Q 1C0AA 2K5VA 4DR1Q 2YTVA 3HOYG 5FLMH 4GN3B 2N3SA 4A3CG 4JI2Q 1ASYA 1B7YB 3HOVH 1Z47A 1L0WA 1Z9FA 3F2DA 5M5WH 1VQJA 4R1JA 1YI2A 1R9TH 4LF4Q 4JG2A 1CSPA 3HOUG 2KCTA 1A62A 1UE1A 4JBKA 1SFOH 3I55A 1X54A 4HJAA 3CMAA 1VQLA 5IT9c 1I94Q 4A3KG 1WCMG 3L7ZC 4NXMQ 4A3FH 1VQ9A 4DR2L 1X3GA 2NN6G 3AEVA 3UE1A 1YZ6A 4IFDG 3I56A 4LF7L 4DAYB 4OWXB 5ELNA 4DV0Q 3CC7A 5HGQA 1VQBA 1X55A 3S1NH 2LXJA 4OX9L 1W3SA 1NMFA 3A74A 4JI7Q 3HOZG 4LFCL 3A5ZB 2LSSA 5FLXc 3J7ZC 4DR1L 4JYAQ 4QGUA
chains in the Genus database with same CATH superfamily
2OU2A 1UE6A 1WYDA 2B8GA 2DKVA 4OIJA 3TREA 5D3DA 5EAYA 3K5OA 3BVGA 1R9TB 2RDGA 2PQ8A 3K7UC 4OO1I 1S3OA 1PFMA 1CZGA 1DM0B 2E5RA 2ICEC 2C35B 4B3RL 4GKJL 4MZ9A 1HFGA 4C1NK 4TKOB 5EGTA 4JV5L 4I65A 1QVFA 1BCPD 1VQKA 4DR4Q 1QILA 2AMCB 2MJFB 1WGCA 5KYIA 1XPUA 2NYZD 1JE5A 3TBIB 5CBEE 5AJ3Q 2VW9A 1X3EA 1Y1VB 3R8BA 5I9PA 3RUZA 1KBFA 5M5XH 1IYJB 1HTLD 4A3FG 4G75A 1AN1I 2V4DA 5IYCH 2PQAB 4KHPQ 2IP6A 4C3IH 2CWHA 2UUAL 2Y0SG 1R0RI 1GXDC 1KHIA 1Y8FA 1R4PB 4SGBI 2D2CC 1JJCB 3TO6A 1PRTD 3EROA 3HFZB 2B2YA 2LS01 2VNUD 5KNBA 4JI0Q 3RD4A 3ZJYC 4A3KB 1XYIA 5CCMA 4IUQA 3FBVA 2WGCA 4TQUS 3UEYA 4IPCA 2B2YC 2N52A 3A8JE 4FVMA 2E2IH 1K0RA 2F0JA 1TBOA 3B55A 4L5RC 1E2VA 3KJOA 5LL6X 2R92B 1SBBB 2OWOA 1I6HB 1W4RA 2RLDA 2SDFA 1AE2A 1HHVA 1EEID 3VE5A 1F77A 1KDBA 1KLGD 1NR4A 4YHHQ 1CKNB 3BZKA 3F8TA 1S40A 2JA5B 1GOZA 5M3MH 2IX3A 1I6VC 1BCPC 1C7YA 3MXNB 2I46A 1J5EL 3M3YH 3MXNA 1R4QB 4YWKA 4E1PA 1YNXA 4KY5A 1SNDA 3FPPA 4A3GB 4GNXA 3KLWA 1TWCH 5FLMG 3I90A 5EBCA 3K8AA 5HQ8A 1RL2A 4MN3A 3OSOA 2Z0SA 3F2CA 4DV5Q 3T1HQ 5CV9A 1J8IA 4MHEA 1VQ8A 3KF6A 3KOJA 2KENA 5C3EG 3RNUA 5EJWA 3J81j 5IWAL 3MHBA 5KRUA 3KLSX 4DXFA 1TKWB 1XPOA 1T9HA 4DV7L 1O7IA 1V1HA 3UI2A 1TIID 2NVXH 1LTLA 2ENZA 4ZCKA 3A8IE 4GN5A 4UXJA 1RHPA 5CV8A 3CU7A 1TWAB 5M3MB 1JE4A 3HOUH 2V53A 1Q1EA 3AYHB 4DV4L 3GTLH 3GTJB 2ERWA 3UOEA 4UP8A 1EZ6A 1JC7A 2F0KA 1XMOL 3HOYH 4OIKA 4FYDA 1HXYD 1K83H 2GIVA 1IXRA 2NZOA 1MSHA 3T1YQ 1N33Q 4U6RA 3DLLA 2JXDA 5C6AA 3H3VC 4KJNA 1RCVD 2Q8IB 1WKXA 3ULPA 4DR5Q 1LYLA 4A3JH 4OO1G 5C4HA 3SGIA 1UEBA 4R4OA 5CBAE 4GOPA 2XNAC 1F9SA 1JJGA 4Y7NB 1WTRA 3S1QH 1CGJI 3I4NG 1EQVA 3MVVA 2YFAA 2YU9H 4PL5A 1GJXA 1E2ZA 1LT3D 1BO0A 1WFQA 1D1KA 5CV4A 2H4OA 1PJUA 4HIMA 2AUKA 2ZJPA 1MSGA 3PUZA 5C4XH 2E8GA 2UXDL 2VY3A 4HEDA 4R8NA 3SK8A 2B29A 4CKBA 1QVCA 1TXYA 2WB1G 2NVXB 4YCWA 1CKOA 2VQEQ 4RCNA 1SJED 1KBEA 1X65A 3NEMA 1JOKA 3P1HA 2FJ2A 4ZRZA 4EVOA 5FUVA 3AQQA 4CDDC 4PMBA 3SK4A 3SEBA 3VYRA 5FOBB 3MEFA 2AHOB 1SE4A 3P23A 1TS3A 3SHLA 2LFNA 2VS1A 4FF4A 4PZ8A 4Q0FA 2B2UA 5CORA 1K8GA 1HTPA 2ROWA 4BY1H 1MJ9A 2HQLA 3BDOA 2DIPA 1LT6D 2LUYA 3I91A 3MXGA 3QG1A 3HOXH 1WTOA 2FNFX 4UAIA 5ELBA 3NWSA 2NU1I 2JA6B 3E3XA 5IP7G 4KI0A 4RGTA 4X3TA 4HJ8A 4LFBL 3SE0A 5ELOA 5KGUA 1ESRA 3ULLA 5IYDH 2J0TD 3G71A 2Q2TA 3TN2A 2CQAA 4A3MG 1JWUD 1VMCA 3QTLD 3GTGB 4OHJA 2DNCA 3X3MA 4DR7Q 5DEHA 4E1RA 1WTJA 1W6JA 4P71A 4LJZC 1BBXC 2WP8J 3I4NB 5KIXA 4IUUA 1CT2I 1VQ6A 1WOCA 1WCMB 2E75C 3RZOB 3UE0A 4FXKC 4Q5VA 2B63H 2O2LD 1KXLA 1TDPA 3UGLA 3C2PA 1HR0Q 1Q12A 1HPCA 1QJOA 3TS0A 1EQRA 1X56A 1PH9A 4JI1Q 2R61A 1A15A 3OXGA 2PNRC 4KV6A 1XMOQ 5E3PA 1HNZL 3ICEA 4A3IH 4P73A 3MWYW 1SYDA 4DA2A 2MJ8A 1JCKB 4NPSA 4GKKL 4OVOA 3PF4A 1L1OB 1G91A 1Z7TA 1NR2A 2DN8A 4BXXH 2ZXRA 3BG3A 1UE5A 1PTOH 1PH2A 1V1PB 1M8BA 2SGDI 4MNOA 2XTIA 1NCVA 4NXNQ 4B9XA 5FJ8G 1BXTA 4DV0L 5IYDG 1ML0D 2ZM6L 2LB7A 2F0OA 3C1EA 3DEPA 4XQNA 1VQ7A 5FO9B 5NUCA 1W6KA 2MNAA 1EEFD 1OXUA 3HOXG 3KLRA 3T1HL 1PDQA 5C44H 2B2VC 3S24A 2AWOA 5ELDA 2IHEA 3CXLA 4Z7HA 2RBMA 4A75A 3GOXA 4ZLTF 2B2VA 3S16B 3PIP3 4ME3A 4M1UB 3PO2B 4YIJA 1J5EQ 2Q2HA 2PW5A 1DOKA 2KOLA 2N8NA 2M5XA 1CM9A 3M3YB 2GKVA 3PIOA 5M5WB 2F1MA 4TRDA 4IJHA 3FKIG 3UEJA 1A2UA 4MPIA 3OL0A 3C46A 1K8OA 2PZWA 2WB1B 2JAEA 2R92G 2HDLA 3QWPA 4JPBW 4CHTB 3M4OB 1K7UA 2ZW3A 3UDIA 1HJPA 1WJJA 4LNQA 5C4XG 2K4KA 4BBRG 2E2HH 3L0OA 3WOFA 2WAQB 2EYMA 2GVBA 3CQZH 1K3RA 3KY9A 5I2XA 5J8FA 4L5QA 2JA5G 3PIPA 3FC3A 1T5EA 4EGVA 3PO2H 4JK1C 4U68A 2KHJA 1IW4A 1OXVA 1DS2I 4Z7GA 4BWGB 5AJ3L 4A3GG 2CQOA 3VA7A 1CHOI 3OIPA 1N8RC 4JOIA 3BS1A 4O1NA 5LMNQ 2JA8B 4J8QA 4A3JG 2Z4HA 5C4ZA 1I6HH 4K8JA 4GNXC 4ULLA 5EX0A 2AQ1B 2HCIA 2EYHA 3GD7A 1SYCA 5GAGC 2CH4A 2PNHA 1PPFI 1I4RA 4UDUC 2KCCA 3DM1A 1TWFB 2L0CA 1SMYC 2WAQG 1WD1A 1HJAI 1Y1VH 1LM0A 3BVMA 2SNMA 2FXQA 3CCUA 4KN7C 3OIQA 2MHVA 3RZDB 5JHWC 4DV3L 1YJNA 2QDBA 3HKZB 4B3TL 5FLXE 1SGDI 4FP5D 3TP6A 2JA8H 5JOBA 1KDAA 1M1KC 1H9SA 3T53B 4C3IB 2A2DA 3ERSX 1PCEA 1AW7A 2EXZA 4K2LA 2QQDA 1G6PA 4APVA 5C3WA 3U4VA 3M7NA 4K0KQ 2ENNA 5KEEA 1XA6A 2NVQB 4H7BA 3ERQA 2N88A 2X6GA 3V2TA 5HGIA 2R7DA 2I07B 3JAMc 2HHHQ 3GTMB 4BY7H 4BBSG 5JVG3 1NNXA 1V1IA 3F1ZA 1QNKA 3PMFA 2K19A 1EOTA 3CRLC 1K8MA 2F52A 4OEMB 3LX0A 5I4DA 1VQEA 1XPRA 2G9HD 2YUUA 2SOBA 2EDGA 5T1IA 5CV6A 2EE1A 3CCMA 1BCPF 1C0AA 2F0FA 1EU4A 2H1EA 2JA7B 3NXWA 2K5VA 4DR1Q 5FLMH 1B7YB 1Z47A 1Z9FA 5M5WH 3I8ZA 1K7TA 2B39A 1HPTA 2BE5D 3OWEB 4Q9VA 2O5IC 1I50B 3CMAA 1I94Q 3BVZA 1GHKA 2XWBB 1EYCA 1X74A 1K3BC 4ZK9B 2MUYA 3ND9A 3I56A 2CH4W 4DAYB 4DV0Q 3CC7A 1X55A 4OX9L 2K5DA 2VXWA 2KQ3A 3NQIA 2A6HC 4IUPA 3I70A 3BDLA 2PCFB 1PFBA 4DR1L 4JYAQ 3M7GA 1V9PA 1Q9BA 1C48A 2ODDA 2NVYB 1EY9A 3D6WA 1FNVA 2NZ1D 4HIDA 5IIFA 1LT5D 1LTAD 1LACA 2EZVA 2E2JB 3FPUB 1HNZQ 4H13C 4C3IG 1ILQA 1WTVA 1XNQL 4UHVA 1S5CD 1YIJA 1X9NA 4YZDA 1I94L 1TVXA 1N9WA 1CT1D 5IYCG 4RKBA 4DR5L 2JB1A 3S2HH 1KAAA 2A6EC 3NQTA 3T51B 1SSOA 2F0EA 3IRBA 4A3IB 2I0QA 2EYJA 2RSNA 1HNWQ 5K5PA 2UU9Q 4X6AH 1SGYI 2MO0A 1E1TA 3H15A 4DR6Q 4DV6L 4KD3A 4JI8Q 5C4XB 4N8FA 1PRTF 1A3VA 1STYA 1Q8KA 1U0LA 3EBEA 2E74C 1C8CA 3HEJA 2UXBQ 2N71A 5FUWA 3K5MA 4JV5Q 1STHA 4QCLA 3BYTB 2AKWB 2JB2A 1Q1BA 3GDEA 2F0QA 3Q22A 4GOPB 2A69C 2HHHL 4QB4A 1YJWA 1PYSB 2ZTCA 1WTXA 2KMQA 2UUBL 5EPLA 2K14A 4AH6A 4C1NI 3PF5A 1QZHA 4K0KL 2KEEA 3IAS1 4IPHA 1NBWA 4DFAA 2PQEA 4O0AA 4ZUIA 1V43A 1JOOA 4LWCA 3SVMA 1ULMA 4IURA 1XX6A 3WWVA 2BA0A 2NB0A 4LMQD 5CC4A 1VF7A 2JA6G 2J87A 3FP9A 5LNK1 4R4QA 2F0SA 1EWCA 3HRZC 3J80E 3KYHC 4LK1C 3CCQA 2F0PA 5C4JB 1CTMA 3PUYA 3TJQA 1WCMH 1JWSD 4YWMA 3QWNA 1RJTA 1E22A 3OHXC 1PV4A 4YWLA 1STBA 1TWCB 5EKKA 2NU3I 5K36H 2OT2A 4ME5A 3L2PA 3OOCA 1HZBA 3V05A 1CSOI 2WB1E 2JA1A 3GTGH 1LTSD 1G2SA 2F3CI 4EQOA 1BMOA 5IGBA 2E2DC 5KNDA 2A2CA 4POGA 2JA7H 5C4JH 1BCPB 1IY5A 3CF5A 4ID6A 1PVOA 3RU0A 5AFWA 1JOQA 1E1OA 1HEVA 2JYYA 1O78A 1IBKQ 4A76A 2B3GA 1RTNA 2L1BA 1PH7A 1QCBD 4IFDH 5LMNL 5JPNC 2RC4A 1CA5A 4HJ5A 2B2WC 1Y8NB 3FNBA 4YCUA 4BA1I 4DV4Q 2VUMG 4CJ0B 4A3GH 3MFYA 2CCZA 1HR0W 1EYAA 4OAVB 5G3LF 2XTRA 1FR3A 1II3A 4JOIC 5EPKA 2ZTDA 3PO2G 2SGQI 1VQHA 3JAML 1KTKA 3K80C 3J81i 2WCYA 2BH2A 3NSWA 4GLAC 3FKIB 1Y14B 1QNUA 1EQTA 2R92H 1B8AA 1VQMA 2QQ0A 3HOWG 1OYVI 1EIGA 3BZCA 1U9RA 1XBTA 2Q8RE 1RKNA 4QF4A 2CW0C 5DM73 4BBRB 5M5XB 2K52A 2XMXA 1C9OA 3QR8A 2PI2A 2NU0I 3ITPA 1D5XC 4NV2A 2Q8TA 3S1RB 3G4SA 1U5KA 1PH8A 3T1YL 1N33L 2DGYA 1MD2D 3FEWX 2HQEA 4HCSA 1ZYRC 3A5UA 3P7JA 2EXDA 1XJVA 3TO9A 5C44G 3TEHB 2R7FA 5DM63 1VQGA 2ENBA 5BN5A 1H0ZA 2F3IA 1B70B 5HY6A 1XWEA 5C5MA 1G51A 1V1OA 4DWLA 4IALA 4MTNA 3AU7A 2K5WA 3HOWB 1MIUA 3T4AC 3MTSA 5FJ8H 3DWPA 2WFWA 3QOJA 1NUCA 1EQQA 4IN3A 4YCVA 1IBMQ 4DV2Q 4A3BB 3Q8DA 4ILWA 3DHQA 1ZEQX 5I6YA 3D4DA 3J7A5 3NBIA 4B3TQ 4A3LH 3MC0B 1PYWD 4DUZQ 3DO9A 1B4OA 2KCXA 4K5VA 2QDLA 2QEJC 1UNSA 3W5OA 1AZPA 1QUQB 5JJKA 3HOVB 1L0YB 3L0IA 1GUGA 2RKSA 3D31A 1NE3A 1IBLL 2A74C 3G7LA 2VQFQ 2GN5A 1Y8OB 1VS0A 4ZYSA 3CP0A 2IX1A 1Q46A 4IFDJ 3L9AX 5E4WC 1LTGD 4J6HA 2B2TA 2RF4A 4P72A 4C3HH 4A3FB 1AP0A 2Z1CA 1SNOA 3PGZA 1AE3A 3GTMH 3HP3A 3J81c 4BY7B 2GVIA 4HGUA 4B3ML 1AFPA 2EYFA 3K58A 1HA6A 5I6WA 4DNTB 2GVAA 3U58A 2R93G 1ZXTA 2KECA 2WIIB 4KY7A 3A0JA 5GROA 1FJGQ 3G6EA 1YVCA 1X3FA 5C3XA 2A69D 2JN4A 2YYZA 4ALPA 2F4VQ 2OTJA 3UDXA 3D00A 1JR0D 4CGYB 1PH1A 4GN4B 3CCEA 5TSSA 4JI4Q 4NV5A 2I5LX 3OVOA 3VYUA 2LXKA 2NBFA 3STBD 1B3AA 3VA9A 3TP5A 5M3FB 3MXUA 2V1CA 5ISRA 1D5ZC 3GTOH 1BF4A 1A8VA 4HSPA 3AJFA 3TP8A 1MJBA 3S14H 2V1CC 4X62L 2BDOA 4AQYQ 3UGDA 1N36L 1EFWA 4K2KA 2E5LL 4MTKA 2UXDQ 1B1ZA 2JQOA 3I4OA 4G7ZC 1FYCA 2ZJRA 2L55A 2SEBD 4DR4L 4LUOA 1VQDA 5LHY1 5M5YH 1DGSA 5LL6S 5GAEC 1Y8PB 2QQCA 2GKRI 5CYUA 1Q7YC 3JAMi 4DUZL 3U4ZA 3GV6A 1UUPA 3I4MH 1CHQD 1CE3A 1VQFA 3OYYA 3PIO3 5IT9E 3TS2A 4FKDA 1A63A 2OQ0A 1HNXL 4DV1Q 2ORVA 2NVTH 2A6HD 2A68D 1EIFA 1LV9A 1IW7D 3K0XA 3KDFA 4HMIA 2K75A 4OX9Q 1BKBA 4DU9A 2OZUA 5IYBH 3I4NH 3I4MG 2OEOA 5DNFA 4HSVA 4PNYA 4AMLA 3R2IA 4GXTA 1STGA 5GADC 3J80c 2KCNA 3HKSA 4LF9Q 3T56B 5IGFA 4OL7A 1I4QA 2HT1A 2P6AC 3TQYA 5H1SE 3NWTA 2M9VA 5EBDA 1CK1A 2F0HA 5GQOA 3J80L 4DV1L 1Z7KB 1P8LA 1ONLA 4UY8C 3VR5A 3G6JB 1JQOA 2R6GA 4HTHA 5KYLA 1B3QA 1DCZA 4AS3A 3PSIA 3RLFA 1Y1WH 3F4MA 1OXSC 2CFMA 2F3VA 5JVH3 1S72A 1GHJA 4AYBG 3CC4A 4ZKBB 1Q8IA 4R4CA 5E4XA 3BDCA 3FMCA 1Z6HA 4XIGS 1RD9D 4OAUC 3GQBA 4ODGA 4DUYL 1SGEI 1VQ4A 3KLSA 2ID0A 3KK7A 4QQBX 2IL8A 4DR7L 4AS2A 3S16H 3PO3H 2NN6I 5COYA 2K01A 1Q86C 1OTCA 1MHWC 1XNRQ 1F2ZA 2FU2A 2KEDA 2CWAA 3HG9A 2JP1A 4H44C 3CD6A 2UVOA 1YO7A 2R93H 1DXMA 4MIUA 2N55A 1XTCD 4XT3B 5C3EH 1VDDA 2F0GA 3S1RH 1EZ8A 4BBSB 2JA9A 3E9HA 1B50A 3NUCA 3GTKH 5JJLA 1HRJA 3H0GG 2F6MB 2BDNA 3NENA 3FSYA 3DWQA 1QVGA 2D9UA 1LO5D 3I4LA 2EJFC 2QZGA 4NMZA 4X64Q 4LF8L 1GO3E 4EX5A 3UFFA 1AZQA 2CAZB 1HQMC 1YTPA 9WGAA 2OF1A 1EY0A 4X64L 3S15B 4EQPA 5M3MG 4DV3Q 3S15H 1N34Q 2PO4A 4DKAC 1KLUD 4F88A 5JPMC 3ULJA 2A1AA 3S17H 1O80A 1PMRA 1SXTA 1HDLA 3NE5B 1P16A 2DJFC 2Z8LA 3KUPA 4B3SL 1YNJC 4A3LG 1AH9A 2N49A 1P9ZA 2R7ZG 3U50C 2UUAQ 4QJFA 2A20A 2DJGC 5C3EB 2VB2X 1I4PA 1KNAA 3FSXA 4DK0A 1X3PA 3KBXA 2I5HA 3LNNA 4X65Q 4LF5Q 2UZ3A 1WTQA 4B6DA 2F0DA 1ASYA 3K0YA 3HOVH 1D2BA 4LAAA 4X3UA 1R9TH 4LF4Q 1NXUA 1FNWA 1A62A 1UE1A 4JBKA 1S5ED 1G8ZD 2B8FA 2VB3X 4A3KG 1TT2A 4XXEA 4A3FH 3JAME 5IGDA 1X3GA 1ENFA 4J1MA 3I73A 4B08A 4LF7L 3S1NB 5HGQA 