1W3SA

The crystal structure of reco from deinococcus radiodurans.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
230
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna repair
molecule keywords HYPOTHETICAL PROTEIN DR0819
publication title Crystal Structure and DNA-Binding Analysis of Reco from Deinococcus Radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 53
structure length 230
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1w3sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1w3sA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1w3sA03
4C2MH 1TWHH 2RCNA 4JV5L 1FJGQ 2JA8H 2D0OA 1W2BA 2KENA 3UE1A 2PI2A 4RG1A 4C3HH 3F1ZA 2YYZA 5GAGC 2VNUD 5M5WH 3S1QH 1V1QA 5FLXc 4GKJL 4OXPA 2HHHQ 5C4XG 3U4VA 1VQNA 1H95A 4DUZQ 3BZCA 1E1OA 1QVCA 2NVTH 4HIOA 3WWVA 2Q2TA 4JBMA 4LNQA 4AYBE 4DV4Q 1IL2A 3GTOH 3H3VI 4HJ8A 1Q82C 2UXCQ 5K36G 4LUOA 1IZ6A 3NEMA 1R9TH 3D31A 3CMAA 4DK6C 1C0AA 3A0JA 2R6GA 4TVAB 1FJGL 1KIXA 1IXRA 1PVOA 1HZCA 1YNXA 4LUZA 3M4PA 2VQEQ 1ASZA 4OX9Q 4JBWA 3M85A 1HR0Q 1S3OA 3AFQA 1UWVA 2HIVA 4EQ5A 4LF5Q 3S24A 2HHHL 5DLQE 4DUZL 4LF4Q 2AHOB 4LF9Q 5FLMH 4DV4L 1NY4A 3S15H 2MO1A 2Z6KC 2VY3A 4A3IH 2UXCL 2CCZA 2UXBQ 2BH2A 2ID0A 2RF4A 3I4NG 5IP9H 1TWCH 1VQHA 4P71A 4PZ6A 2K14A 3HFZB 1KQSA 1QUQB 4BXXG 1VCIA 1W3SA 3I4MH 1SRUA 4JI2Q 4C3JH 1EIYB 3TEHB 1XPRA 2VQEL 3CD6A 4OX9L 4JI5Q 1NJIC 1HR0L 4LFBQ 3S16H 2ZM6Q 4GKKQ 3PF5A 4GNXA 4X6AH 2DGYA 3ER0A 2OCEA 5FJ8G 4Y7NH 2JA5H 5HGQA 1EUJA 1VQKA 4LF4L 4LF6Q 3E0EA 2MO0A 1SN8A 1K73C 1KRTA 3KJOA 4LF9L 3S1RH 4A3FG 1X54A 4OWWB 1PH7A 4OWXB 4B3TQ 2UXBL 5GAHC 1RIPA 1Y1VG 2K4KA 1E22A 5C44H 4DKAC 1LUZA 4YCUA 4LFCQ 2HQLA 4HJAA 5LMUQ 4JI2L 2ATWA 3RNUA 4GOPB 4MNOA 4OONA 4JI5L 3DLLA 1YI2A 4UP9A 1YIJA 4LFBL 1TWFH 2ZM6L 1XMQQ 3PF4A 4GKKL 2VZAA 1XJVA 4OO1G 3RLNA 3I4OA 4JI1Q 1S72A 2V1CC 4YY3Q 2N78A 3GO5A 2L15A 2Q2HA 2WAQE 4LF6L 1M1KC 2JA7H 3HOUG 1PYBA 5BR8Q 1VQ8A 1Y1WH 3PO3H 2ZJPA 4B3TL 4A3DG 