1SYEA 5FO7B 2LXJA 1EL0A 1SYGA 3OWFA 3HOXB 2PW7A 3HOZG 3WDNA 4LFCL 2JXMB 3CHBD 3R93A 4KKSA 1AEXA 2R3ZA 5FLXc 1B44D 3J7ZC 4QGUA 2CJSC 5CR3A 2UUCQ 3HOWH 3I4MB 4DR6L 3R5AA 1FAQA 5FLXL 4RHSA 2AUJD 2EYOA 1V8QA 4A93H 2K5NA 2Y0SB 4ZQ3A 3FDTA 1CQVA 1TS2A 5BN3A 1VQIA 1R79A 1LUZA 1Y69U 3LWEA 1VQAA 1X4SA 3OMGA 2F0MA 3OXLA 2ICIA 3W1BA 4DNIA 3CCRA 3VR2A 5EKIA 2VUMH 3VR6A 1VMPA 4GI3C 1O7ZA 1S4ZA 3A54A 2QSBA 3M4PA 4LUVA 1PH6A 1F2YA 5A35A 3VDYA 3SDJA 4PV1C 4V190 3UGIA 2JA7G 3MAQA 1N36Q 3SEKC 4JI3L 4RKLA 4NP5A 3HOYB 1JJ2A 1GUWA 1ET9A 3K59A 4QUFA 1PTRA 1Z2IA 2FFKB 3EFXD 5IGGA 4PL4A 4A3CH 3E5SA 1E7ZA 3ZYYX 2CVRA 1HCZA 1TWAH 3I7FA 1SR3A 4DV6Q 1PA6A 4A3EB 2L5TA 2KMOA 3OXFA 1YEZA 4YY3Q 1HNWL 2SGEI 4RCOA 3AB9A 1H95A 4X3SA 3H0GB 1K83B 4KD4A 3K5NA 2YQPA 3J7YW 4F8MA 1RF2D 3I72A 2EY6A 5HI7A 4PG3A 2AQ2B 4KJOA 5FUXA 2P22B 1K73C 2JA6H 1A2TA 1CKNA 2XN9C 1EY4A 5JEAH 1OMUA 2QPOA 4B3MQ 2E2JH 5A2QE 3X3NA 2XRSD 1KDCA 4FXGC 1TGSI 3TZDA 1IBKL 2Z4IA 4CJ2C 4DR3Q 2A8VA 4NW2A 4FXDA 3EJIA 1LABA 3SK6A 1LR7A 3W2DA 2D0PA 3UDGA 1I3QB 5J8CA 4DK6C 3IL8A 3ER0A 1FVIA 1TIHA 1M8AA 3B4VC 3T13A 2Q2UA 2XRCA 2EJMA 5M9OA 1ULKA 1PYBA 4RGOS 1MGSA 4JI2L 4IUTA 1S5DD 1XX8A 1I5FA 3BU2A 1WGTA 3H09A 5M3FG 5BR8L 3QJYA 5IP9H 5FUYA 1B53A 2JZMA 3D4RA 3EQLC 1MKHA 5C0XI 1SNPA 2RHSB 1A3TA 4ZAIA 4PZ7A 4KN4C 3FHWA 3S2DH 1SYBA 1HR0L 2J4XA 4JI3Q 3DA3A 4TSSA 4X62Q 3DMUA 1GD7A 4IJLA 1MI2A 4A3KH 2F0TA 1IL8A 2OQKA 3GP7A 1SDFA 4C56C 2KA7A 4KK7A 1L0XB 1SE3A 2TMPA 5HURA 3CCLA 4HMJA 4K6DA 3S1QB 3E6ZX 2ALYB 3FVQA 2EQSA 3HOVG 2UU9L 2F66B 3SGBI 1IKLA 1E0BA 4X66Q 1H9RA 3GTPH 1MJAA 3CCSA 2F4VL 5J1ZA 3VR3A 3H3VI 3BZDB 4JYAL 1PTOC 3SK5A 3K6OA 1JORA 3KJPA 1SMXA 2H5XA 2DUDA 7WGAA 1PZKD 2AWNA 2KKMA 4AYBE 3U9SA 1YNJD 3QIAA 1PTOB 2L15A 3RN2A 1CT4I 4CKCA 4GS3A 5LMNW 1E3PA 4OWWB 1OO9B 1IHZA 2EY1A 5IT9L 1L2FA 2K5HA 3NK9A 1IY6A 2K28A 3E9IA 1TBQR 1EYGA 3JSBA 2BL8A 1TU2B 5CGKA 1OXTA 2SNSA 1TURA 2GKTI 4YY3L 3A7LA 1VQOA 2NU2I 1ICWA 4H0LC 1X6OA 1X3QA 4RGNA 2HIVA 2Z6KC 1I4XA 2OVOA 2IX0A 3J81L 5T1GA 2A19A 2IY5B 1SLJA 1STAA 3QOLA 4Z9CB 3GTPB 4N9TA 5J22A 4C3JB 3K57A 1E2WA 3TP7A 2AQ3B 3KDFB 4IQZA 5FK9C 3UDFA 2VRWB 1PLFA 1QB5D 4H02A 1TQOA 3D0FA 1DS3I 3J7AV 4JI5L 4KHZA 1GM5A 1IBML 2HDMA 4UP7A 1LLRD 4PZ6A 1XTDA 4KKTA 1KRSA 4DV7Q 3VDUA 4B3SQ 3RN5A 1EU3A 4XQQA 1B9MA 2ORWA 4S3SA 3H6MA 1IKMA 2WINB 1Q3LA 3IKJA 5E3QA 2O5JC 4A3BG 1TBRR 1YU6C 2NVTB 2VQFL 3CCJA 2EPBA 4O1PA 2LKVA 3SXHA 1SFOB 3TOAA 3HH2C 2LY7A 3ND8A 3NTHA 1PTQA 3RMHA 3RR5A 3GTQH 2IJ0A 3CXCA 4XTCS 1I4HA 1BBWA 3VR4A 2W0TA 2YV5A 3HZXA 2N1AB 1UWVA 4RFBA 4IPDA 2PZUA 5M5YB 4TVAB 1EY5A 1BDOA 2PI2E 1PH3A 3H3VH 2PQAA 4NXML 3Q0AA 1KIXA 5IYBG 1BOSA 1D1IA 1HZ9A 1SROA 1QZGA 4RWSC 1IYUA 4A3DG 2X52A 1K9MC 4HN7A 4ABNA 2PPBC 4A3DH 2A5HA 4BBRH 4LUZA 3EN2A 3VYSA 4A3EH 3TRZA 4GZYC 4CKEA 4P74A 3S17B 2YU9B 4KMUC 3CPWA 2FUG1 1F9RA 1PH5A 3S2HB 5C0XH 3Q6SA 2K9HA 3FKIH 1F2LA 5JAVA 3GTLB 2K7VA 4G4KA 2A73B 1YHBA 3SR1A 1STEA 2QW7A 4BA2I 1GVPA 2NWGA 2VZAA 5IGCA 4KY6A 1AN8A 1D6EC 1IYVA 2X3TA 3CRKC 4DK3C 1G6ZA 1GUNA 1UUCA 3DXJC 2NVYH 4IUVA 5IOCA 2QA4A 2VL6A 4M8AA 2ETDA 2NTSA 2HGKA 4A3DB 1STNA 2XVSA 4NB3A 3AFPA 1PTOD 3W3AA 4UXHA 2CHBD 1FARA 4IO9A 4DR2Q 3M4OH 3LWUA 1EY7A 3E0EA 4JBWA 3HS0C 2G5DA 2DY7A 1BUVT 4CJ1B 2KMPA 2OTLA 2RDFA 1CI3M 1VQNA 3CW2C 2ES2A 4LF8Q 1KRTA 1H9SB 4GLXA 4UXIA 4DGZA 2BA1A 2J7ZA 3CAMA 1SE8A 3F2BA 2ZJQA 2ASBA 2IW3A 3PUXA 4QUCA 4RHRA 2RIJA 1CFMA 4I7ZC 2B2TC 2QILA 4JI7L 2XIWA 3D6CA 5JJIA 1QUQA 2PMZB 3T16A 2X69A 4LFBQ 4R9WA 3SDZA 4I1TA 4KTAA 3BJUA 4A3IG 2IWHA 1EWIA 4C3HG 4EQ5A 2ZRRA 3LJ1A 4AIMA 5C5LA 4JI8L 3CPFA 3BYYB 1PTOF 3DWAA 3A7AB 3LGJA 1K0SA 2E2IB 1SNCA 5D14A 2LEOA 1WTPA 1SGPI 1H9MA 2WVJA 2B63G 5IY0A 3S9WA 2FEFA 3DA4A 2RCFA 3KF8B 2L12A 5J39A 4LF9L 3PV0A 3N52A 4B3RQ 4GKJQ 4HFVA 3R5CA 1NTGA 3DEOA 1XMQL 1FGBD 3TSSA 1OVOA 1CKMA 2L1LB 1G291 1Q82C 1M90C 3I3CA 2JBWA 1O7LA 3S14B 4WRDA 1K7VA 1SEBD 1X32A 2D0OA 3M4QA 1PFNA 2LMCB 3EA6A 1HNXQ 2ZTEA 4L5TA 1XNQQ 1VQ5A 3HOZB 4A3MH 4FDBA 4QY7A 1HA5A 1UVGA 1FYBA 2YFBA 5CCLA 4I7AA 1NSNS 1KAWA 4JBMA 3GV3A 1Y1CA 2F3WA 4GOPC 4R4IA 5IODA 5IP7H 2RADA 4OONA 1YJ9A 5I9OA 5ELFA 2M00A 4RMFA 3J7AF 2R93B 1CA6A 5J3BA 1LR8A 2F0IA 4BY1G 3V96A 2E5LQ 4G7OC 1IZ6A 4CDEC 1YHAA 1LTBD 4A3JB 4R4TA 2NU4I 2KUMA 1VQPA 1XMQQ 4U673 2HUGA 4CBVA 4RH6A 5E7NA 1ZYRD 4V0BA 1TWFH 3AFQA 4ZUJA 4E6IA 4HIKA 2BE5C 5M3FH 1EWHA 2RA4A 2ATWA 4IPGA 2QQEA 2L11A 4HJ7A 1ESFA 1TWGH 1SNQA 2F4IA 2JW6A 4LF4L 4HIOA 3URYA 2EY2A 2BL7A 3D4WA 3KP9A 1CZWA 3PUVA 4AYBB 4LFAL 3PQIA 1GUSA 2CWFA 1DONA 2YTVA 2MGSA 2N3SA 4HCEA 4F7XA 2EYLA 3F2DA 4A93B 1VQJA 2BOSA 4R1JA 5F2DA 1YI2A 4IUNA 2MP1A 2WKDA 2KCTA 2K05A 4DXGA 2EOTA 1SFOH 3I55A 1X54A 3QB3A 4XDXA 5JJZA 3D3RA 5D65A 4HJAA 1VQLA 1RFHA 1UHAA 2D5DA 4HR7B 4NXMQ 3F2UA 1TY0A 4DR2L 2NN6G 4G57A 5EKLA 3UE1A 3AEVA 1H9KA 4IFDG 3VYTA 4OWXB 5ELNA 4DAYA 4OO1H 2MPMA 3H94A 3S1NH 4DF7A 1W3SA 1NMFA 1EFID 3A74A 4K5WA 2LSSA 4N9PA 2I5MX 1ILPA 2DNEA 3UITA 2F0WA 1TWHH 2QGQA 1EUJA 4NDXA 4DNCA 1LTTD 2EYPA 1HZAA 5GAHC 2C5CA 5K36G 3Q23A 4LF7Q 1S5FD 4GLVB 1TUSA 4WORA 4JVZA 2EIFA 2MFIA 3RZDH 3TO7A 3E0JA 1TS5A 2BCOA 4OXPA 1GUOA 1L1OA 3NBHA 1UAPA 2NN6H 2CW0D 1I4GA 4QL5A 4BS9A 3NTKA 2C9OA 3HKZE 2EVBA 3MEKA 1L1OC 3AMUA 3CC2A 3KFUA 3E2IA 3OTOQ 2L4NA 4KLKA 1BUSA 2RSOA 1WVLA 2XRQD 4DV2L 4IOCA 1ZKOA 1IW7C 4Y7NH 4A93G 4JI5Q 1JMCA 2F0VA 2DY8A 2OCEA 1JWMD 1TS4A 1CUKA 2UXCQ 1PHJA 1SGQI 5G3LD 1SN8A 4GKKQ 3MEHA 3NTIA 5HGTA 3GTQB 1KQSA 3RLOA 3HOZH 4XYQA 1LR9A 1EOVA 1SRUA 1YITA 1DJRD 4WJ3M 2KCMA 5I2YA 2D62A 4JI1L 2Q2IA 3A55A 2JSOA 3MFGA 1N13A 3K5LA 5IE8A 2SGPI 1KC8C 1JB3A 5FO8B 1UEAB 1HFNA 2WAQE 2CWGA 1QWYA 2A6ED 4YHHL 2NTTA 4JI0L 2XSCA 1D5MC 1NAPA 4WP4A 3H91A 4A24A 1UE7A 4ZKCB 2QF7A 3CQZB 3NHHA 2F03A 3OW7A 2G9DA 4DV5L 3J80i 5EPJA 3A8KE 5KNCA 2BUSA 1KABA 1A0IA 1XNRL 1A3UA 1HUMA 1PZJD 2RCNA 4XYOA 1TOTA 1CGII 1YBYA 3G48A 1SNMA 3VA5A 2R7ZH 4X66L 1SAPA 4HJ9A 3MA2B 4IZ8A 4J15A 1I50H 1D8LA 2JK8A 3R3OA 1ASZA 3LJ2A 5LMUQ 3EVQA 1JQYD 2UXBL 5ELCA 2KVMA 3CKIB 4OWTB 2Y0MA 1DD2A 2EJGC 4P2CB 3DM3A 4YZCA 1OMTA 1N32L 3W1GA 4AQYL 5C44B 2JEAI 1FL0A 1JB7A 3M85A 4C2MH 1BBUA 3H0GH 1YNNC 1XXGA 1B2TA 5DAUA 1DZ1A 3M4YA 1HH2P 2QGMA 3IFDA 3HGBA 4DN4M 2A68C 4G7HC 3TZUA 2X6LA 2ZXOA 1MJCA 3M9BA 4BBSH 1YNND 1NJIC 4BY7G 1O7YA 3O13A 4DAVA 2RQXA 3J81E 1RTOA 5D3IB 2HCCA 4PMCA 1HUNA 4X3KA 2QCPX 2UUBQ 3PO3G 5CMDA 3IAM1 4O42A 2JJQA 2JEBI 3NELA 1SGRI 2OD1A 4POFA 4L5SA 2JA8G 3HOUB 1QG7A 1N32Q 2XGTA 3IFTA 1CHPD 1TWHB 2K5QA 2MO1A 1SMYD 1V1QA 1Y1WG 4IOAA 3STBC 1Y1VG 4PMWA 2FINB 2FMCA 3A56A 1SJHD 1HZCA 2PMZE 3BJIA 3K7AH 1IBLQ 1TY2A 4O1OA 2L9HA 2M2LA 3S1MH 5E3FA 3HKZG 1NMGA 2MQHA 5LMUL 4Y52H 5C0XG 2KHSA 1TBNA 4BY1B 3SGQI 2WV6D 2F0LA 5C0XJ 1QE6A 1ENAA 1RDPD 4L6TB 4A3EG 1IL2A 3OPOA 1QOHA 3RLNA 2R7ZB 2JA5H 4OGQC 4QMGA 1FJGL 4DR3L 2O4XA 3JC66 1NUBA 1CSQA 4C3JH 1YHQA 3QAHA 2F0NA 2UUCL 4OELB 2QKIC 3OMCA 4K8IA 2JB3A 2HD3A 1I3QH 4PQXA 4LFCQ 1U4RA 1VQCA 4QIWB 2IT1A 1C4QA 5EX3A 4A4IA 2K6AA 1T5XD 1ET6A 4LF6Q 2JE6I 3NPPA 4WFN3 1VCIA 1P9GA 2EY5A 4L8JA 2PYKA 1VDZA 1J6QA 3GO5A 1PZID 4A3BH 3R5DA 2FMMA 4CDCC 4WJWA 1VF5C 4HAEA 4LW1A 4LF6L 1U4PA 2N17A 4DPGA 4F87A 2ELIA 1V1PA 5IWAQ 2VQEL 1UVFA 1M4VA 3KF8A 1PH4A 1FY7A 3CCVA 2L7XA 2UXCL 2P5ZX 3QO2A 2VUMB 2ZXPA 2CKZB 2V6EA 4HEA1 4PL3A 4C2MB 1SJ8A 1PXUA 3KBGA 4N8X1 5DAEA 4RGMA 2PZTA 3GTJH 4BXXG 1DOMA 3OTOL 4NKLA 2WKCA 4DK1A 2RVLA 2K50A 3RZOH 1W2BA 4FNFA 3TMEA 1JT8A 2E73A 4O2DA 3WOEA 3KF6B 1GUTA 2OXPA 1SYFA 1JICA 3VDPA 1B9NA 1OXXK 2B2UC 1CQFA 3OW2A 1Q81C 1Q90A 3P20A 2K04A 2NZHA 5ELEA 3I2ZA 2YTXA 3MZ5A 3B6YA 2YTYA 4WJ4A 3NBHB 1WI5A 3PCOB 3IAYA 4DAMA 2SGFI 1LTRD 4DNRB 1N34L 1PRTB 5CV7A 2XWJB 1KL9A 2K33A 1HQRD 4CDFC 2KBNA 4B9WA 4FF3A 1D7QA 3S2DB 1G2TA 1EY6A 4KKUA 2F0UA 4XT1B 5FKAC 2Z9HA 2Z6BA 2BH8A 4R8IA 2WACA 2RHQB 3C3LA 2K03A 4KHVA 2B8TA 2TSSA 3I9V1 5IGEA 1EIHA 2ARPF 5CV5A 3U9OA 3C1FA 4X65L 4GNXB 4LF5L 1KMAA 1TR5A 5BR8Q 3Q24A 3R5BA 1NY4A 3DUZA 4FF1A 1EY8A 3LJ0A 1MJEA 3EIVA 4DAPA 1Y1BA 1U4LA 4FO2A 1J9OA 1E24A 2KHIA 3NP8A 4UP9A 1K8AC 2K32A 4RA8A 3CMEA 3S1MB 4DUYQ 1FGUA 5IP9G 3K81C 2JYOA 2Z6KA 2N78A 1PFSA 1CT0I 1SGNI 3K7AB 5E3RA 3N6RA 1EIYB 2HIXA 1GKHA 1F9PA 1TWGB 4JC0A 4K14A 2ZT9C 3GTOB 2QEXA 2FHTA 2KJXA 3R2TA 4JI4L 4A3MB 2NVQH 1FNUA 4JI6L 4C3JG 3GTKB 4NXNL 3P75A 1DYQA 4RG1A 4JCVE 4P75A 2B63B 1BVSA 2CWPA 1WTHA 1K28A 4RAUC 3E59A 1MBYA 4JBJA 1DOLA 1S5BD 1BR9A 2B2WA 2RIOA 1RIPA 1KNEA 4JW0A 3FVVA 5EQ0A 1M8CA 3PDNA 4XQJA 2IHFA 1KD1C 5JEAG 4JI6Q 5L37A 2ZM6Q 4IFDI 4K6LA 1PRTC 2IPKD 1H9JA 1RODA 1F9QA 3L3OC 5JEAJ 2RDHA 4KHPL 4FF2A 4K5XA 1BNZA 4G76A 3D8GA 1BQQT 1LT4D 3MXPA 5DLQE 4C3HB 2Y0SE 4LFAQ 4YZ9A 3PUWA 1WD0A 4QIWE 2GA4B 4UPAA 3HOYG 1A6XA 4GN3B 2XTQA 4A3CG 5E1FA 4JI2Q 1WTWA 1L0WA 3PO3B 1U4MA 1MT1A 5A2QL 4JG2A 2DB6A 1ENCA 3TOBA 1CSPA 3HOUG 2J9RA 1S20A 2KMRA 2GSCA 4EQNA 2K1BA 5IT9c 2L8EA 1ICFB 1WCMG 3L7ZC 1VQ9A 2E2HB 2NUCA 1EYDA 1YZ6A 1Y1WB 2B0UC 5BN4A 1F2MA 4L63B 1VQBA 1ULNA 1SE2A 3FRPB 3TDQA 4JI7Q 3ONAB 1FD7D 3A5ZB 1LTID 2E76C 4L9MA
chains in the Genus database with same CATH topology
2CJSC 1UE6A 1WYDA 1V9PA 2I5MX 2UUCQ 3HOWH 3UITA 4DR6L 1TWHH 2QGQA 3TREA 2ODDA 1FAQA 5EAYA 1EUJA 4HIDA 4A93H 2K5NA 1HZAA 3K7UC 4OO1I 5GAHC 1S3OA 1HNZQ 5K36G 4LF7Q 4GLVB 1XNQL 1VQIA 1R79A 2E5RA 1LUZA 1YIJA 1X9NA 4YZDA 2C35B 1I94L 1VQAA 4B3RL 4MZ9A 2EIFA 4GKJL 1TUSA 1X4SA 1N9WA 3W1BA 4JV5L 2MFIA 4DNIA 5IYCG 3OXLA 4DR5L 2JB1A 1QVFA 1VQKA 3S2HH 3RZDH 4DR4Q 3IRBA 3CCRA 2I0QA 2AMCB 2MJFB 1HNWQ 4OXPA 2UU9Q 1XPUA 1JE5A 2VUMH 4X6AH 5AJ3Q 1SGYI 2VW9A 1X3EA 2MO0A 1E1TA 3H15A 4DR6Q 1L1OA 4DV6L 4GI3C 1KBFA 4JI8Q 3M4PA 4LUVA 1PH6A 5M5XH 3VDYA 1Q8KA 1IYJB 1U0LA 3EBEA 4QL5A 4A3FG 4G75A 2UXBQ 2N71A 2SGPI 1AN1I 4JV5Q 5FUWA 3HKZE 3SDJA 5IYCH 1L1OC 3MEKA 3UGIA 2JA7G 3CC2A 1N36Q 3SEKC 2PQAB 2AKWB 2JB2A 1Q1BA 4JI3L 3KFUA 3E2IA 4KHPQ 3OTOQ 3GDEA 1JJ2A 4KLKA 2IP6A 4C3IH 1BUSA 4GOPB 4DV2L 4IOCA 4Y7NH 2HHHL 2Y0SG 2UUAL 1YJWA 1PYSB 2ZTCA 1JMCA 4JI5Q 4A93G 1PTRA 1R0RI 1KHIA 4PL4A 4A3CH 2OCEA 2KMQA 1E7ZA 2UUBL 1Y8FA 1CUKA 2K14A 4AH6A 3PF5A 1QZHA 1JJCB 4K0KL 2UXCQ 1TWAH 1PHJA 1SGQI 3IAS1 1SN8A 3I7FA 3HFZB 4IPHA 4GKKQ 1NBWA 2VNUD 1SR3A 4O0AA 4DV6Q 4JI0Q 1PA6A 1V43A 3ZJYC 4LWCA 5CCMA 3FBVA 2KMOA 3OXFA 1KQSA 1YEZA 3RLOA 4YY3Q 4TQUS 3HOZH 3WWVA 2BA0A 4IPCA 1HNWL 1XX6A 2ENZA 2N52A 2SGEI 3UEYA 1LR9A 2E2IH 2JA6G 1EOVA 1SRUA 1K0RA 3FP9A 1YITA 4WJ3M 1H95A 1TBOA 5LNK1 4R4QA 4L5RC 2KCMA 3KJOA 2YQPA 2D62A 4JI1L 3KYHC 2Q2IA 3CCQA 2OWOA 5HI7A 4PG3A 1W4RA 1AE2A 1N13A 5FUXA 3PUYA 3TJQA 2P22B 5IE8A 1WCMH 1K73C 2JA6H 1CKNA 4YWMA 4YHHQ 1KC8C 1CKNB 3BZKA 1OMUA 3F8TA 1S40A 4B3MQ 2E2JH 2QPOA 1E22A 5M3MH 2WAQE 1PV4A 1TGSI 4YWLA 4YHHL 4JI0L 1C7YA 1IBKL 3MXNB 1J5EL 3M3YH 4DR3Q 2A8VA 4YWKA 2NU3I 4E1PA 1YNXA 1LR7A 3L2PA 1HZBA 2D0PA 3UDGA 4GNXA 4A24A 1UE7A 2WB1E 3KLWA 4DK6C 1CSOI 1TWCH 3ER0A 2JA1A 5FLMG 1FVIA 3GTGH 4DV5L 3K8AA 1TIHA 5HQ8A 1RL2A 3J80i 2BUSA 3B4VC 2F3CI 2Q2UA 1BMOA 2XRCA 2Z0SA 3F2CA 1PYBA 4DV5Q 1A0IA 3T1HQ 1XNRL 2A2CA 1VQ8A 2RCNA 3KF6A 3KOJA 2KENA 5C3EG 5C4JH 3RNUA 4POGA 2JA7H 3J81j 4JI2L 1YBYA 3G48A 3CF5A 1CGII 1I5FA 3BU2A 5IWAL 1PVOA 3RU0A 5M3FG 1E1OA 1XPOA 5BR8L 2R7ZH 1T9HA 4DV7L 5IP9H 4X66L 1O7IA 1V1HA 1IBKQ 2JYYA 2JZMA 5FUYA 4A76A 1MKHA 1LTLA 2B3GA 5C0XI 2RHSB 4HJ9A 2NVXH 1PH7A 4PZ7A 5LMNL 3FHWA 3S2DH 4J15A 1I50H 4YCUA 1D8LA 2JK8A 4BA1I 4DV4Q 3DA3A 4HJ5A 1HR0L 4JI3Q 2VUMG 4X62Q 1ASZA 4A3GH 2CCZA 1HR0W 4OAVB 3LJ2A 5LMUQ 1GD7A 4IJLA 4A3KH 2XTRA 2UXBL 4GN5A 4UXJA 4JOIC 2ZTDA 3PO2G 2SGQI 2OQKA 1VQHA 4OWTB 3HOUH 2V53A 3DM3A 4YZCA 3K80C 1OMTA 3J81i 1Q1EA 3CCLA 3W1GA 1N32L 2WCYA 1PJUA 3AYHB 4AQYL 2BH2A 4DV4L 2JEAI 1FL0A 3GTLH 2ALYB 1JB7A 2ERWA 2EQSA 4GLAC 4UP8A 3HOVG 1Y14B 3M85A 2UU9L 2F66B 1BBUA 4C2MH 3SGBI 1XMOL 4X66Q 3HOYH 2R92H 3GTPH 1K83H 3CCSA 1B8AA 1IXRA 2NZOA 3H0GH 1VQMA 2F4VL 3H3VI 3HOWG 4JYAL 2QQ0A 1OYVI 3T1YQ 3BZCA 4U6RA 3KJPA 1SMXA 2H5XA 1N33Q 2DUDA 3DLLA 1XBTA 2AWNA 2KKMA 1HH2P 4AYBE 2JXDA 2K52A 2XMXA 1C9OA 2L15A 2PI2A 3RN2A 1CT4I 2NU0I 3ULPA 1MJCA 3M9BA 4NV2A 4DR5Q 4GS3A 1NJIC 4BBSH 4BY7G 3G4SA 1LYLA 5LMNW 1E3PA 1U5KA 4A3JH 4OWWB 4OO1G 3SGIA 1UEBA 1L2FA 2K5HA 1PH8A 1IY6A 3T1YL 4R4OA 2DGYA 4GOPA 2UUBQ 1N33L 1JJGA 3PO3G 1CGJI 3S1QH 3IAM1 3E9IA 1TBQR 1EYGA 3JSBA 3A5UA 2JJQA 3I4NG 2JEBI 3NELA 2EXDA 1XJVA 1SGRI 2OD1A 4POFA 4L5SA 2JA8G 1OXTA 5C44G 3TEHB 2XGTA 2R7FA 2YFAA 1N32Q 1VQGA 1TOTA 1TURA 2GKTI 1H0ZA 2YU9H 2F3IA 4PL5A 1B70B 4YY3L 5HY6A 1VQOA 2NU2I 1WFQA 1G51A 1X6OA 4DWLA 2MO1A 4MTNA 1V1QA 3PUZA 2ZJPA 4HIMA 5C4XH 2E8GA 2HIVA 1MIUA 1Y1WG 2VY3A 2Z6KC 4IOAA 2UXDL 3STBC 1Y1VG 5FJ8H 2OVOA 2B29A 2IX0A 4PMWA 1QVCA 1TXYA 2A19A 2WB1G 4YCWA 1CKOA 1SLJA 2WFWA 2IY5B 2VQEQ 1EQQA 1HZCA 2PMZE 1KBEA 3BJIA 1X65A 3K7AH 4YCVA 4DV2Q 1IBMQ 3NEMA 3KDFB 3Q8DA 1IBLQ 4O1OA 3UDFA 3S1MH 3AQQA 2VRWB 5FUVA 4H02A 3HKZG 3D0FA 1DS3I 3J7A5 1NMGA 3MEFA 2MQHA 4B3TQ 2AHOB 4A3LH 5LMUL 4Y52H 3P23A 5C0XG 4JI5L 4KHZA 1GM5A 2VS1A 4DUZQ 4PZ8A 1TBNA 1IBML 3DO9A 2KCXA 4SGBI 3SGQI 4UP7A 1K8GA 4PZ6A 5C0XJ 4BY1H 1XTDA 2ROWA 2HQLA 1KRSA 3W5OA 4DV7Q 2DIPA 1QUQB 5JJKA 4A3EG 1IL2A 3VDUA 2LUYA 4B3SQ 3RLNA 3RN5A 3HOXH 2JA5H 3L0IA 3D31A 2FNFX 2ORWA 2NU1I 1NE3A 1IBLL 1FJGL 4DR3L 5IP7G 4KI0A 4HJ8A 4LFBL 2VQFQ 2GN5A 5ELOA 3ULLA 5IYDH 3JC66 1VS0A 3G71A 1CSQA 3CP0A 2Q2TA 2IX1A 4A3BG 1NUBA 4C3JH 1Q46A 2VQFL 1YHQA 3CCJA 4IFDJ 2UUCL 4P72A 2RF4A 4O1PA 4C3HH 4A3MG 3QTLD 2JB3A 3PGZA 1AE3A 1I3QH 4LFCQ 3J81c 3GTMH 2GVIA 4DR7Q 4HGUA 3HH2C 4B3ML 1VQCA 1PTQA 3RR5A 2IT1A 3GTQH 4E1RA 3CXCA 4A4IA 4XTCS 5EX3A 1BBWA 4LF6Q 2W0TA 2GVAA 2YV5A 2JE6I 1UWVA 4P71A 3U58A 2R93G 2N1AB 4IPDA 2WP8J 4TVAB 3A0JA 1VCIA 5GROA 1FJGQ 1CT2I 1VQ6A 1WOCA 2PI2E 3G6EA 1PH3A 3H3VH 1J6QA 1X3FA 1YVCA 2PQAA 3GO5A 3UE0A 4NXML 2YYZA 4ALPA 1KIXA 5IYBG 2F4VQ 3UDXA 2OTJA 4A3BH 3D00A 2B63H 1PH1A 4LW1A 4LF6L 1HZ9A 4GN4B 1SROA 3CCEA 1QZGA 1KXLA 3UGLA 4JI4Q 4NV5A 4A3DG 2N17A 4DPGA 2I5LX 3OVOA 1HR0Q 2ELIA 2LXKA 1K9MC 3STBD 3VA9A 1Q12A 5IWAQ 2VQEL 4A3DH 1UVFA 3TS0A 1EQRA 1X56A 3EN2A 4LUZA 4BBRH 1PH4A 1PH9A 4JI1Q 4A3EH 3TRZA 2V1CA 3CCVA 3GTOH 2L7XA 1A8VA 3AJFA 4P74A 2UXCL 3OXGA 1XMOQ 3S14H 3CPWA 2FUG1 1HNZL 3ICEA 2CKZB 2V1CC 4X62L 4A3IH 2V6EA 4P73A 4HEA1 1PH5A 5C4XG 4PL3A 1SJ8A 4AQYQ 3UGDA 2K9HA 3FKIH 1N36L 1EFWA 5DAEA 3GTJH 2E5LL 4BXXG 2UXDQ 3OTOL 1YHBA 2JQOA 4NPSA 2K50A 3I4OA 3RZOH 4BA2I 2ZJRA 1GVPA 2VZAA 4DR4L 4GKKL 4OVOA 4LUOA 1VQDA 1W2BA 3PF4A 1JT8A 1L1OB 4O2DA 5M5YH 2E73A 1DGSA 3KF6B 5GAEC 4BXXH 2J87A 4DK3C 2QQCA 2GKRI 1UUCA 1UE5A 1Q7YC 2NVYH 3JAMi 1PH2A 1M8BA 2QA4A 4DUZL 4MNOA 2VL6A 2XTIA 3U4ZA 2SGDI 4NXNQ 3I4MH 1CE3A 1VQFA 3OYYA 3AFPA 4NB3A 5FJ8G 4DV0L 3TS2A 5IYDG 4FKDA 3VDPA 1A63A 2ZM6L 2OQ0A 1HNXL 4DV1Q 1FARA 2ORVA 4UXHA 4IO9A 1OXXK 2NVTH 4DR2Q 3M4OH 4JBWA 3E0EA 1VQ7A 2MNAA 1OXUA 3OW2A 1EIFA 3HOXG 3KDFA 3T1HL 3K0XA 1Q81C 2KMPA 2K75A 5C44H 2OTLA 1VQNA 2NZHA 3S24A 3CW2C 2AWOA 3I2ZA 2IHEA 1KRTA 2YTXA 2ES2A 1BKBA 3B6YA 4LF8Q 4OX9Q 3CXLA 2YTYA 4Z7HA 5IYBH 4A75A 4GLXA 3I4NH 3I4MG 3NBHB 4WJ4A 4UXIA 1WI5A 3PCOB 3GOXA 4DAMA 2BA1A 2SGFI 4GXTA 3CAMA 5GADC 1SE8A 4ME3A 1N34L 1KL9A 3J80c 3HKSA 3F2BA 2ZJQA 4LF9Q 2ASBA 2KBNA 2HT1A 3PUXA 1J5EQ 2Q2HA 1D7QA 2P6AC 3TQYA 5H1SE 2M5XA 2N8NA 4JI7L 5GQOA 2GKVA 4DV1L 5JJIA 3PIOA 1QUQA 1Z7KB 1P8LA 4UY8C 4IJHA 4LFBQ 3FKIG 3UEJA 4I1TA 3OL0A 3BJUA 2R6GA 4A3IG 1EWIA 2BH8A 2JAEA 4EQ5A 2ZRRA 2R92G 4AS3A 3LJ1A 2RHQB 4AIMA 3PSIA 3RLFA 4JI8L 2B8TA 3CPFA 3QWPA 3I9V1 1Y1WH 3F4MA 1OXSC 2CFMA 3UDIA 1HJPA 1WJJA 3LGJA 4AYBG 2K4KA 4BBRG 2E2HH 4LNQA 3L0OA 3CC4A 2ARPF 4X65L 4LF5L 4GNXB 2GVBA 3CQZH 1K3RA 4R4CA 2LEOA 4XIGS 5BR8Q 3KY9A 1KMAA 4OAUC 1NY4A 4L5QA 4DUYL 2JA5G 3PIPA 1VQ4A 1SGEI 1SGPI 3FC3A 3LJ0A 2ID0A 1MJEA 2WVJA 3PO2H 3EIVA 2B63G 5IY0A 4QQBX 2KHJA 1IW4A 1OXVA 4DR7L 4AS2A 3S16H 1DS2I 1Y1BA 3DA4A 4LF9L 3KF8B 4Z7GA 3PO3H 2KHIA 1E24A 2NN6I 3PV0A 5AJ3L 4A3GG 4UP9A 1K8AC 1Q86C 4B3RQ 1OTCA 2CQOA 1XNRQ 4GKJQ 1CHOI 1N8RC 4HFVA 2CWAA 4JOIA 5LMNQ 3CMEA 3CD6A 1NTGA 4DUYQ 1FGUA 4A3JG 5IP9G 3K81C 1YO7A 1XMQL 2Z6KA 2R93H 2N78A 1PFSA 1CT0I 1I6HH 4GNXC 1SGNI 1OVOA 1CKMA 2L1LB 1EIYB 5EX0A 1G291 1Q82C 2HIXA 1M90C 1GKHA 5C3EH 3GD7A 3S1RH 1VDDA 4JC0A 5GAGC 2PNHA 1PPFI 2JA9A 2D0OA 3M4QA 3E9HA 1IY5A 2QEXA 2ZTEA 1HNXQ 4L5TA 1XNQQ 1VQ5A 3GTKH 5JJLA 4A3MH 3H0GG 2F6MB 4FDBA 4QY7A 4JI4L 2NVQH 2WAQG 4JI6L 1UVGA 3NENA 1FYBA 4NXNL 1HJAI 2YFBA 1Y1VH 1LM0A 4JBMA 1KAWA 1Y1CA 5CCLA 4RG1A 2FXQA 3CCUA 4GOPC 4JCVE 1QVGA 3UFFA 4X64Q 4R4IA 4LF8L 1GO3E 4EX5A 5IP7H 4P75A 5JHWC 2CAZB 4DV3L 1BVSA 2CWPA 4OONA 1YJNA 1YTPA 1YJ9A 4B3TL 4X64L 1SGDI 3E59A 1LR8A 4JBJA 4RMFA 1TBRR 1YU6C 2RIOA 1RIPA 1M8CA 5M3MG 4DV3Q 3S15H 3PDNA 1N34Q 2JA8H 2IHFA 1KD1C 1M1KC 5J3BA 5JEAG 4JI6Q 2A2DA 3ERSX 4DKAC 2ZM6Q 4BY1G 2E5LQ 1PCEA 1S72A 2QQDA 1G6PA 1IZ6A 3ULJA 2A1AA 4APVA 1YHAA 3U4VA 4IFDI 4R4TA 2NU4I 1VQPA 1XMQQ 3S17H 5JEAJ 3M7NA 5E7NA 4KHPL 4K0KQ 1P16A 1XA6A 2ENNA 1HDLA 4B3SL 1AH9A 4A3LG 1TWFH 2N49A 3AFQA 3JAMc 5HGIA 2R7DA 3U50C 2R7ZG 4HIKA 5M3FH 2HHHQ 2UUAQ 4BY7H 4BBSG 4G76A 2ATWA 3F1ZA 4IPGA 1V1IA 2K19A 4QJFA 5DLQE 4HJ7A 2QQEA 1TWGH 2A20A 2F52A 2Y0SE 4LF4L 4LFAQ 1VQEA 4HIOA 1XPRA 2JW6A 2YUUA 4YZ9A 3PUWA 3KP9A 4QIWE 3CCMA 3PUVA 4LFAL 4UPAA 2I5HA 4X65Q 4LF5Q 1C0AA 2UZ3A 2K5VA 4DR1Q 2YTVA 3HOYG 5FLMH 4GN3B 2N3SA 2XTQA 4B6DA 4A3CG 4JI2Q 1ASYA 1B7YB 3HOVH 1Z47A 1L0WA 1Z9FA 3F2DA 1MT1A 5M5WH 1VQJA 4R1JA 1YI2A 1R9TH 4LF4Q 4JG2A 2DB6A 1CSPA 1HPTA 3HOUG 2KCTA 2J9RA 2KMRA 1A62A 1UE1A 4JBKA 4Q9VA 3I55A 1X54A 4HJAA 1SFOH 1RFHA 3CMAA 1VQLA 5IT9c 1I94Q 4A3KG 1WCMG 3L7ZC 2L8EA 4NXMQ 4A3FH 1VQ9A 1X74A 4DR2L 1X3GA 2NN6G 3AEVA 3UE1A 1YZ6A 2B0UC 4IFDG 3VE5A 3I56A 4LF7L 4DAYB 4OWXB 5ELNA 4DV0Q 3CC7A 5HGQA 1VQBA 1X55A 3S1NH 2LXJA 4OX9L 1W3SA 1NMFA 3A74A 4JI7Q 3HOZG 4LFCL 3A5ZB 2LSSA 5FLXc 3J7ZC 4L9MA 4DR1L 4JYAQ 4QGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE6 A;  1WYD A;  1V9P A;  2I5M X;  2UUC Q;  3HOW H;  4DR6 L;  1TWH H;  2QGQ A;  3TRE A;  5EAY A;  1EUJ A;  4HID A;  4A93 H;  2K5N A;  1HZA A;  3K7U C;  4OO1 I;  5GAH C;  1S3O A;  1HNZ Q;  5K36 G;  4LF7 Q;  4GLV B;  1XNQ L;  1VQI A;  1LUZ A;  1YIJ A;  1X9N A;  1I94 L;  2C35 B;  1VQA A;  4B3R L;  4MZ9 A;  2EIF A;  4GKJ L;  1N9W A;  3W1B A;  4JV5 L;  2MFI A;  4DNI A;  5IYC G;  4DR5 L;  1QVF A;  1VQK A;  3S2H H;  3RZD H;  4DR4 Q;  3IRB A;  3CCR A;  2I0Q A;  2AMC B;  1HNW Q;  4OXP A;  2UU9 Q;  1XPU A;  1JE5 A;  2VUM H;  4X6A H;  5AJ3 Q;  2VW9 A;  1X3E A;  2MO0 A;  1E1T A;  3H15 A;  4DR6 Q;  1L1O A;  4DV6 L;  4JI8 Q;  3M4P A;  4LUV A;  1PH6 A;  5M5X H;  3VDY A;  1Q8K A;  1IYJ B;  1U0L A;  3EBE A;  4QL5 A;  4A3F G;  2UXB Q;  4JV5 Q;  3HKZ E;  5IYC H;  1L1O C;  2JA7 G;  3CC2 A;  1N36 Q;  2PQA B;  2AKW B;  1Q1B A;  4JI3 L;  3KFU A;  4KHP Q;  3OTO Q;  3GDE A;  1JJ2 A;  4KLK A;  4C3I H;  4GOP B;  4DV2 L;  4IOC A;  4Y7N H;  2HHH L;  2Y0S G;  2UUA L;  1YJW A;  1PYS B;  2ZTC A;  1JMC A;  4JI5 Q;  4A93 G;  1KHI A;  4A3C H;  2OCE A;  1E7Z A;  2UUB L;  1CUK A;  2K14 A;  4AH6 A;  3PF5 A;  1QZH A;  1JJC B;  4K0K L;  2UXC Q;  1TWA H;  1PHJ A;  1SN8 A;  3I7F A;  4GKK Q;  3HFZ B;  4IPH A;  1NBW A;  2VNU D;  1SR3 A;  4O0A A;  4DV6 Q;  4JI0 Q;  1PA6 A;  1V43 A;  3ZJY C;  4LWC A;  1KQS A;  1YEZ A;  3RLO A;  4YY3 Q;  4TQU S;  3HOZ H;  3WWV A;  2BA0 A;  4IPC A;  1HNW L;  2E2I H;  2JA6 G;  1EOV A;  1SRU A;  1K0R A;  3FP9 A;  1YIT A;  4WJ3 M;  1H95 A;  4R4Q A;  4L5R C;  2KCM A;  3KJO A;  2D62 A;  4JI1 L;  3KYH C;  2Q2I A;  3CCQ A;  2OWO A;  4PG3 A;  1AE2 A;  3PUY A;  1K73 C;  5IE8 A;  1WCM H;  2JA6 H;  1CKN A;  4YWM A;  4YHH Q;  1KC8 C;  1CKN B;  3BZK A;  3F8T A;  1S40 A;  4B3M Q;  2E2J H;  1E22 A;  5M3M H;  2WAQ E;  