3HKZE 5IT9c 3CF5A 5IE8A 4ALPA 3KF8B 1SMXA 2C35B 4LFCL 1Q1BA 5HY6A 1VQ7A 5IYCH 5M3FG 2NN6G 5LMUL 2K5HA 4DNIA 4P74A 3J80c 4DV7L 2UXDQ 1KAWA 4PG3A 1J5EQ 4IPGA 3B6YA 2RHSB 4R4TA 1EOVA 1BBUA 1NE3A 1XMQL 3UDXA 4POGA 3KDFB 4A3GG 4B3RQ 3M4OH 4JI1L 2UUBQ 2KHJA 1SFOH 1IBKQ 4A76A 1YVCA 5IP7H 4YY3L 4HJ9A 1VQPA 4KHZA 3J81i 1MIUA 1GVPA 1YEZA 2R7FA 4IJLA 3L7ZC 4BA1I 3G71A 4A3BH 3GD7A 1OXVA 2Z6KA 4A3JG 4LUVA 4IOAA 1X55A 4IO9A 2A8VA 2VW9A 3GTQH 4BA2I 4NB3A 3HOZH 2ZTCA 3A5ZB 1VQOA 3E9IA 2OTJA 1XPUA 2UXDL 3ZJYC 2VS1A 4QY7A 1J5EL 1D7QA 4L5QA 1VQCA 4X66Q 4B3RL 3CCVA 3PIPA 2F3IA 4BY1G 2EIFA 1IBKL 3K81C 3J80i 3T1HQ 1YHAA 3PUWA 1XNQQ 3HOWH 3MXNB 5C3EH 4QIWE 5M3MH 4A3MH 3S1MH 1G6PA 3ULLA 1WCMG 3W1GA 4MTNA 3ULJA 3G4SA 1M90C 4JBKA 4A3LH 3UDIA 1NTGA 4DR2L 2K5NA 1RL2A 2FXQA 4GN5A 4LF8L 3CW2C 4XIGS 4BBSG 4P72A 2K5VA 2EQSA 3RN2A 3ICEA 3NENA 1I94Q 1OXXK 1U0LA 4BBRH 2WP8J 4X64Q 3J81j 4WJ4A 1L1OB 3KF6A 3KYHC 3K7UC 1EIFA 1X3GA 5EAYA 5IYDH 1KRSA 4LFAQ 1PH6A 2K52A 4KHPL 1XNQL 3W1BA 1BKBA 2QEXA 1WYDA 4JI0Q 4JI4Q 3HOYG 1VQIA 3FKIG 4B3MQ 3A5UA 3HKSA 4DV5Q 1YHQA 4KI0A 3H3VH 2NVXH 1X56A 3BZKA 5JEAJ 4A3FH 5AJ3Q 1AH9A 2R7ZG 4LWCA 2PQAA 3PUVA 1JJCB 1HZAA 5IYBG 1I94L 1QZGA 3HOVG 4OO1I 3I2ZA 1U5KA 4DPGA 1A63A 2E2HH 4X64L 1VQ4A 3RR5A 3GDEA 3ULPA 4DV2Q 3JAMc 2JQOA 4DR5Q 4A3EG 3K0XA 4A3CH 2DUDA 2WB1G 4A93G 1IYJB 1KD1C 2AMCB 2AKWB 1XMOQ 2A19A 2IX0A 2N8NA 3PUXA 1EYGA 2VUMH 1X3FA 1VQ5A 4JI0L 4JI4L 3H0GH 1GKHA 4B3ML 1BVSA 2A1AA 4DV5L 2CKZB 3PO2G 2NN6I 2R93G 4KLKA 2JK8A 4IPCA 4JI8Q 5AJ3L 2JA6H 1D8LA 1C9OA 1EQQA 2YTXA 1EQRA 4JC0A 4R4CA 1IBLQ 2UUAQ 4OWTB 2E8GA 1GM5A 4LF5L 2YV5A 1E24A 1Q46A 4YCWA 3NBHB 4DUYQ 5LMNW 2R92H 1V43A 2OQKA 3FHWA 4UP8A 4DV2L 3HOXH 4L5TA 4DR5L 1HNZQ 2GVAA 4GLXA 1N33Q 2IY5B 4DV3Q 1E1TA 3M9BA 3S14H 4DV1Q 1DGSA 1Q7YC 1KHIA 3STBD 4A3GH 1GO3E 1OXTA 2NZOA 2ZTDA 3CP0A 3CCEA 1XMOL 2I5HA 1Z9FA 2IHFA 4RMFA 5GADC 3JAMi 1MJEA 1L0WA 2I5LX 2RHQB 1C7YA 2GVBA 3PUZA 4O0AA 