1PV4 A;  4YWL A;  4YHH L;  4JI0 L;  1C7Y A;  1IBK L;  3MXN B;  1J5E L;  3M3Y H;  4DR3 Q;  2A8V A;  4YWK A;  1YNX A;  3L2P A;  1HZB A;  2D0P A;  3UDG A;  4GNX A;  1UE7 A;  2WB1 E;  3KLW A;  4DK6 C;  1TWC H;  3ER0 A;  5FLM G;  1FVI A;  3GTG H;  4DV5 L;  3K8A A;  1RL2 A;  3J80 i;  2Q2U A;  2Z0S A;  3F2C A;  1PYB A;  4DV5 Q;  1A0I A;  3T1H Q;  1XNR L;  1VQ8 A;  2RCN A;  3KF6 A;  3KOJ A;  2KEN A;  5C3E G;  5C4J H;  3RNU A;  4POG A;  2JA7 H;  3J81 j;  4JI2 L;  1YBY A;  3G48 A;  3CF5 A;  1I5F A;  3BU2 A;  5IWA L;  1PVO A;  5M3F G;  1E1O A;  1XPO A;  5BR8 L;  2R7Z H;  1T9H A;  4DV7 L;  5IP9 H;  4X66 L;  1O7I A;  1IBK Q;  4A76 A;  1MKH A;  1LTL A;  2B3G A;  5C0X I;  2RHS B;  4HJ9 A;  2NVX H;  1PH7 A;  4PZ7 A;  5LMN L;  3FHW A;  3S2D H;  4J15 A;  1I50 H;  4YCU A;  1D8L A;  2JK8 A;  4BA1 I;  4DV4 Q;  4HJ5 A;  1HR0 L;  4JI3 Q;  2VUM G;  4A3G H;  4X62 Q;  1ASZ A;  2CCZ A;  1HR0 W;  5LMU Q;  1GD7 A;  4IJL A;  4A3K H;  2UXB L;  4GN5 A;  4JOI C;  2ZTD A;  3PO2 G;  2OQK A;  1VQH A;  4OWT B;  3HOU H;  3DM3 A;  3K80 C;  3J81 i;  1Q1E A;  3CCL A;  3W1G A;  1N32 L;  3AYH B;  4AQY L;  2BH2 A;  4DV4 L;  2JEA I;  1FL0 A;  3GTL H;  2ALY B;  1JB7 A;  2EQS A;  4GLA C;  4UP8 A;  3HOV G;  1Y14 B;  3M85 A;  2UU9 L;  4C2M H;  1BBU A;  1XMO L;  4X66 Q;  3HOY H;  2R92 H;  3GTP H;  1K83 H;  3CCS A;  1B8A A;  1IXR A;  2NZO A;  3H0G H;  1VQM A;  2F4V L;  3H3V I;  3HOW G;  4JYA L;  3T1Y Q;  3BZC A;  1N33 Q;  3KJP A;  1SMX A;  2H5X A;  2DUD A;  3DLL A;  2AWN A;  4AYB E;  1HH2 P;  2K52 A;  1C9O A;  2L15 A;  2PI2 A;  3RN2 A;  3ULP A;  1MJC A;  3M9B A;  4DR5 Q;  4BBS H;  4GS3 A;  1NJI C;  4BY7 G;  3G4S A;  1LYL A;  5LMN W;  1E3P A;  1U5K A;  4A3J H;  4OWW B;  4OO1 G;  3SGI A;  1UEB A;  1L2F A;  2K5H A;  1PH8 A;  3T1Y L;  4R4O A;  2DGY A;  4GOP A;  2UUB Q;  1N33 L;  1JJG A;  3PO3 G;  3S1Q H;  3E9I A;  1EYG A;  3A5U A;  3I4N G;  2JJQ A;  2JEB I;  3NEL A;  2EXD A;  1XJV A;  4POF A;  4L5S A;  2JA8 G;  1OXT A;  5C44 G;  3TEH B;  2XGT A;  2R7F A;  1N32 Q;  1VQG A;  2YU9 H;  2F3I A;  1B70 B;  4YY3 L;  5HY6 A;  1VQO A;  1WFQ A;  1G51 A;  1X6O A;  2MO1 A;  4MTN A;  4HIM A;  1V1Q A;  3PUZ A;  2ZJP A;  5C4X H;  2E8G A;  2HIV A;  1MIU A;  1Y1W G;  2VY3 A;  2Z6K C;  4IOA A;  2UXD L;  3STB C;  1Y1V G;  5FJ8 H;  2B29 A;  2IX0 A;  4PMW A;  1QVC A;  1TXY A;  2A19 A;  2WB1 G;  4YCW A;  1CKO A;  1SLJ A;  2WFW A;  2IY5 B;  2VQE Q;  1EQQ A;  1HZC A;  2PMZ E;  1X65 A;  3K7A H;  4YCV A;  4DV2 Q;  1IBM Q;  3NEM A;  3KDF B;  3Q8D A;  1IBL Q;  3UDF A;  3S1M H;  3AQQ A;  4H02 A;  3HKZ G;  3D0F A;  3J7A 5;  1NMG A;  3MEF A;  2MQH A;  4B3T Q;  2AHO B;  4A3L H;  5LMU L;  4Y52 H;  5C0X G;  4JI5 L;  4KHZ A;  1GM5 A;  2VS1 A;  4DUZ Q;  4PZ8 A;  1IBM L;  4UP7 A;  1K8G A;  4PZ6 A;  5C0X J;  4BY1 H;  1XTD A;  2HQL A;  1KRS A;  3W5O A;  4DV7 Q;  1QUQ B;  5JJK A;  4A3E G;  1IL2 A;  4B3S Q;  3RLN A;  3RN5 A;  3HOX H;  2JA5 H;  3D31 A;  1NE3 A;  1IBL L;  1FJG L;  4DR3 L;  5IP7 G;  4KI0 A;  4HJ8 A;  4LFB L;  2VQF Q;  2GN5 A;  5ELO A;  3ULL A;  5IYD H;  3JC6 6;  1VS0 A;  3G71 A;  1CSQ A;  3CP0 A;  2Q2T A;  2IX1 A;  4A3B G;  4C3J H;  1Q46 A;  2VQF L;  1YHQ A;  3CCJ A;  4IFD J;  2UUC L;  4P72 A;  2RF4 A;  4C3H H;  4A3M G;  3PGZ A;  1AE3 A;  1I3Q H;  4LFC Q;  3J81 c;  3GTM H;  4DR7 Q;  4B3M L;  1VQC A;  3RR5 A;  2IT1 A;  3GTQ H;  3CXC A;  4A4I A;  4XTC S;  1BBW A;  4LF6 Q;  2GVA A;  2YV5 A;  2JE6 I;  1UWV A;  4P71 A;  3U58 A;  2R93 G;  4IPD A;  2WP8 J;  4TVA B;  3A0J A;  1VCI A;  5GRO A;  1FJG Q;  1VQ6 A;  1WOC A;  2PI2 E;  3G6E A;  1PH3 A;  3H3V H;  1J6Q A;  1X3F A;  1YVC A;  2PQA A;  3GO5 A;  3UE0 A;  4NXM L;  2YYZ A;  4ALP A;  1KIX A;  5IYB G;  2F4V Q;  3UDX A;  2OTJ A;  4A3B H;  2B63 H;  1PH1 A;  4LW1 A;  4LF6 L;  1HZ9 A;  4GN4 B;  1SRO A;  3CCE A;  1QZG A;  1KXL A;  4JI4 Q;  4A3D G;  4DPG A;  2I5L X;  1HR0 Q;  2LXK A;  1K9M C;  3STB D;  1Q12 A;  5IWA Q;  2VQE L;  4A3D H;  3TS0 A;  1EQR A;  1X56 A;  3EN2 A;  4LUZ A;  4BBR H;  1PH4 A;  1PH9 A;  4JI1 Q;  4A3E H;  3TRZ A;  3CCV A;  3GTO H;  1A8V A;  4P74 A;  2UXC L;  1XMO Q;  3S14 H;  3CPW A;  1HNZ L;  3ICE A;  2CKZ B;  2V1C C;  4X62 L;  4A3I H;  4P73 A;  1PH5 A;  5C4X G;  4AQY Q;  3FKI H;  1N36 L;  1EFW A;  3GTJ H;  2E5L L;  4BXX G;  2UXD Q;  3OTO L;  1YHB A;  2JQO A;  4NPS A;  2K50 A;  3I4O A;  3RZO H;  4BA2 I;  2ZJR A;  1GVP A;  2VZA A;  4DR4 L;  4GKK L;  4LUO A;  1VQD A;  1W2B A;  3PF4 A;  1JT8 A;  1L1O B;  4O2D A;  5M5Y H;  1DGS A;  3KF6 B;  5GAE C;  4BXX H;  4DK3 C;  1UE5 A;  1Q7Y C;  2NVY H;  3JAM i;  1PH2 A;  2QA4 A;  4DUZ L;  4MNO A;  2VL6 A;  2XTI A;  3U4Z A;  4NXN Q;  3I4M H;  1VQF A;  3OYY A;  3AFP A;  4NB3 A;  5FJ8 G;  4DV0 L;  3TS2 A;  5IYD G;  1A63 A;  2ZM6 L;  2OQ0 A;  1HNX L;  4DV1 Q;  4IO9 A;  1OXX K;  2NVT H;  4DR2 Q;  3M4O H;  4JBW A;  3E0E A;  1VQ7 A;  2MNA A;  1OXU A;  3OW2 A;  1EIF A;  3HOX G;  3KDF A;  3T1H L;  3K0X A;  1Q81 C;  2K75 A;  5C44 H;  2OTL A;  1VQN A;  2NZH A;  3S24 A;  3CW2 C;  2AWO A;  3I2Z A;  2IHE A;  1KRT A;  2YTX A;  2ES2 A;  1BKB A;  3B6Y A;  4LF8 Q;  4OX9 Q;  2YTY A;  4GLX A;  5IYB H;  4A75 A;  3I4N H;  4WJ4 A;  3I4M G;  3NBH B;  1WI5 A;  3PCO B;  4DAM A;  2BA1 A;  3CAM A;  5GAD C;  1SE8 A;  4ME3 A;  1N34 L;  1KL9 A;  3J80 c;  3HKS A;  3F2B A;  2ZJQ A;  4LF9 Q;  2ASB A;  2KBN A;  2HT1 A;  3PUX A;  1J5E Q;  2Q2H A;  1D7Q A;  3TQY A;  5H1S E;  2N8N A;  4JI7 L;  5GQO A;  4DV1 L;  5JJI A;  3PIO A;  1QUQ A;  1P8L A;  4UY8 C;  4IJH A;  4LFB Q;  3FKI G;  3BJU A;  2R6G A;  4A3I G;  1EWI A;  2BH8 A;  4EQ5 A;  2R92 G;  2RHQ B;  4AIM A;  3PSI A;  3RLF A;  4JI8 L;  3CPF A;  1Y1W H;  1S72 A;  1OXS C;  2CFM A;  3UDI A;  1HJP A;  1WJJ A;  3LGJ A;  4AYB G;  2K4K A;  4BBR G;  2E2H H;  4LNQ A;  3L0O A;  3CC4 A;  4X65 L;  4LF5 L;  4GNX B;  3CQZ H;  2GVB A;  1K3R A;  4R4C A;  4XIG S;  5BR8 Q;  1NY4 A;  4L5Q A;  4DUY L;  2JA5 G;  3PIP A;  1VQ4 A;  2ID0 A;  1MJE A;  3PO2 H;  3EIV A;  2B63 G;  5IY0 A;  4QQB X;  2KHJ A;  1OXV A;  4DR7 L;  3S16 H;  4LF9 L;  3KF8 B;  3PO3 H;  2KHI A;  1E24 A;  2NN6 I;  3PV0 A;  5AJ3 L;  4A3G G;  4UP9 A;  1K8A C;  1Q86 C;  4B3R Q;  1OTC A;  2CQO A;  1XNR Q;  4GKJ Q;  1N8R C;  2CWA A;  4JOI A;  5LMN Q;  3CME A;  3CD6 A;  1NTG A;  4DUY Q;  1FGU A;  4A3J G;  5IP9 G;  3K81 C;  1XMQ L;  2R93 H;  2Z6K A;  2N78 A;  1PFS A;  1I6H H;  4GNX C;  1CKM A;  1EIY B;  1G29 1;  1Q82 C;  2HIX A;  1M90 C;  1GKH A;  5C3E H;  3GD7 A;  3S1R H;  4JC0 A;  5GAG C;  2PNH A;  2JA9 A;  2D0O A;  3M4Q A;  3E9H A;  2QEX A;  2ZTE A;  1HNX Q;  4L5T A;  1XNQ Q;  1VQ5 A;  3GTK H;  5JJL A;  4A3M H;  3H0G G;  4FDB A;  4JI4 L;  4QY7 A;  2NVQ H;  2WAQ G;  4JI6 L;  3NEN A;  4NXN L;  1Y1V H;  1LM0 A;  4JBM A;  1KAW A;  4RG1 A;  2FXQ A;  3CCU A;  4GOP C;  4JCV E;  1QVG A;  4X64 Q;  4R4I A;  4LF8 L;  1GO3 E;  4EX5 A;  5IP7 H;  4P75 A;  4DV3 L;  1YJN A;  1BVS A;  2CWP A;  4OON A;  1YJ9 A;  4B3T L;  4X64 L;  4JBJ A;  4RMF A;  1RIP A;  5M3M G;  4DV3 Q;  3S15 H;  1N34 Q;  2JA8 H;  2IHF A;  1KD1 C;  1M1K C;  5J3B A;  5JEA G;  4JI6 Q;  3ERS X;  4DKA C;  2ZM6 Q;  4BY1 G;  2E5L Q;  1G6P A;  1IZ6 A;  3ULJ A;  2A1A A;  4APV A;  1YHA A;  3U4V A;  4IFD I;  4R4T A;  1VQP A;  1XMQ Q;  3S17 H;  5JEA J;  3M7N A;  5E7N A;  4KHP L;  4K0K Q;  1P16 A;  4B3S L;  1AH9 A;  4A3L G;  1TWF H;  2N49 A;  3AFQ A;  3JAM c;  2R7Z G;  2R7D A;  3U50 C;  4BY7 H;  4HIK A;  5M3F H;  2HHH Q;  2UUA Q;  4BBS G;  2ATW A;  3F1Z A;  4IPG A;  4QJF A;  5DLQ E;  4HJ7 A;  1TWG H;  2F52 A;  2Y0S E;  4LF4 L;  4LFA Q;  1VQE A;  4HIO A;  1XPR A;  3PUW A;  4QIW E;  3CCM A;  3PUV A;  4LFA L;  4UPA A;  2I5H A;  4X65 Q;  4LF5 Q;  1C0A A;  2K5V A;  4DR1 Q;  2YTV A;  3HOY G;  5FLM H;  4GN3 B;  2N3S A;  4A3C G;  4JI2 Q;  1ASY A;  1B7Y B;  3HOV H;  1Z47 A;  1L0W A;  1Z9F A;  3F2D A;  5M5W H;  1VQJ A;  4R1J A;  1YI2 A;  1R9T H;  4LF4 Q;  4JG2 A;  1CSP A;  3HOU G;  2KCT A;  1A62 A;  1UE1 A;  4JBK A;  1SFO H;  3I55 A;  1X54 A;  4HJA A;  3CMA A;  1VQL A;  5IT9 c;  1I94 Q;  4A3K G;  1WCM G;  3L7Z C;  4NXM Q;  4A3F H;  1VQ9 A;  4DR2 L;  1X3G A;  2NN6 G;  3AEV A;  3UE1 A;  1YZ6 A;  4IFD G;  3I56 A;  4LF7 L;  4DAY B;  4OWX B;  5ELN A;  4DV0 Q;  3CC7 A;  5HGQ A;  1VQB A;  1X55 A;  3S1N H;  2LXJ A;  4OX9 L;  1W3S A;  1NMF A;  3A74 A;  4JI7 Q;  3HOZ G;  4LFC L;  3A5Z B;  2LSS A;  5FLX c;  3J7Z C;  4DR1 L;  4JYA Q;  4QGU A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  1UE6 A;  1WYD A;  2B8G A;  2DKV A;  4OIJ A;  3TRE A;  5D3D A;  5EAY A;  3K5O A;  3BVG A;  1R9T B;  2RDG A;  2PQ8 A;  3K7U C;  4OO1 I;  1S3O A;  1PFM A;  1CZG A;  1DM0 B;  2E5R A;  2ICE C;  2C35 B;  4B3R L;  4GKJ L;  4MZ9 A;  1HFG A;  4C1N K;  4TKO B;  5EGT A;  4JV5 L;  4I65 A;  1QVF A;  1BCP D;  1VQK A;  4DR4 Q;  1QIL A;  2AMC B;  2MJF B;  1WGC A;  5KYI A;  1XPU A;  2NYZ D;  1JE5 A;  3TBI B;  5CBE E;  5AJ3 Q;  2VW9 A;  1X3E A;  1Y1V B;  3R8B A;  5I9P A;  3RUZ A;  1KBF A;  5M5X H;  1IYJ B;  1HTL D;  4A3F G;  4G75 A;  1AN1 I;  2V4D A;  5IYC H;  2PQA B;  4KHP Q;  2IP6 A;  4C3I H;  2CWH A;  2UUA L;  2Y0S G;  1R0R I;  1GXD C;  1KHI A;  1Y8F A;  1R4P B;  4SGB I;  2D2C C;  1JJC B;  3TO6 A;  1PRT D;  3ERO A;  3HFZ B;  2B2Y A;  2LS0 1;  2VNU D;  5KNB A;  4JI0 Q;  3RD4 A;  3ZJY C;  4A3K B;  1XYI A;  5CCM A;  4IUQ A;  3FBV A;  2WGC A;  4TQU S;  3UEY A;  4IPC A;  2B2Y C;  2N52 A;  3A8J E;  4FVM A;  2E2I H;  1K0R A;  2F0J A;  1TBO A;  3B55 A;  4L5R C;  1E2V A;  3KJO A;  5LL6 X;  2R92 B;  1SBB B;  2OWO A;  1I6H B;  1W4R A;  2RLD A;  2SDF A;  1AE2 A;  1HHV A;  1EEI D;  3VE5 A;  1F77 A;  1KDB A;  1KLG D;  1NR4 A;  4YHH Q;  1CKN B;  3BZK A;  3F8T A;  1S40 A;  2JA5 B;  1GOZ A;  5M3M H;  2IX3 A;  1I6V