1O7IA 1B7YB 1X65A 3BU2A 1TWAH 1CKNB 2JEAI 3K7AH 4QL5A 2NVQH 1UE6A 4JI8L 2GN5A 2YTVA 3D0FA 1YJNA 3CXCA 2WAQG 1I50H 3J81c 4DR6Q 1IBLL 2UUAL 4UP7A 3KOJA 1A8VA 5JJKA 1CSPA 1VQEA 2JJQA 1OTCA 4PZ8A 2N3SA 2UUCQ 1CSQA 1HNZL 4JG2A 3I56A 4DV3L 1VQDA 4JI7Q 2AWNA 2B63H 1NMGA 2CQOA 4GOPC 1JT8A 1Q8KA 4FDBA 4R4IA 5C4JH 3E9HA 4AH6A 3CCSA 1S40A 4LW1A 2Y0SG 1CKMA 1WOCA 3Q8DA 1SR3A 4HJ5A 1I5FA 3S1NH 4A3IG 2JE6I 2B29A 1TXYA 3L2PA 2I5MX 1K83H 3OTOQ 1WJJA 3CC2A 4DR6L 5IP9G 4GLAC 4R1JA 4YHHQ 4HIDA 3TREA 3F2CA 4B3SQ 3I4MG 2UUCL 4JYAQ 4A3KG 3GTLH 5C4XH 5BR8L 1VQ9A 1PHJA 4QQBX 4JI7L 1VS0A 3EBEA 4BXXH 3M3YH 5ELNA 2JA5G 1PFSA 2KHIA 3TQYA 1N33L 1SROA 1JMCA 4PMWA 4NXMQ 3M4QA 1AE2A 3H15A 3RZDH 2I0QA 1PH9A 1FL0A 2AWOA 4NXNQ 3FKIH 3W5OA 5C0XI 1PV4A 4GNXB 3S17H 3AYHB 5C44G 3OTOL 2UU9Q 4YHHL 2UUBL 1XTDA 4IFDJ 4MZ9A 3STBC 4B3SL 3T1YQ 4IFDG 1G51A 4O2DA 4JYAL 2KCTA 4JI6Q 5E7NA 5IY0A 3CCJA 1PH8A 1JB7A 1ASYA 2OTLA 4R4QA 1PH1A 1K0RA 3G6EA 1JJGA 2H5XA 1UE5A 3RN5A 1AE3A 1QUQA 2PNHA 4YCVA 3OW2A 1E3PA 1P8LA 2EXDA 4AIMA 3KLWA 2JA7G 2ZJQA 1TWGH 1VQ6A 4P75A 3CQZH 4NXML 4AYBG 2MQHA 1J6QA 2D0PA 4NXNL 3F2DA 4A75A 3I4NH 1Y1WG 3PO3G 1YITA 2Q2UA 4DR7Q 3CPFA 1PA6A 3PO2H 1A0IA 4X66L 1UE1A 2UU9L 1VQBA 1HR0W 4R4OA 3UDGA 4POFA 1VQJA 4XTCS 5IYCG 3T1HL 1Y14B 4X62Q 3T1YL 3AEVA 3EN2A 4YWMA 1OXUA 2PI2E 1OXSC 3UDFA 3SGIA 4JI6L 5FJ8H 5JJLA 1T9HA 4BY7G 1HH2P 4YWKA 4HJ7A 2B3GA 2YTYA 1CKNA 5IP7G 5JEAG 1UEBA 4UY8C 1Y1VH 1L1OC 4GOPA 5C0XJ 3JC66 1N32Q 1I3QH 3K80C 1VQMA 4DR7L 2F52A 5C0XG 3DM3A 3PIOA 4A3BG 1YHBA 2KCMA 1IBMQ 1YJ9A 1K8AC 3I7FA 4AQYQ 4DR3Q 3CC7A 3CCUA 1E7ZA 3HOZG 4LFAL 4IPDA 2QGQA 4X62L 3RZOH 1HNWQ 4NPSA 1HJPA 4L5RC 2F4VQ 4WJ3M 3K8AA 4EX5A 3U4ZA 2BH8A 2NVYH 1Z47A 1K9MC 1N9WA 2R7DA 3HOUH 3U50C 3CCMA 5GROA 3PCOB 2KBNA 2HT1A 3PV0A 1UE7A 3CAMA 5H1SE 1N36Q 3HOWG 2K50A 4A3DH 5C3EG 1B8AA 5ELOA 4A3MG 5M3MG 5M5YH 1N32L 4PZ7A 4HIKA 1G291 3CMEA 3KDFA 5M3FH 4A3LG 1X6OA 1IBML 2JA8G 1B70B 1X3EA 2HIXA 