C;  1BCP C;  1C7Y A;  3MXN B;  2I46 A;  1J5E L;  3M3Y H;  3MXN A;  1R4Q B;  4YWK A;  4E1P A;  1YNX A;  4KY5 A;  1SND A;  3FPP A;  4A3G B;  4GNX A;  3KLW A;  1TWC H;  5FLM G;  3I90 A;  5EBC A;  3K8A A;  5HQ8 A;  1RL2 A;  4MN3 A;  3OSO A;  2Z0S A;  3F2C A;  4DV5 Q;  3T1H Q;  5CV9 A;  1J8I A;  4MHE A;  1VQ8 A;  3KF6 A;  3KOJ A;  2KEN A;  5C3E G;  3RNU A;  5EJW A;  3J81 j;  5IWA L;  3MHB A;  5KRU A;  3KLS X;  4DXF A;  1TKW B;  1XPO A;  1T9H A;  4DV7 L;  1O7I A;  1V1H A;  3UI2 A;  1TII D;  2NVX H;  1LTL A;  2ENZ A;  4ZCK A;  3A8I E;  4GN5 A;  4UXJ A;  1RHP A;  5CV8 A;  3CU7 A;  1TWA B;  5M3M B;  1JE4 A;  3HOU H;  2V53 A;  1Q1E A;  3AYH B;  4DV4 L;  3GTL H;  3GTJ B;  2ERW A;  3UOE A;  4UP8 A;  1EZ6 A;  1JC7 A;  2F0K A;  1XMO L;  3HOY H;  4OIK A;  4FYD A;  1HXY D;  1K83 H;  2GIV A;  1IXR A;  2NZO A;  1MSH A;  3T1Y Q;  1N33 Q;  4U6R A;  3DLL A;  2JXD A;  5C6A A;  3H3V C;  4KJN A;  1RCV D;  2Q8I B;  1WKX A;  3ULP A;  4DR5 Q;  1LYL A;  4A3J H;  4OO1 G;  5C4H A;  3SGI A;  1UEB A;  4R4O A;  5CBA E;  4GOP A;  2XNA C;  1F9S A;  1JJG A;  4Y7N B;  1WTR A;  3S1Q H;  1CGJ I;  3I4N G;  1EQV A;  3MVV A;  2YFA A;  2YU9 H;  4PL5 A;  1GJX A;  1E2Z A;  1LT3 D;  1BO0 A;  1WFQ A;  1D1K A;  5CV4 A;  2H4O A;  1PJU A;  4HIM A;  2AUK A;  2ZJP A;  1MSG A;  3PUZ A;  5C4X H;  2E8G A;  2UXD L;  2VY3 A;  4HED A;  4R8N A;  3SK8 A;  2B29 A;  4CKB A;  1QVC A;  1TXY A;  2WB1 G;  2NVX B;  4YCW A;  1CKO A;  2VQE Q;  4RCN A;  1SJE D;  1KBE A;  1X65 A;  3NEM A;  1JOK A;  3P1H A;  2FJ2 A;  4ZRZ A;  4EVO A;  5FUV A;  3AQQ A;  4CDD C;  4PMB A;  3SK4 A;  3SEB A;  3VYR A;  5FOB B;  3MEF A;  2AHO B;  1SE4 A;  3P23 A;  1TS3 A;  3SHL A;  2LFN A;  2VS1 A;  4FF4 A;  4PZ8 A;  4Q0F A;  2B2U A;  5COR A;  1K8G A;  1HTP A;  2ROW A;  4BY1 H;  1MJ9 A;  2HQL A;  3BDO A;  2DIP A;  1LT6 D;  2LUY A;  3I91 A;  3MXG A;  3QG1 A;  3HOX H;  1WTO A;  2FNF X;  4UAI A;  5ELB A;  3NWS A;  2NU1 I;  2JA6 B;  3E3X A;  5IP7 G;  4KI0 A;  4RGT A;  4X3T A;  4HJ8 A;  4LFB L;  3SE0 A;  5ELO A;  5KGU A;  1ESR A;  3ULL A;  5IYD H;  2J0T D;  3G71 A;  2Q2T A;  3TN2 A;  2CQA A;  4A3M G;  1JWU D;  1VMC A;  3QTL D;  3GTG B;  4OHJ A;  2DNC A;  3X3M A;  4DR7 Q;  5DEH A;  4E1R A;  1WTJ A;  1W6J A;  4P71 A;  4LJZ C;  1BBX C;  2WP8 J;  3I4N B;  5KIX A;  4IUU A;  1CT2 I;  1VQ6 A;  1WOC A;  1WCM B;  2E75 C;  3RZO B;  3UE0 A;  4FXK C;  4Q5V A;  2B63 H;  2O2L D;  1KXL A;  1TDP A;  3UGL A;  3C2P A;  1HR0 Q;  1Q12 A;  1HPC A;  1QJO A;  3TS0 A;  1EQR A;  1X56 A;  1PH9 A;  4JI1 Q;  2R61 A;  1A15 A;  3OXG A;  2PNR C;  4KV6 A;  1XMO Q;  5E3P A;  1HNZ L;  3ICE A;  4A3I H;  4P73 A;  3MWY W;  1SYD A;  4DA2 A;  2MJ8 A;  1JCK B;  4NPS A;  4GKK L;  4OVO A;  3PF4 A;  1L1O B;  1G91 A;  1Z7T A;  1NR2 A;  2DN8 A;  4BXX H;  2ZXR A;  3BG3 A;  1UE5 A;  1PTO H;  1PH2 A;  1V1P B;  1M8B A;  2SGD I;  4MNO A;  2XTI A;  1NCV A;  4NXN Q;  4B9X A;  5FJ8 G;  1BXT A;  4DV0 L;  5IYD G;  1ML0 D;  2ZM6 L;  2LB7 A;  2F0O A;  3C1E A;  3DEP A;  4XQN A;  1VQ7 A;  5FO9 B;  5NUC A;  1W6K A;  2MNA A;  1EEF D;  1OXU A;  3HOX G;  3KLR A;  3T1H L;  1PDQ A;  5C44 H;  2B2V C;  3S24 A;  2AWO A;  5ELD A;  2IHE A;  3CXL A;  4Z7H A;  2RBM A;  4A75 A;  3GOX A;  4ZLT F;  2B2V A;  3S16 B;  3PIP 3;  4ME3 A;  4M1U B;  3PO2 B;  4YIJ A;  1J5E Q;  2Q2H A;  2PW5 A;  1DOK A;  2KOL A;  2N8N A;  2M5X A;  1CM9 A;  3M3Y B;  2GKV A;  3PIO A;  5M5W B;  2F1M A;  4TRD A;  4IJH A;  3FKI G;  3UEJ A;  1A2U A;  4MPI A;  3OL0 A;  3C46 A;  1K8O A;  2PZW A;  2WB1 B;  2JAE A;  2R92 G;  2HDL A;  3QWP A;  4JPB W;  4CHT B;  3M4O B;  1K7U A;  2ZW3 A;  3UDI A;  1HJP A;  1WJJ A;  4LNQ A;  5C4X G;  2K4K A;  4BBR G;  2E2H H;  3L0O A;  3WOF A;  2WAQ B;  2EYM A;  2GVB A;  3CQZ H;  1K3R A;  3KY9 A;  5I2X A;  5J8F A;  4L5Q A;  2JA5 G;  3PIP A;  3FC3 A;  1T5E A;  4EGV A;  3PO2 H;  4JK1 C;  4U68 A;  2KHJ A;  1IW4 A;  1OXV A;  1DS2 I;  4Z7G A;  4BWG B;  5AJ3 L;  4A3G G;  2CQO A;  3VA7 A;  1CHO I;  3OIP A;  1N8R C;  4JOI A;  3BS1 A;  4O1N A;  5LMN Q;  2JA8 B;  4J8Q A;  4A3J G;  2Z4H A;  5C4Z A;  1I6H H;  4K8J A;  4GNX C;  4ULL A;  5EX0 A;  2AQ1 B;  2HCI A;  2EYH A;  3GD7 A;  1SYC A;  5GAG C;  2CH4 A;  2PNH A;  1PPF I;  1I4R A;  4UDU C;  2KCC A;  3DM1 A;  1TWF B;  2L0C A;  1SMY C;  2WAQ G;  1WD1 A;  1HJA I;  1Y1V H;  1LM0 A;  3BVM A;  2SNM A;  2FXQ A;  3CCU A;  4KN7 C;  3OIQ A;  2MHV A;  3RZD B;  5JHW C;  4DV3 L;  1YJN A;  2QDB A;  3HKZ B;  4B3T L;  5FLX E;  1SGD I;  4FP5 D;  3TP6 A;  2JA8 H;  5JOB A;  1KDA A;  1M1K C;  1H9S A;  3T53 B;  4C3I B;  2A2D A;  3ERS X;  1PCE A;  1AW7 A;  2EXZ A;  4K2L A;  2QQD A;  1G6P A;  4APV A;  5C3W A;  3U4V A;  3M7N A;  4K0K Q;  2ENN A;  5KEE A;  1XA6 A;  2NVQ B;  4H7B A;  3ERQ A;  2N88 A;  2X6G A;  3V2T A;  5HGI A;  2R7D A;  2I07 B;  3JAM c;  2HHH Q;  3GTM B;  4BY7 H;  4BBS G;  5JVG 3;  1NNX A;  1V1I A;  3F1Z A;  1QNK A;  3PMF A;  2K19 A;  1EOT A;  3CRL C;  1K8M A;  2F52 A;  4OEM B;  3LX0 A;  5I4D A;  1VQE A;  1XPR A;  2G9H D;  2YUU A;  2SOB A;  2EDG A;  5T1I A;  5CV6 A;  2EE1 A;  3CCM A;  1BCP F;  1C0A A;  2F0F A;  1EU4 A;  2H1E A;  2JA7 B;  3NXW A;  2K5V A;  4DR1 Q;  5FLM H;  1B7Y B;  1Z47 A;  1Z9F A;  5M5W H;  3I8Z A;  1K7T A;  2B39 A;  1HPT A;  2BE5 D;  3OWE B;  4Q9V A;  2O5I C;  1I50 B;  3CMA A;  1I94 Q;  3BVZ A;  1GHK A;  2XWB B;  1EYC A;  1X74 A;  1K3B C;  4ZK9 B;  2MUY A;  3ND9 A;  3I56 A;  2CH4 W;  4DAY B;  4DV0 Q;  3CC7 A;  1X55 A;  4OX9 L;  2K5D A;  2VXW A;  2KQ3 A;  3NQI A;  2A6H C;  4IUP A;  3I70 A;  3BDL A;  2PCF B;  1PFB A;  4DR1 L;  4JYA Q;  3M7G A;  1V9P A;  1Q9B A;  1C48 A;  2ODD A;  2NVY B;  1EY9 A;  3D6W A;  1FNV A;  2NZ1 D;  4HID A;  5IIF A;  1LT5 D;  1LTA D;  1LAC A;  2EZV A;  2E2J B;  3FPU B;  1HNZ Q;  4H13 C;  4C3I G;  1ILQ A;  1WTV A;  1XNQ L;  4UHV A;  1S5C D;  1YIJ A;  1X9N A;  4YZD A;  1I94 L;  1TVX A;  1N9W A;  1CT1 D;  5IYC G;  4RKB A;  4DR5 L;  2JB1 A;  3S2H H;  1KAA A;  2A6E C;  3NQT A;  3T51 B;  1SSO A;  2F0E A;  3IRB A;  4A3I B;  2I0Q A;  2EYJ A;  2RSN A;  1HNW Q;  5K5P A;  2UU9 Q;  4X6A H;  1SGY I;  2MO0 A;  1E1T A;  3H15 A;  4DR6 Q;  4DV6 L;  4KD3 A;  4JI8 Q;  5C4X B;  4N8F A;  1PRT F;  1A3V A;  1STY A;  1Q8K A;  1U0L A;  3EBE A;  2E74 C;  1C8C A;  3HEJ A;  2UXB Q;  2N71 A;  5FUW A;  3K5M A;  4JV5 Q;  1STH A;  4QCL A;  3BYT B;  2AKW B;  2JB2 A;  1Q1B A;  3GDE A;  2F0Q A;  3Q22 A;  4GOP B;  2A69 C;  2HHH L;  4QB4 A;  1YJW A;  1PYS B;  2ZTC A;  1WTX A;  2KMQ A;  2UUB L;  5EPL A;  2K14 A;  4AH6 A;  4C1N I;  3PF5 A;  1QZH A;  4K0K L;  2KEE A;  3IAS 1;  4IPH A;  1NBW A;  4DFA A;  2PQE A;  4O0A A;  4ZUI A;  1V43 A;  1JOO A;  4LWC A;  3SVM A;  1ULM A;  4IUR A;  1XX6 A;  3WWV A;  2BA0 A;  2NB0 A;  4LMQ D;  5CC4 A;  1VF7 A;  2JA6 G;  2J87 A;  3FP9 A;  5LNK 1;  4R4Q A;  2F0S A;  1EWC A;  3HRZ C;  3J80 E;  3KYH C;  4LK1 C;  3CCQ A;  2F0P A;  5C4J B;  1CTM A;  3PUY A;  3TJQ A;  1WCM H;  1JWS D;  4YWM A;  3QWN A;  1RJT A;  1E22 A;  3OHX C;  1PV4 A;  4YWL A;  1STB A;  1TWC B;  5EKK A;  2NU3 I;  5K36 H;  2OT2 A;  4ME5 A;  3L2P A;  3OOC A;  1HZB A;  3V05 A;  1CSO I;  2WB1 E;  2JA1 A;  3GTG H;  1LTS D;  1G2S A;  2F3C I;  4EQO A;  1BMO A;  5IGB A;  2E2D C;  5KND A;  2A2C A;  4POG A;  2JA7 H;  5C4J H;  1BCP B;  1IY5 A;  3CF5 A;  4ID6 A;  1PVO A;  3RU0 A;  5AFW A;  1JOQ A;  1E1O A;  1HEV A;  2JYY A;  1O78 A;  1IBK Q;  4A76 A;  2B3G A;  1RTN A;  2L1B A;  1PH7 A;  1QCB D;  4IFD H;  5LMN L;  5JPN C;  2RC4 A;  1CA5 A;  4HJ5 A;  2B2W C;  1Y8N B;  3FNB A;  4YCU A;  4BA1 I;  4DV4 Q;  2VUM G;  4CJ0 B;  4A3G H;  3MFY A;  2CCZ A;  1HR0 W;  1EYA A;  4OAV B;  5G3L F;  2XTR A;  1FR3 A;  1II3 A;  4JOI C;  5EPK A;  2ZTD A;  3PO2 G;  2SGQ I;  1VQH A;  3JAM L;  1KTK A;  3K80 C;  3J81 i;  2WCY A;  2BH2 A;  3NSW A;  4GLA C;  3FKI B;  1Y14 B;  1QNU A;  1EQT A;  2R92 H;  1B8A A;  1VQM A;  2QQ0 A;  3HOW G;  1OYV I;  1EIG A;  3BZC A;  1U9R A;  1XBT A;  2Q8R E;  1RKN A;  4QF4 A;  2CW0 C;  5DM7 3;  4BBR B;  5M5X B;  2K52 A;  2XMX A;  1C9O A;  3QR8 A;  2PI2 A;  2NU0 I;  3ITP A;  1D5X C;  4NV2 A;  2Q8T A;  3S1R B;  3G4S A;  1U5K A;  1PH8 A;  3T1Y L;  1N33 L;  2DGY A;  1MD2 D;  3FEW X;  2HQE A;  4HCS A;  1ZYR C;  3A5U A;  3P7J A;  2EXD A;  1XJV A;  3TO9 A;  5C44 G;  3TEH B;  2R7F A;  5DM6 3;  1VQG A;  2ENB A;  5BN5 A;  1H0Z A;  2F3I A;  1B70 B;  5HY6 A;  1XWE A;  5C5M A;  1G51 A;  1V1O A;  4DWL A;  4IAL A;  4MTN A;  3AU7 A;  2K5W A;  3HOW B;  1MIU A;  3T4A C;  3MTS A;  5FJ8 H;  3DWP A;  2WFW A;  3QOJ A;  1NUC A;  1EQQ A;  4IN3 A;  4YCV A;  1IBM Q;  4DV2 Q;  4A3B B;  3Q8D A;  4ILW A;  3DHQ A;  1ZEQ X;  5I6Y A;  3D4D A;  3J7A 5;  3NBI A;  4B3T Q;  4A3L H;  3MC0 B;  1PYW D;  4DUZ Q;  3DO9 A;  1B4O A;  2KCX A;  4K5V A;  2QDL A;  2QEJ C;  1UNS A;  3W5O A;  1AZP A;  1QUQ B;  5JJK A;  3HOV B;  1L0Y B;  3L0I A;  1GUG A;  2RKS A;  3D31 A;  1NE3 A;  1IBL L;  2A74 C;  3G7L A;  2VQF Q;  2GN5 A;  1Y8O B;  1VS0 A;  4ZYS A;  3CP0 A;  2IX1 A;  1Q46 A;  4IFD J;  3L9A X;  5E4W C;  1LTG D;  4J6H A;  2B2T A;  2RF4 A;  4P72 A;  4C3H H;  4A3F B;  1AP0 A;  2Z1C A;  1SNO A;  3PGZ A;  1AE3 A;  3GTM H;  3HP3 A;  3J81 c;  4BY7 B;  2GVI A;  4HGU A;  4B3M L;  1AFP A;  2EYF A;  3K58 A;  1HA6 A;  5I6W A;  4DNT B;  2GVA A;  3U58 A;  2R93 G;  1ZXT A;  2KEC A;  2WII B;  4KY7 A;  3A0J A;  5GRO A;  1FJG Q;  3G6E A;  1YVC A;  1X3F A;  5C3X A;  2A69 D;  2JN4 A;  2YYZ A;  4ALP A;  2F4V Q;  2OTJ A;  3UDX A;  3D00 A;  1JR0 D;  4CGY B;  1PH1 A;  4GN4 B;  3CCE A;  5TSS A;  4JI4 Q;  4NV5 A;  2I5L X;  3OVO A;  3VYU A;  2LXK A;  2NBF A;  3STB D;  1B3A A;  3VA9 A;  3TP5 A;  5M3F B;  3MXU A;  2V1C A;  5ISR A;  1D5Z C;  3GTO H;  1BF4 A;  1A8V A;  4HSP A;  3AJF A;  3TP8 A;  1MJB A;  3S14 H;  2V1C C;  4X62 L;  2BDO A;  4AQY Q;  3UGD A;  1N36 L;  1EFW A;  4K2K A;  2E5L L;  4MTK A;  2UXD Q;  1B1Z A;  2JQO A;  3I4O A;  4G7Z C;  1FYC A;  2ZJR A;  2L55 A;  2SEB D;  4DR4 L;  4LUO A;  1VQD A;  5LHY 1;  5M5Y H;  1DGS A;  5LL6 S;  5GAE C;  1Y8P B;  2QQC A;  2GKR I;  5CYU A;  1Q7Y C;  3JAM i;  4DUZ L;  3U4Z A;  3GV6 A;  1UUP A;  3I4M H;  1CHQ D;  1CE3 A;  1VQF A;  3OYY A;  3PIO 3;  5IT9 E;  3TS2 A;  4FKD A;  1A63 A;  2OQ0 A;  1HNX L;  4DV1 Q;  2ORV A;  2NVT H;  2A6H D;  2A68 D;  1EIF A;  1LV9 A;  1IW7 D;  3K0X A;  3KDF A;  4HMI A;  2K75 A;  4OX9 Q;  1BKB A;  4DU9 A;  2OZU A;  5IYB H;  3I4N H;  3I4M G;  2OEO A;  5DNF A;  4HSV A;  4PNY A;  4AML A;  3R2I A;  4GXT A;  1STG A;  5GAD C;  3J80 c;  2KCN A;  3HKS A;  4LF9 Q;  3T56 B;  5IGF A;  4OL7 A;  1I4Q A;  2HT1 A;  2P6A C;  3TQY A;  5H1S E;  3NWT A;  2M9V A;  5EBD A;  1CK1 A;  2F0H A;  5GQO A;  3J80 L;  4DV1 L;  1Z7K B;  1P8L A;  1ONL A;  4UY8 C;  3VR5 A;  3G6J B;  1JQO A;  2R6G A;  4HTH A;  5KYL A;  1B3Q A;  1DCZ A;  4AS3 A;  3PSI A;  3RLF A;  1Y1W H;  3F4M A;  1OXS C;  2CFM A;  2F3V A;  5JVH 3;  1S72 A;  1GHJ A;  4AYB G;  3CC4 A;  4ZKB B;  1Q8I A;  4R4C A;  5E4X A;  3BDC A;  3FMC A;  1Z6H A;  4XIG S;  1RD9 D;  4OAU C;  3GQB A;  4ODG A;  4DUY L;  1SGE I;  1VQ4 A;  3KLS A;  2ID0 A;  3KK7 A;  4QQB X;  2IL8 A;  4DR7 L;  4AS2 A;  3S16 H;  3PO3 H;  2NN6 I;  5COY A;  2K01 A;  1Q86 C;  1OTC A;  1MHW C;  1XNR Q;  1F2Z A;  2FU2 A;  2KED A;  2CWA A;  3HG9 A;  2JP1 A;  4H44 C;  3CD6 A;  2UVO A;  1YO7 A;  2R93 H;  1DXM A;  4MIU A;  2N55 A;  1XTC D;  4XT3 B;  5C3E H;  1VDD A;  2F0G A;  3S1R H;  1EZ8 A;  4BBS B;  2JA9 A;  3E9H A;  1B50 A;  3NUC A;  3GTK H;  5JJL A;  1HRJ A;  3H0G G;  2F6M B;  2BDN A;  3NEN A;  3FSY A;  3DWQ A;  1QVG A;  2D9U A;  1LO5 D;  3I4L A;  2EJF C;  2QZG A;  4NMZ A;  4X64 Q;  4LF8 L;  1GO3 E;  4EX5 A;  3UFF A;  1AZQ A;  2CAZ B;  1HQM C;  1YTP A;  9WGA A;  2OF1 A;  1EY0 A;  4X64 L;  3S15 B;  4EQP A;  5M3M G;  4DV3 Q;  3S15 H;  1N34 Q;  2PO4 A;  4DKA C;  1KLU D;  4F88 A;  5JPM C;  3ULJ A;  2A1A A;  3S17 H;  1O80 A;  1PMR A;  1SXT A;  1HDL A;  3NE5 B;  1P16 A;  2DJF C;  2Z8L A;  3KUP A;  4B3S L;  1YNJ C;  4A3L G;  1AH9 A;  2N49 A;  1P9Z A;  2R7Z G;  3U50 C;  2UUA Q;  4QJF A;  2A20 A;  2DJG C;  5C3E B;  2VB2 X;  1I4P A;  1KNA A;  3FSX A;  4DK0 A;  1X3P A;  3KBX A;  2I5H A;  3LNN A;  4X65 Q;  4LF5 Q;  2UZ3 A;  1WTQ A;  4B6D A;  2F0D A;  1ASY A;  3K0Y A;  3HOV H;  1D2B A;  4LAA A;  4X3U A;  1R9T H;  4LF4 Q;  1NXU A;  1FNW A;  1A62 A;  1UE1 A;  4JBK A;  1S5E D;  1G8Z D;  2B8F A;  2VB3 X;  4A3K G;  1TT2 A;  4XXE A;  4A3F H;  3JAM E;  5IGD A;  1X3G A;  1ENF A;  4J1M A;  3I73 A;  4B08 A;  4LF7 L;  3S1N B;  5HGQ A;  1SYE A;  5FO7 B;  2LXJ A;  1EL0 A;  1SYG A;  3OWF A;  3HOX B;  2PW7 A;  3HOZ G;  3WDN A;  4LFC L;  2JXM B;  3CHB D;  3R93 A;  4KKS A;  1AEX A;  2R3Z A;  5FLX c;  1B44 D;  3J7Z C;  4QGU A;  2CJS C;  5CR3 A;  2UUC Q;  3HOW H;  3I4M B;  4DR6 L;  3R5A A;  1FAQ A;  5FLX L;  4RHS A;  2AUJ D;  2EYO A;  1V8Q A;  4A93 H;  2K5N A;  2Y0S B;  4ZQ3 A;  3FDT A;  1CQV A;  1TS2 A;  5BN3 A;  1VQI A;  1R79 A;  1LUZ A;  1Y69 U;  3LWE A;  1VQA A;  1X4S A;  3OMG A;  2F0M A;  3OXL A;  2ICI A;  3W1B A;  4DNI A;  3CCR A;  3VR2 A;  5EKI A;  2VUM H;  3VR6 A;  1VMP A;  4GI3 C;  1O7Z A;  1S4Z A;  3A54 A;  2QSB A;  3M4P A;  4LUV A;  1PH6 A;  1F2Y A;  5A35 A;  3VDY A;  3SDJ A;  4PV1 C;  4V19 0;  3UGI A;  2JA7 G;  3MAQ A;  1N36 Q;  3SEK C;  4JI3 L;  4RKL A;  4NP5 A;  3HOY B;  1JJ2 A;  1GUW A;  1ET9 A;  3K59 A;  4QUF A;  1PTR A;  1Z2I A;  2FFK B;  3EFX D;  5IGG A;  4PL4 A;  4A3C H;  3E5S A;  1E7Z A;  3ZYY X;  2CVR A;  1HCZ A;  1TWA H;  3I7F A;  1SR3 A;  4DV6 Q;  1PA6 A;  4A3E B;  2L5T A;  2KMO A;  3OXF A;  1YEZ A;  4YY3 Q;  1HNW L;  2SGE I;  4RCO A;  3AB9 A;  1H95 A;  4X3S A;  3H0G B;  1K83 B;  4KD4 A;  3K5N A;  2YQP A;  3J7Y W;  4F8M A;  1RF2 D;  3I72 A;  2EY6 A;  5HI7 A;  4PG3 A;  2AQ2 B;  4KJO A;  5FUX A;  2P22 B;  1K73 C;  2JA6 H;  1A2T A;  1CKN A;  2XN9 C;  1EY4 A;  5JEA H;  1OMU A;  2QPO A;  4B3M Q;  2E2J H;  5A2Q E;  3X3N A;  2XRS D;  1KDC A;  4FXG C;  1TGS I;  3TZD A;  1IBK L;  2Z4I A;  4CJ2 C;  4DR3 Q;  2A8V A;  4NW2 A;  4FXD A;  3EJI A;  1LAB A;  3SK6 A;  1LR7 A;  3W2D A;  2D0P A;  3UDG A;  1I3Q B;  5J8C A;  4DK6 C;  3IL8 A;  3ER0 A;  1FVI A;  1TIH A;  1M8A A;  3B4V C;  3T13 A;  2Q2U A;  2XRC A;  2EJM A;  5M9O A;  1ULK A;  1PYB A;  4RGO S;  1MGS A;  4JI2 L;  4IUT A;  1S5D D;  1XX8 A;  1I5F A;  3BU2 A;  1WGT A;  3H09 A;  5M3F G;  5BR8 L;  3QJY A;  5IP9 H;  5FUY A;  1B53 A;  2JZM A;  3D4R A;  3EQL C;  1MKH A;  5C0X I;  1SNP A;  2RHS B;  1A3T A;  4ZAI A;  4PZ7 A;  4KN4 C;  3FHW A;  3S2D H;  1SYB A;  1HR0 L;  2J4X A;  4JI3 Q;  3DA3 A;  4TSS A;  4X62 Q;  3DMU A;  1GD7 A;  4IJL A;  1MI2 A;  4A3K H;  2F0T A;  1IL8 A;  2OQK A;  3GP7 A;  1SDF A;  4C56 C;  2KA7 A;  4KK7 A;  1L0X B;  1SE3 A;  2TMP A;  5HUR A;  3CCL A;  4HMJ A;  4K6D A;  3S1Q B;  3E6Z X;  2ALY B;  3FVQ A;  2EQS A;  3HOV G;  2UU9 L;  2F66 B;  3SGB I;  1IKL A;  1E0B A;  4X66 Q;  1H9R A;  3GTP H;  1MJA A;  3CCS A;  2F4V L;  5J1Z A;  3VR3 A;  3H3V I;  3BZD B;  4JYA L;  1PTO C;  3SK5 A;  3K6O A;  1JOR A;  3KJP A;  1SMX A;  2H5X A;  2DUD A;  7WGA A;  1PZK D;  2AWN A;  2KKM A;  4AYB E;  3U9S A;  1YNJ D;  3QIA A;  1PTO B;  2L15 A;  3RN2 A;  1CT4 I;  4CKC A;  4GS3 A;  5LMN W;  1E3P A;  4OWW B;  1OO9 B;  1IHZ A;  2EY1 A;  5IT9 L;  1L2F A;  2K5H A;  3NK9 A;  1IY6 A;  2K28 A;  3E9I A;  1TBQ R;  1EYG A;  3JSB A;  2BL8 A;  1TU2 B;  5CGK A;  1OXT A;  2SNS A;  1TUR A;  2GKT I;  4YY3 L;  3A7L A;  1VQO A;  2NU2 I;  1ICW A;  4H0L C;  1X6O A;  1X3Q A;  4RGN A;  2HIV A;  2Z6K C;  1I4X A;  2OVO A;  2IX0 A;  3J81 L;  5T1G A;  2A19 A;  2IY5 B;  1SLJ A;  1STA A;  3QOL A;  4Z9C B;  3GTP B;  4N9T A;  5J22 A;  4C3J B;  3K57 A;  1E2W A;  3TP7 A;  2AQ3 B;  3KDF B;  4IQZ A;  5FK9 C;  3UDF A;  2VRW B;  1PLF A;  1QB5 D;  4H02 A;  1TQO A;  3D0F A;  1DS3 I;  3J7A V;  4JI5 L;  4KHZ A;  1GM5 A;  1IBM L;  2HDM A;  4UP7 A;  1LLR D;  4PZ6 A;  1XTD A;  4KKT A;  1KRS A;  4DV7 Q;  3VDU A;  4B3S Q;  3RN5 A;  1EU3 A;  4XQQ A;  1B9M A;  2ORW A;  4S3S A;  3H6M A;  1IKM A;  2WIN B;  1Q3L A;  3IKJ A;  5E3Q A;  2O5J C;  4A3B G;  1TBR R;  1YU6 C;  2NVT B;  2VQF L;  3CCJ A;  2EPB A;  4O1P A;  2LKV A;  3SXH A;  1SFO B;  3TOA A;  3HH2 C;  2LY7 A;  3ND8 A;  3NTH A;  1PTQ A;  3RMH A;  3RR5 A;  3GTQ H;  2IJ0 A;  3CXC A;  4XTC S;  1I4H A;  1BBW A;  3VR4 A;  2W0T A;  2YV5 A;  3HZX A;  2N1A B;  1UWV A;  4RFB A;  4IPD A;  2PZU A;  5M5Y B;  4TVA B;  1EY5 A;  1BDO A;  2PI2 E;  1PH3 A;  3H3V H;  2PQA A;  4NXM L;  3Q0A A;  1KIX A;  5IYB G;  1BOS A;  1D1I A;  1HZ9 A;  1SRO A;  1QZG A;  4RWS C;  1IYU A;  4A3D G;  2X52 A;  1K9M C;  4HN7 A;  4ABN A;  2PPB C;  4A3D H;  2A5H A;  4BBR H;  4LUZ A;  3EN2 A;  3VYS A;  4A3E H;  3TRZ A;  4GZY C;  4CKE A;  4P74 A;  3S17 B;  2YU9 B;  4KMU C;  3CPW A;  2FUG 1;  1F9R A;  1PH5 A;  3S2H B;  5C0X H;  3Q6S A;  2K9H A;  3FKI H;  1F2L A;  5JAV A;  3GTL B;  2K7V A;  4G4K A;  2A73 B;  1YHB A;  3SR1 A;  1STE A;  2QW7 A;  4BA2 I;  1GVP A;  2NWG A;  2VZA A;  5IGC A;  4KY6 A;  1AN8 A;  1D6E C;  1IYV A;  2X3T A;  3CRK C;  4DK3 C;  1G6Z A;  1GUN A;  1UUC A;  3DXJ C;  2NVY H;  4IUV A;  5IOC A;  2QA4 A;  2VL6 A;  4M8A A;  2ETD A;  2NTS A;  2HGK A;  4A3D B;  1STN A;  2XVS A;  4NB3 A;  3AFP A;  1PTO D;  3W3A A;  4UXH A;  2CHB D;  1FAR A;  4IO9 A;  4DR2 Q;  3M4O H;  3LWU A;  1EY7 A;  3E0E A;  4JBW A;  3HS0 C;  2G5D A;  2DY7 A;  1BUV T;  4CJ1 B;  2KMP A;  2OTL A;  2RDF A;  1CI3 M;  1VQN A;  3CW2 C;  2ES2 A;  4LF8 Q;  1KRT A;  1H9S B;  4GLX A;  4UXI A;  4DGZ A;  2BA1 A;  2J7Z A;  3CAM A;  1SE8 A;  3F2B A;  2ZJQ A;  2ASB A;  2IW3 A;  3PUX A;  4QUC A;  4RHR A;  2RIJ A;  1CFM A;  4I7Z C;  2B2T C;  2QIL A;  4JI7 L;  2XIW A;  3D6C A;  5JJI A;  1QUQ A;  2PMZ B;  3T16 A;  2X69 A;  4LFB Q;  4R9W A;  3SDZ A;  4I1T A;  4KTA A;  3BJU A;  4A3I G;  2IWH A;  1EWI A;  4C3H G;  4EQ5 A;  2ZRR A;  3LJ1 A;  4AIM A;  5C5L A;  4JI8 L;  3CPF A;  3BYY B;  1PTO F;  3DWA A;  3A7A B;  3LGJ A;  1K0S A;  2E2I B;  1SNC A;  5D14 A;  2LEO A;  1WTP A;  1SGP I;  1H9M A;  2WVJ A;  2B63 G;  5IY0 A;  3S9W A;  2FEF A;  3DA4 A;  2RCF A;  3KF8 B;  2L12 A;  5J39 A;  4LF9 L;  3PV0 A;  3N52 A;  4B3R Q;  4GKJ Q;  4HFV A;  3R5C A;  1NTG A;  3DEO A;  1XMQ L;  1FGB D;  3TSS A;  1OVO A;  1CKM A;  2L1L B;  1G29 1;  1Q82 C;  1M90 C;  3I3C A;  2JBW A;  1O7L A;  3S14 B;  4WRD A;  1K7V A;  1SEB D;  1X32 A;  2D0O A;  3M4Q A;  1PFN A;  2LMC B;  3EA6 A;  1HNX Q;  2ZTE A;  4L5T A;  1XNQ Q;  1VQ5 A;  3HOZ B;  4A3M H;  4FDB A;  4QY7 A;  1HA5 A;  1UVG A;  1FYB A;  2YFB A;  5CCL A;  4I7A A;  1NSN S;  1KAW A;  4JBM A;  3GV3 A;  1Y1C A;  2F3W A;  4GOP C;  4R4I A;  5IOD A;  5IP7 H;  2RAD A;  4OON A;  1YJ9 A;  5I9O A;  5ELF A;  2M00 A;  4RMF A;  3J7A F;  2R93 B;  1CA6 A;  5J3B A;  1LR8 A;  2F0I A;  4BY1 G;  3V96 A;  2E5L Q;  4G7O C;  1IZ6 A;  4CDE C;  1YHA A;  1LTB D;  4A3J B;  4R4T A;  2NU4 I;  2KUM A;  1VQP A;  1XMQ Q;  4U67 3;  2HUG A;  4CBV A;  4RH6 A;  5E7N A;  1ZYR D;  4V0B A;  1TWF H;  3AFQ A;  4ZUJ A;  4E6I A;  4HIK A;  2BE5 C;  5M3F H;  1EWH A;  2RA4 A;  2ATW A;  4IPG A;  2QQE A;  2L11 A;  4HJ7 A;  1ESF A;  1TWG H;  1SNQ A;  2F4I A;  2JW6 A;  4LF4 L;  4HIO A;  3URY A;  2EY2 A;  2BL7 A;  3D4W A;  3KP9 A;  1CZW A;  3PUV A;  4AYB B;  4LFA L;  3PQI A;  1GUS A;  2CWF A;  1DON A;  2YTV A;  2MGS A;  2N3S A;  4HCE A;  4F7X A;  2EYL A;  3F2D A;  4A93 B;  1VQJ A;  2BOS A;  4R1J A;  5F2D A;  1YI2 A;  4IUN A;  2MP1 A;  2WKD A;  2KCT A;  2K05 A;  4DXG A;  2EOT A;  1SFO H;  3I55 A;  1X54 A;  3QB3 A;  4XDX A;  5JJZ A;  3D3R A;  5D65 A;  4HJA A;  1VQL A;  1RFH A;  1UHA A;  2D5D A;  4HR7 B;  4NXM Q;  3F2U A;  1TY0 A;  4DR2 L;  2NN6 G;  4G57 A;  5EKL A;  3UE1 A;  3AEV A;  1H9K A;  4IFD G;  3VYT A;  4OWX B;  5ELN A;  4DAY A;  4OO1 H;  2MPM A;  3H94 A;  3S1N H;  4DF7 A;  1W3S A;  1NMF A;  1EFI D;  3A74 A;  4K5W A;  2LSS A;  4N9P A;  2I5M X;  1ILP A;  2DNE A;  3UIT A;  2F0W A;  1TWH H;  2QGQ A;  1EUJ A;  4NDX A;  4DNC A;  1LTT D;  2EYP A;  1HZA A;  5GAH C;  2C5C A;  5K36 G;  3Q23 A;  4LF7 Q;  1S5F D;  4GLV B;  1TUS A;  4WOR A;  4JVZ A;  2EIF A;  2MFI A;  3RZD H;  3TO7 A;  3E0J A;  1TS5 A;  2BCO A;  4OXP A;  1GUO A;  1L1O A;  3NBH A;  1UAP A;  2NN6 H;  2CW0 D;  1I4G A;  4QL5 A;  4BS9 A;  3NTK A;  2C9O A;  3HKZ E;  2EVB A;  3MEK A;  1L1O C;  3AMU A;  3CC2 A;  3KFU A;  3E2I A;  3OTO Q;  2L4N A;  4KLK A;  1BUS A;  2RSO A;  1WVL A;  2XRQ D;  4DV2 L;  4IOC A;  1ZKO A;  1IW7 C;  4Y7N H;  4A93 G;  4JI5 Q;  1JMC A;  2F0V A;  2DY8 A;  2OCE A;  1JWM D;  1TS4 A;  1CUK A;  2UXC Q;  1PHJ A;  1SGQ I;  5G3L D;  1SN8 A;  4GKK Q;  3MEH A;  3NTI A;  5HGT A;  3GTQ B;  1KQS A;  3RLO A;  3HOZ H;  4XYQ A;  1LR9 A;  1EOV A;  1SRU A;  1YIT A;  1DJR D;  4WJ3 M;  2KCM A;  5I2Y A;  2D62 A;  4JI1 L;  2Q2I A;  3A55 A;  2JSO A;  3MFG A;  1N13 A;  3K5L A;  5IE8 A;  2SGP I;  1KC8 C;  1JB3 A;  5FO8 B;  1UEA B;  1HFN A;  2WAQ E;  2CWG A;  1QWY A;  2A6E D;  4YHH L;  2NTT A;  4JI0 L;  2XSC A;  1D5M C;  1NAP A;  4WP4 A;  3H91 A;  4A24 A;  1UE7 A;  4ZKC B;  2QF7 A;  3CQZ B;  3NHH A;  2F03 A;  3OW7 A;  2G9D A;  4DV5 L;  3J80 i;  5EPJ A;  3A8K E;  5KNC A;  2BUS A;  1KAB A;  1A0I A;  1XNR L;  1A3U A;  1HUM A;  1PZJ D;  2RCN A;  4XYO A;  1TOT A;  1CGI I;  1YBY A;  3G48 A;  1SNM A;  3VA5 A;  2R7Z H;  4X66 L;  1SAP A;  4HJ9 A;  3MA2 B;  4IZ8 A;  4J15 A;  1I50 H;  1D8L A;  2JK8 A;  3R3O A;  1ASZ A;  3LJ2 A;  5LMU Q;  3EVQ A;  1JQY D;  2UXB L;  5ELC A;  2KVM A;  3CKI B;  4OWT B;  2Y0M A;  1DD2 A;  2EJG C;  4P2C B;  3DM3 A;  4YZC A;  1OMT A;  1N32 L;  3W1G A;  4AQY L;  5C44 B;  2JEA I;  1FL0 A;  1JB7 A;  3M85 A;  4C2M H;  1BBU A;  3H0G H;  1YNN C;  1XXG A;  1B2T A;  5DAU A;  1DZ1 A;  3M4Y A;  1HH2 P;  2QGM A;  3IFD A;  3HGB A;  4DN4 M;  2A68 C;  4G7H C;  3TZU A;  2X6L A;  2ZXO A;  1MJC A;  3M9B A;  4BBS H;  1YNN D;  1NJI C;  4BY7 G;  1O7Y A;  3O13 A;  4DAV A;  2RQX A;  3J81 E;  1RTO A;  5D3I B;  2HCC A;  4PMC A;  1HUN A;  4X3K A;  2QCP X;  2UUB Q;  3PO3 G;  5CMD A;  3IAM 1;  4O42 A;  2JJQ A;  2JEB I;  3NEL A;  1SGR I;  2OD1 A;  4POF A;  4L5S A;  2JA8 G;  3HOU B;  1QG7 A;  1N32 Q;  2XGT A;  3IFT A;  1CHP D;  1TWH B;  2K5Q A;  2MO1 A;  1SMY D;  1V1Q A;  1Y1W G;  4IOA A;  3STB C;  1Y1V G;  4PMW A;  2FIN B;  2FMC A;  3A56 A;  1SJH D;  1HZC A;  2PMZ E;  3BJI A;  3K7A H;  1IBL Q;  1TY2 A;  4O1O A;  2L9H A;  2M2L A;  3S1M H;  5E3F A;  3HKZ G;  1NMG A;  2MQH A;  5LMU L;  4Y52 H;  5C0X G;  2KHS A;  1TBN A;  4BY1 B;  3SGQ I;  2WV6 D;  2F0L A;  5C0X J;  1QE6 A;  1ENA A;  1RDP D;  4L6T B;  4A3E G;  1IL2 A;  3OPO A;  1QOH A;  3RLN A;  2R7Z B;  2JA5 H;  4OGQ C;  4QMG A;  1FJG L;  4DR3 L;  2O4X A;  3JC6 6;  1NUB A;  1CSQ A;  4C3J H;  1YHQ A;  3QAH A;  2F0N A;  2UUC L;  4OEL B;  2QKI C;  3OMC A;  4K8I A;  2JB3 A;  2HD3 A;  1I3Q H;  4PQX A;  4LFC Q;  1U4R A;  1VQC A;  4QIW B;  2IT1 A;  1C4Q A;  5EX3 A;  4A4I A;  2K6A A;  1T5X D;  1ET6 A;  4LF6 Q;  2JE6 I;  3NPP A;  4WFN 3;  1VCI A;  1P9G A;  2EY5 A;  4L8J A;  2PYK A;  1VDZ A;  1J6Q A;  3GO5 A;  1PZI D;  4A3B H;  3R5D A;  2FMM A;  4CDC C;  4WJW A;  1VF5 C;  4HAE A;  4LW1 A;  4LF6 L;  1U4P A;  2N17 A;  4DPG A;  4F87 A;  2ELI A;  1V1P A;  5IWA Q;  2VQE L;  1UVF A;  1M4V A;  3KF8 A;  1PH4 A;  1FY7 A;  3CCV A;  2L7X A;  2UXC L;  2P5Z X;  3QO2 A;  2VUM B;  2ZXP A;  2CKZ B;  2V6E A;  4HEA 1;  4PL3 A;  4C2M B;  1SJ8 A;  1PXU A;  3KBG A;  4N8X 1;  5DAE A;  4RGM A;  2PZT A;  3GTJ H;  4BXX G;  1DOM A;  3OTO L;  4NKL A;  2WKC A;  4DK1 A;  2RVL A;  2K50 A;  3RZO H;  1W2B A;  4FNF A;  3TME A;  1JT8 A;  2E73 A;  4O2D A;  3WOE A;  3KF6 B;  1GUT A;  2OXP A;  1SYF A;  1JIC A;  3VDP A;  1B9N A;  1OXX K;  2B2U C;  1CQF A;  3OW2 A;  1Q81 C;  1Q90 A;  3P20 A;  2K04 A;  2NZH A;  5ELE A;  3I2Z A;  2YTX A;  3MZ5 A;  3B6Y A;  2YTY A;  4WJ4 A;  3NBH B;  1WI5 A;  3PCO B;  3IAY A;  4DAM A;  2SGF I;  1LTR D;  4DNR B;  1N34 L;  1PRT B;  5CV7 A;  2XWJ B;  1KL9 A;  2K33 A;  1HQR D;  4CDF C;  2KBN A;  4B9W A;  4FF3 A;  1D7Q A;  3S2D B;  1G2T A;  1EY6 A;  4KKU A;  2F0U A;  4XT1 B;  5FKA C;  2Z9H A;  2Z6B A;  2BH8 A;  4R8I A;  2WAC A;  2RHQ B;  3C3L A;  2K03 A;  4KHV A;  2B8T A;  2TSS A;  3I9V 1;  5IGE A;  1EIH A;  2ARP F;  5CV5 A;  3U9O A;  3C1F A;  4X65 L;  4GNX B;  4LF5 L;  1KMA A;  1TR5 A;  5BR8 Q;  3Q24 A;  3R5B A;  1NY4 A;  3DUZ A;  4FF1 A;  1EY8 A;  3LJ0 A;  1MJE A;  3EIV A;  4DAP A;  1Y1B A;  1U4L A;  4FO2 A;  1J9O A;  1E24 A;  2KHI A;  3NP8 A;  4UP9 A;  1K8A C;  2K32 A;  4RA8 A;  3CME A;  3S1M B;  4DUY Q;  1FGU A;  5IP9 G;  3K81 C;  2JYO A;  2Z6K A;  2N78 A;  1PFS A;  1CT0 I;  1SGN I;  3K7A B;  5E3R A;  3N6R A;  1EIY B;  2HIX A;  1GKH A;  1F9P A;  1TWG B;  4JC0 A;  4K14 A;  2ZT9 C;  3GTO B;  2QEX A;  2FHT A;  2KJX A;  3R2T A;  4JI4 L;  4A3M B;  2NVQ H;  1FNU A;  4JI6 L;  4C3J G;  3GTK B;  4NXN L;  3P75 A;  1DYQ A;  4RG1 A;  4JCV E;  4P75 A;  2B63 B;  1BVS A;  2CWP A;  1WTH A;  1K28 A;  4RAU C;  3E59 A;  1MBY A;  4JBJ A;  1DOL A;  1S5B D;  1BR9 A;  2B2W A;  2RIO A;  1RIP A;  1KNE A;  4JW0 A;  3FVV A;  5EQ0 A;  1M8C A;  3PDN A;  4XQJ A;  2IHF A;  1KD1 C;  5JEA G;  4JI6 Q;  5L37 A;  2ZM6 Q;  4IFD I;  4K6L A;  1PRT C;  2IPK D;  1H9J A;  1ROD A;  1F9Q A;  3L3O C;  5JEA J;  2RDH A;  4KHP L;  4FF2 A;  4K5X A;  1BNZ A;  4G76 A;  3D8G A;  1BQQ T;  1LT4 D;  3MXP A;  5DLQ E;  4C3H B;  2Y0S E;  4LFA Q;  4YZ9 A;  3PUW A;  1WD0 A;  4QIW E;  2GA4 B;  4UPA A;  3HOY G;  1A6X A;  4GN3 B;  2XTQ A;  4A3C G;  5E1F A;  4JI2 Q;  1WTW A;  1L0W A;  3PO3 B;  1U4M A;  1MT1 A;  5A2Q L;  4JG2 A;  2DB6 A;  1ENC A;  3TOB A;  1CSP A;  3HOU G;  2J9R A;  1S20 A;  2KMR A;  2GSC A;  4EQN A;  2K1B A;  5IT9 c;  2L8E A;  1ICF B;  1WCM G;  3L7Z C;  1VQ9 A;  2E2H B;  2NUC A;  1EYD A;  1YZ6 A;  1Y1W B;  2B0U C;  5BN4 A;  1F2M A;  4L63 B;  1VQB A;  1ULN A;  1SE2 A;  3FRP B;  3TDQ A;  4JI7 Q;  3ONA B;  1FD7 D;  3A5Z B;  1LTI D;  2E76 C;  4L9M A; 
#chains in the Genus database with same CATH homology
 2CJS C;  1UE6 A;  1WYD A;  1V9P A;  2I5M X;  2UUC Q;  3HOW H;  3UIT A;  4DR6 L;  1TWH H;  2QGQ A;  3TRE A;  2ODD A;  1FAQ A;  5EAY A;  1EUJ A;  4HID A;  4A93 H;  2K5N A;  1HZA A;  3K7U C;  4OO1 I;  5GAH C;  1S3O A;  1HNZ Q;  5K36 G;  4LF7 Q;  4GLV B;  1XNQ L;  1VQI A;  1R79 A;  2E5R A;  1LUZ A;  1YIJ A;  1X9N A;  4YZD A;  2C35 B;  1I94 L;  1VQA A;  4B3R L;  4MZ9 A;  2EIF A;  4GKJ L;  1TUS A;  1X4S A;  1N9W A;  3W1B A;  4JV5 L;  2MFI A;  4DNI A;  5IYC G;  3OXL A;  4DR5 L;  2JB1 A;  1QVF A;  1VQK A;  3S2H H;  3RZD H;  4DR4 Q;  3IRB A;  3CCR A;  2I0Q A;  2AMC B;  2MJF B;  1HNW Q;  4OXP A;  2UU9 Q;  1XPU A;  1JE5 A;  2VUM H;  4X6A H;  5AJ3 Q;  1SGY I;  2VW9 A;  1X3E A;  2MO0 A;  1E1T A;  3H15 A;  4DR6 Q;  1L1O A;  4DV6 L;  4GI3 C;  1KBF A;  4JI8 Q;  3M4P A;  4LUV A;  1PH6 A;  5M5X H;  3VDY A;  1Q8K A;  1IYJ B;  1U0L A;  3EBE A;  4QL5 A;  4A3F G;  4G75 A;  2UXB Q;  2N71 A;  2SGP I;  1AN1 I;  4JV5 Q;  5FUW A;  3HKZ E;  3SDJ A;  5IYC H;  1L1O C;  3MEK A;  3UGI A;  2JA7 G;  3CC2 A;  1N36 Q;  3SEK C;  2PQA B;  2AKW B;  2JB2 A;  1Q1B A;  4JI3 L;  3KFU A;  3E2I A;  4KHP Q;  3OTO Q;  3GDE A;  1JJ2 A;  4KLK A;  2IP6 A;  4C3I H;  1BUS A;  4GOP B;  4DV2 L;  4IOC A;  4Y7N H;  2HHH L;  2Y0S G;  2UUA L;  1YJW A;  1PYS B;  2ZTC A;  1JMC A;  4JI5 Q;  4A93 G;  1PTR A;  1R0R I;  1KHI A;  4PL4 A;  4A3C H;  2OCE A;  2KMQ A;  1E7Z A;  2UUB L;  1Y8F A;  1CUK A;  2K14 A;  4AH6 A;  3PF5 A;  1QZH A;  1JJC B;  4K0K L;  2UXC Q;  1TWA H;  1PHJ A;  1SGQ I;  3IAS 1;  1SN8 A;  3I7F A;  3HFZ B;  4IPH A;  4GKK Q;  1NBW A;  2VNU D;  1SR3 A;  4O0A A;  4DV6 Q;  4JI0 Q;  1PA6 A;  1V43 A;  3ZJY C;  4LWC A;  5CCM A;  3FBV A;  2KMO A;  3OXF A;  1KQS A;  1YEZ A;  3RLO A;  4YY3 Q;  4TQU S;  3HOZ H;  3WWV A;  2BA0 A;  4IPC A;  1HNW L;  1XX6 A;  2ENZ A;  2N52 A;  2SGE I;  3UEY A;  1LR9 A;  2E2I H;  2JA6 G;  1EOV A;  1SRU A;  1K0R A;  3FP9 A;  1YIT A;  4WJ3 M;  1H95 A;  1TBO A;  5LNK 1;  4R4Q A;  4L5R C;  2KCM A;  3KJO A;  2YQP A;  2D62 A;  4JI1 L;  3KYH C;  2Q2I A;  3CCQ A;  2OWO A;  5HI7 A;  4PG3 A;  1W4R A;  1AE2 A;  1N13 A;  5FUX A;  3PUY A;  3TJQ A;  2P22 B;  5IE8 A;  1WCM H;  1K73 C;  2JA6 H;  1CKN A;  4YWM A;  4YHH Q;  1KC8 C;  1CKN B;  3BZK A;  1OMU A;  3F8T A;  1S40 A;  4B3M Q;  2E2J H;  2QPO A;  1E22 A;  5M3M H;  2WAQ E;  1PV4 A;  1TGS I;  4YWL A;  4YHH L;  4JI0 L;  1C7Y A;  1IBK L;  3MXN B;  1J5E L;  3M3Y H;  4DR3 Q;  2A8V A;  4YWK A;  2NU3 I;  4E1P A;  1YNX A;  1LR7 A;  3L2P A;  1HZB A;  2D0P A;  3UDG A;  4GNX A;  4A24 A;  1UE7 A;  2WB1 E;  3KLW A;  4DK6 C;  1CSO I;  1TWC H;  3ER0 A;  2JA1 A;  5FLM G;  1FVI A;  3GTG H;  4DV5 L;  3K8A A;  1TIH A;  5HQ8 A;  1RL2 A;  3J80 i;  2BUS A;  3B4V C;  2F3C I;  2Q2U A;  1BMO A;  2XRC A;  2Z0S A;  3F2C A;  1PYB A;  4DV5 Q;  1A0I A;  3T1H Q;  1XNR L;  2A2C A;  1VQ8 A;  2RCN A;  3KF6 A;  3KOJ A;  2KEN A;  5C3E G;  5C4J H;  3RNU A;  4POG A;  2JA7 H;  3J81 j;  4JI2 L;  1YBY A;  3G48 A;  3CF5 A;  1CGI I;  1I5F A;  3BU2 A;  5IWA L;  1PVO A;  3RU0 A;  5M3F G;  1E1O A;  1XPO A;  5BR8 L;  2R7Z H;  1T9H A;  4DV7 L;  5IP9 H;  4X66 L;  1O7I A;  1V1H A;  1IBK Q;  2JYY A;  2JZM A;  5FUY A;  4A76 A;  1MKH A;  1LTL A;  2B3G A;  5C0X I;  2RHS B;  4HJ9 A;  2NVX H;  1PH7 A;  4PZ7 A;  5LMN L;  3FHW A;  3S2D H;  4J15 A;  1I50 H;  4YCU A;  1D8L A;  2JK8 A;  4BA1 I;  4DV4 Q;  3DA3 A;  4HJ5 A;  1HR0 L;  4JI3 Q;  2VUM G;  4X62 Q;  1ASZ A;  4A3G H;  2CCZ A;  1HR0 W;  4OAV B;  3LJ2 A;  5LMU Q;  1GD7 A;  4IJL A;  4A3K H;  2XTR A;  2UXB L;  4GN5 A;  4UXJ A;  4JOI C;  2ZTD A;  3PO2 G;  2SGQ I;  2OQK A;  1VQH A;  4OWT B;  3HOU H;  2V53 A;  3DM3 A;  4YZC A;  3K80 C;  1OMT A;  3J81 i;  1Q1E A;  3CCL A;  3W1G A;  1N32 L;  2WCY A;  1PJU A;  3AYH B;  4AQY L;  2BH2 A;  4DV4 L;  2JEA I;  1FL0 A;  3GTL H;  2ALY B;  1JB7 A;  2ERW A;  2EQS A;  4GLA C;  4UP8 A;  3HOV G;  1Y14 B;  3M85 A;  2UU9 L;  2F66 B;  1BBU A;  4C2M H;  3SGB I;  1XMO L;  4X66 Q;  3HOY H;  2R92 H;  3GTP H;  1K83 H;  3CCS A;  1B8A A;  1IXR A;  2NZO A;  3H0G H;  1VQM A;  2F4V L;  3H3V I;  3HOW G;  4JYA L;  2QQ0 A;  1OYV I;  3T1Y Q;  3BZC A;  4U6R A;  3KJP A;  1SMX A;  2H5X A;  1N33 Q;  2DUD A;  3DLL A;  1XBT A;  2AWN A;  2KKM A;  1HH2 P;  4AYB E;  2JXD A;  2K52 A;  2XMX A;  1C9O A;  2L15 A;  2PI2 A;  3RN2 A;  1CT4 I;  2NU0 I;  3ULP A;  1MJC A;  3M9B A;  4NV2 A;  4DR5 Q;  4GS3 A;  1NJI C;  4BBS H;  4BY7 G;  3G4S A;  1LYL A;  5LMN W;  1E3P A;  1U5K A;  4A3J H;  4OWW B;  4OO1 G;  3SGI A;  1UEB A;  1L2F A;  2K5H A;  1PH8 A;  1IY6 A;  3T1Y L;  4R4O A;  2DGY A;  4GOP A;  2UUB Q;  1N33 L;  1JJG A;  3PO3 G;  1CGJ I;  3S1Q H;  3IAM 1;  3E9I A;  1TBQ R;  1EYG A;  3JSB A;  3A5U A;  2JJQ A;  3I4N G;  2JEB I;  3NEL A;  2EXD A;  1XJV A;  1SGR I;  2OD1 A;  4POF A;  4L5S A;  2JA8 G;  1OXT A;  5C44 G;  3TEH B;  2XGT A;  2R7F A;  2YFA A;  1N32 Q;  1VQG A;  1TOT A;  1TUR A;  2GKT I;  1H0Z A;  2YU9 H;  2F3I A;  4PL5 A;  1B70 B;  4YY3 L;  5HY6 A;  1VQO A;  2NU2 I;  1WFQ A;  1G51 A;  1X6O A;  4DWL A;  2MO1 A;  4MTN A;  1V1Q A;  3PUZ A;  2ZJP A;  4HIM A;  5C4X H;  2E8G A;  2HIV A;  1MIU A;  1Y1W G;  2VY3 A;  2Z6K C;  4IOA A;  2UXD L;  3STB C;  1Y1V G;  5FJ8 H;  2OVO A;  2B29 A;  2IX0 A;  4PMW A;  1QVC A;  1TXY A;  2A19 A;  2WB1 G;  4YCW A;  1CKO A;  1SLJ A;  2WFW A;  2IY5 B;  2VQE Q;  1EQQ A;  1HZC A;  2PMZ E;  1KBE A;  3BJI A;  1X65 A;  3K7A H;  4YCV A;  4DV2 Q;  1IBM Q;  3NEM A;  3KDF B;  3Q8D A;  1IBL Q;  4O1O A;  3UDF A;  3S1M H;  3AQQ A;  2VRW B;  5FUV A;  4H02 A;  3HKZ G;  3D0F A;  1DS3 I;  3J7A 5;  1NMG A;  3MEF A;  2MQH A;  4B3T Q;  2AHO B;  4A3L H;  5LMU L;  4Y52 H;  3P23 A;  5C0X G;  4JI5 L;  4KHZ A;  1GM5 A;  2VS1 A;  4DUZ Q;  4PZ8 A;  1TBN A;  1IBM L;  3DO9 A;  2KCX A;  4SGB I;  3SGQ I;  4UP7 A;  1K8G A;  4PZ6 A;  5C0X J;  4BY1 H;  1XTD A;  2ROW A;  2HQL A;  1KRS A;  3W5O A;  4DV7 Q;  2DIP A;  1QUQ B;  5JJK A;  4A3E G;  1IL2 A;  3VDU A;  2LUY A;  4B3S Q;  3RLN A;  3RN5 A;  3HOX H;  2JA5 H;  3L0I A;  3D31 A;  2FNF X;  2ORW A;  2NU1 I;  1NE3 A;  1IBL L;  1FJG L;  4DR3 L;  5IP7 G;  4KI0 A;  4HJ8 A;  4LFB L;  2VQF Q;  2GN5 A;  5ELO A;  3ULL A;  5IYD H;  3JC6 6;  1VS0 A;  3G71 A;  1CSQ A;  3CP0 A;  2Q2T A;  2IX1 A;  4A3B G;  1NUB A;  4C3J H;  1Q46 A;  2VQF L;  1YHQ A;  3CCJ A;  4IFD J;  2UUC L;  4P72 A;  2RF4 A;  4O1P A;  4C3H H;  4A3M G;  3QTL D;  2JB3 A;  3PGZ A;  1AE3 A;  1I3Q H;  4LFC Q;  3J81 c;  3GTM H;  2GVI A;  4DR7 Q;  4HGU A;  3HH2 C;  4B3M L;  1VQC A;  1PTQ A;  3RR5 A;  2IT1 A;  3GTQ H;  4E1R A;  3CXC A;  4A4I A;  4XTC S;  5EX3 A;  1BBW A;  4LF6 Q;  2W0T A;  2GVA A;  2YV5 A;  2JE6 I;  1UWV A;  4P71 A;  3U58 A;  2R93 G;  2N1A B;  4IPD A;  2WP8 J;  4TVA B;  3A0J A;  1VCI A;  5GRO A;  1FJG Q;  1CT2 I;  1VQ6 A;  1WOC A;  2PI2 E;  3G6E A;  1PH3 A;  3H3V H;  1J6Q A;  1X3F A;  1YVC A;  2PQA A;  3GO5 A;  3UE0 A;  4NXM L;  2YYZ A;  4ALP A;  1KIX A;  5IYB G;  2F4V Q;  3UDX A;  2OTJ A;  4A3B H;  3D00 A;  2B63 H;  1PH1 A;  4LW1 A;  4LF6 L;  1HZ9 A;  4GN4 B;  1SRO A;  3CCE A;  1QZG A;  1KXL A;  3UGL A;  4JI4 Q;  4NV5 A;  4A3D G;  2N17 A;  4DPG A;  2I5L X;  3OVO A;  1HR0 Q;  2ELI A;  2LXK A;  1K9M C;  3STB D;  3VA9 A;  1Q12 A;  5IWA Q;  2VQE L;  4A3D H;  1UVF A;  3TS0 A;  1EQR A;  1X56 A;  3EN2 A;  4LUZ A;  4BBR H;  1PH4 A;  1PH9 A;  4JI1 Q;  4A3E H;  3TRZ A;  2V1C A;  3CCV A;  3GTO H;  2L7X A;  1A8V A;  3AJF A;  4P74 A;  2UXC L;  3OXG A;  1XMO Q;  3S14 H;  3CPW A;  2FUG 1;  1HNZ L;  3ICE A;  2CKZ B;  2V1C C;  4X62 L;  4A3I H;  2V6E A;  4P73 A;  4HEA 1;  1PH5 A;  5C4X G;  4PL3 A;  1SJ8 A;  4AQY Q;  3UGD A;  2K9H A;  3FKI H;  1N36 L;  1EFW A;  5DAE A;  3GTJ H;  2E5L L;  4BXX G;  2UXD Q;  3OTO L;  1YHB A;  2JQO A;  4NPS A;  2K50 A;  3I4O A;  3RZO H;  4BA2 I;  2ZJR A;  1GVP A;  2VZA A;  4DR4 L;  4GKK L;  4OVO A;  4LUO A;  1VQD A;  1W2B A;  3PF4 A;  1JT8 A;  1L1O B;  4O2D A;  5M5Y H;  2E73 A;  1DGS A;  3KF6 B;  5GAE C;  4BXX H;  2J87 A;  4DK3 C;  2QQC A;  2GKR I;  1UUC A;  1UE5 A;  1Q7Y C;  2NVY H;  3JAM i;  1PH2 A;  1M8B A;  2QA4 A;  4DUZ L;  4MNO A;  2VL6 A;  2XTI A;  3U4Z A;  2SGD I;  4NXN Q;  3I4M H;  1CE3 A;  1VQF A;  3OYY A;  3AFP A;  4NB3 A;  5FJ8 G;  4DV0 L;  3TS2 A;  5IYD G;  4FKD A;  3VDP A;  1A63 A;  2ZM6 L;  2OQ0 A;  1HNX L;  4DV1 Q;  1FAR A;  2ORV A;  4UXH A;  4IO9 A;  1OXX K;  2NVT H;  4DR2 Q;  3M4O H;  4JBW A;  3E0E A;  1VQ7 A;  2MNA A;  1OXU A;  3OW2 A;  1EIF A;  3HOX G;  3KDF A;  3T1H L;  3K0X A;  1Q81 C;  2KMP A;  2K75 A;  5C44 H;  2OTL A;  1VQN A;  2NZH A;  3S24 A;  3CW2 C;  2AWO A;  3I2Z A;  2IHE A;  1KRT A;  2YTX A;  2ES2 A;  1BKB A;  3B6Y A;  4LF8 Q;  4OX9 Q;  3CXL A;  2YTY A;  4Z7H A;  5IYB H;  4A75 A;  4GLX A;  3I4N H;  3I4M G;  3NBH B;  4WJ4 A;  4UXI A;  1WI5 A;  3PCO B;  3GOX A;  4DAM A;  2BA1 A;  2SGF I;  4GXT A;  3CAM A;  5GAD C;  1SE8 A;  4ME3 A;  1N34 L;  1KL9 A;  3J80 c;  3HKS A;  3F2B A;  2ZJQ A;  4LF9 Q;  2ASB A;  2KBN A;  2HT1 A;  3PUX A;  1J5E Q;  2Q2H A;  1D7Q A;  2P6A C;  3TQY A;  5H1S E;  2M5X A;  2N8N A;  4JI7 L;  5GQO A;  2GKV A;  4DV1 L;  5JJI A;  3PIO A;  1QUQ A;  1Z7K B;  1P8L A;  4UY8 C;  4IJH A;  4LFB Q;  3FKI G;  3UEJ A;  4I1T A;  3OL0 A;  3BJU A;  2R6G A;  4A3I G;  1EWI A;  2BH8 A;  2JAE A;  4EQ5 A;  2ZRR A;  2R92 G;  4AS3 A;  3LJ1 A;  2RHQ B;  4AIM A;  3PSI A;  3RLF A;  4JI8 L;  2B8T A;  3CPF A;  3QWP A;  3I9V 1;  1Y1W H;  3F4M A;  1OXS C;  2CFM A;  3UDI A;  1HJP A;  1WJJ A;  3LGJ A;  4AYB G;  2K4K A;  4BBR G;  2E2H H;  4LNQ A;  3L0O A;  3CC4 A;  2ARP F;  4X65 L;  4LF5 L;  4GNX B;  2GVB A;  3CQZ H;  1K3R A;  4R4C A;  2LEO A;  4XIG S;  5BR8 Q;  3KY9 A;  1KMA A;  4OAU C;  1NY4 A;  4L5Q A;  4DUY L;  2JA5 G;  3PIP A;  1VQ4 A;  1SGE I;  1SGP I;  3FC3 A;  3LJ0 A;  2ID0 A;  1MJE A;  2WVJ A;  3PO2 H;  3EIV A;  2B63 G;  5IY0 A;  4QQB X;  2KHJ A;  1IW4 A;  1OXV A;  4DR7 L;  4AS2 A;  3S16 H;  1DS2 I;  1Y1B A;  3DA4 A;  4LF9 L;  3KF8 B;  4Z7G A;  3PO3 H;  2KHI A;  1E24 A;  2NN6 I;  3PV0 A;  5AJ3 L;  4A3G G;  4UP9 A;  1K8A C;  1Q86 C;  4B3R Q;  1OTC A;  2CQO A;  1XNR Q;  4GKJ Q;  1CHO I;  1N8R C;  4HFV A;  2CWA A;  4JOI A;  5LMN Q;  3CME A;  3CD6 A;  1NTG A;  4DUY Q;  1FGU A;  4A3J G;  5IP9 G;  3K81 C;  1YO7 A;  1XMQ L;  2Z6K A;  2R93 H;  2N78 A;  1PFS A;  1CT0 I;  1I6H H;  4GNX C;  1SGN I;  1OVO A;  1CKM A;  2L1L B;  1EIY B;  5EX0 A;  1G29 1;  1Q82 C;  2HIX A;  1M90 C;  1GKH A;  5C3E H;  3GD7 A;  3S1R H;  1VDD A;  4JC0 A;  5GAG C;  2PNH A;  1PPF I;  2JA9 A;  2D0O A;  3M4Q A;  3E9H A;  1IY5 A;  2QEX A;  2ZTE A;  1HNX Q;  4L5T A;  1XNQ Q;  1VQ5 A;  3GTK H;  5JJL A;  4A3M H;  3H0G G;  2F6M B;  4FDB A;  4QY7 A;  4JI4 L;  2NVQ H;  2WAQ G;  4JI6 L;  1UVG A;  3NEN A;  1FYB A;  4NXN L;  1HJA I;  2YFB A;  1Y1V H;  1LM0 A;  4JBM A;  1KAW A;  1Y1C A;  5CCL A;  4RG1 A;  2FXQ A;  3CCU A;  4GOP C;  4JCV E;  1QVG A;  3UFF A;  4X64 Q;  4R4I A;  4LF8 L;  1GO3 E;  4EX5 A;  5IP7 H;  4P75 A;  5JHW C;  2CAZ B;  4DV3 L;  1BVS A;  2CWP A;  4OON A;  1YJN A;  1YTP A;  1YJ9 A;  4B3T L;  4X64 L;  1SGD I;  3E59 A;  1LR8 A;  4JBJ A;  4RMF A;  1TBR R;  1YU6 C;  2RIO A;  1RIP A;  1M8C A;  5M3M G;  4DV3 Q;  3S15 H;  3PDN A;  1N34 Q;  2JA8 H;  2IHF A;  1KD1 C;  1M1K C;  5J3B A;  5JEA G;  4JI6 Q;  2A2D A;  3ERS X;  4DKA C;  2ZM6 Q;  4BY1 G;  2E5L Q;  1PCE A;  1S72 A;  2QQD A;  1G6P A;  1IZ6 A;  3ULJ A;  2A1A A;  4APV A;  1YHA A;  3U4V A;  4IFD I;  4R4T A;  2NU4 I;  1VQP A;  1XMQ Q;  3S17 H;  5JEA J;  3M7N A;  5E7N A;  4KHP L;  4K0K Q;  1P16 A;  1XA6 A;  2ENN A;  1HDL A;  4B3S L;  1AH9 A;  4A3L G;  1TWF H;  2N49 A;  3AFQ A;  3JAM c;  5HGI A;  2R7D A;  3U50 C;  2R7Z G;  4HIK A;  5M3F H;  2HHH Q;  2UUA Q;  4BY7 H;  4BBS G;  4G76 A;  2ATW A;  3F1Z A;  4IPG A;  1V1I A;  2K19 A;  4QJF A;  5DLQ E;  4HJ7 A;  2QQE A;  1TWG H;  2A20 A;  2F52 A;  2Y0S E;  4LF4 L;  4LFA Q;  1VQE A;  4HIO A;  1XPR A;  2JW6 A;  2YUU A;  4YZ9 A;  3PUW A;  3KP9 A;  4QIW E;  3CCM A;  3PUV A;  4LFA L;  4UPA A;  2I5H A;  4X65 Q;  4LF5 Q;  1C0A A;  2UZ3 A;  2K5V A;  4DR1 Q;  2YTV A;  3HOY G;  5FLM H;  4GN3 B;  2N3S A;  2XTQ A;  4B6D A;  4A3C G;  4JI2 Q;  1ASY A;  1B7Y B;  3HOV H;  1Z47 A;  1L0W A;  1Z9F A;  3F2D A;  1MT1 A;  5M5W H;  1VQJ A;  4R1J A;  1YI2 A;  1R9T H;  4LF4 Q;  4JG2 A;  2DB6 A;  1CSP A;  1HPT A;  3HOU G;  2KCT A;  2J9R A;  2KMR A;  1A62 A;  1UE1 A;  4JBK A;  4Q9V A;  3I55 A;  1X54 A;  4HJA A;  1SFO H;  1RFH A;  3CMA A;  1VQL A;  5IT9 c;  1I94 Q;  4A3K G;  1WCM G;  3L7Z C;  2L8E A;  4NXM Q;  4A3F H;  1VQ9 A;  1X74 A;  4DR2 L;  1X3G A;  2NN6 G;  3AEV A;  3UE1 A;  1YZ6 A;  2B0U C;  4IFD G;  3VE5 A;  3I56 A;  4LF7 L;  4DAY B;  4OWX B;  5ELN A;  4DV0 Q;  3CC7 A;  5HGQ A;  1VQB A;  1X55 A;  3S1N H;  2LXJ A;  4OX9 L;  1W3S A;  1NMF A;  3A74 A;  4JI7 Q;  3HOZ G;  4LFC L;  3A5Z B;  2LSS A;  5FLX c;  3J7Z C;  4L9M A;  4DR1 L;  4JYA Q;  4QGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...