4AQYL 4DR3L 2OQ0A 3PUYA 2ES2A 4JCVE 4P73A 1PH4A 1HNWL 1SE8A 3S2HH 2WB1E 3AQQA 2D62A 4BBRG 2F4VL 4K0KQ 1I6HH 3AFPA 3FP9A 3TS0A 3OYYA 4LF7Q 3J7A5 4ME3A 4A4IA 1GD7A 4A3KH 4DR4Q 5IYDG 4QGUA 3CCQA 4GLVB 2IT1A 5GQOA 3KFUA 2LXKA 3LGJA 3TS2A 2XGTA 4A3JH 3ERSX 1N36L 2NZHA 1K8GA 3RLFA 3KF6B 3J7ZC 3VDYA 1VQLA 4DUYL 1QZHA 3RLOA 3HKZG 4HIMA 3G48A 4IFDI 1NMFA 4H02A 2N49A 5GAEC 1CKOA 1LM0A 1X9NA 4DV1L 1N34Q 4DV6Q 2IX1A 2ZTEA 2LSSA 3M7NA 2JEBI 1PH2A 1WFQA 4K0KL 4C3IH 4Y52H 2IHEA 4BY1H 3GTPH 1Q12A 1PH3A 4JOIA 1JJ2A 4LF7L 5LMNQ 2WFWA 4DV7Q 4A3CG 1HZ9A 2PQAB 5FLMG 1QVFA 1SLJA 1LYLA 1WI5A 3F2BA 1KC8C 4DR4L 1VQFA 1PH5A 1WCMH 2ZJRA 1VQGA 1Q1EA 2BA0A 1JE5A 1HNXQ 2E5LQ 2VUMG 3PGZA 3KJPA 1L1OA 1PYSB 3H0GG 4DV0Q 5IWAQ 3IRBA 4X65Q 4DR1Q 2MNAA 1EWIA 1L2FA 1BBWA 4JI3Q 4BBSH 1Q86C 2CFMA 2ASBA 2E2IH 2JA6G 2VL6A 4DK3C 1YBYA 2VQFQ 1N34L 3CCLA 2Z0SA 4J15A 1NBWA 4DV6L 1N8RC 1XNRQ 3PSIA 2MFIA 4GS3A 2R92G 2LXJA 3HOXG 5LMNL 1K3RA 3GTMH 4APVA 3HOYH 1Q81C 2QA4A 4GN3B 1EFWA 4IPHA 3GTJH 2YU9H 4BY7H 1A62A 3CCRA 2BA1A 2Y0SE 1HNXL 3BJUA 2E5LL 1FVIA 1LTLA 4GKJQ 4GN4B 4DV0L 4JI3L 5IWAL 4X65L 2ALYB 3I55A 4DR1L 2CWAA 2R7ZH 1YJWA 3UE0A 3GTKH 5IYBH 3HOVH 1HZBA 3GTGH 4JV5Q 1P16A 2VQFL 4DAMA 1MKHA 2E2JH 1VQAA 5M5XH 4A3EH 2JA9A 1XNRL 1CUKA 1FGUA 2Q2IA 2CWPA 3S2DH 4DR2Q 4LF8Q 4A93H 4IJHA 4UPAA 4IOCA 4GNXC 5JJIA 3NELA 3U58A 1KXLA 3L0OA 2XTIA 4JBJA 1V9PA 1YZ6A 4YWLA 4QJFA 3CPWA 2R93H 3F8TA 2B63G 5J3BA 3MEFA 1KL9A 3A74A 4DAYB 1MJCA 1QVGA 3CC4A 2OWOA 4L5SA 3TRZA 4KHPQ 4TQUS 1XPOA 3EIVA 2K75A 2PMZE 4JOIC
chains in the Genus database with same CATH superfamily
1CK1A 3RZOB 1F2LA 3TJQA 2RADA 2JA8H 1EZ8A 3N6RA 3UE1A 4C3HH 5GAGC 2MP1A 1OMTA 3S1QH 1V1QA 1YNJC 5FLXc 2OF1A 4OXPA 4U6RA 1YTPA 1RTNA 1CHPD 1S5CD 1H95A 3MFGA 3U4VA 4DAVA 2ICIA 3BZCA 5E4XA 3EVQA 1RODA 1E1OA 2QF7A 3IL8A 1QVCA 3GTOH 3E0JA 2Q2TA 4LNQA 4AYBE 2F0SA 2UXCQ 5K36G 5LL6X 2QQCA 4FF1A 4A3IB 5CGKA 1C0AA 2L5TA 3QWNA 4TVAB 3KP9A 5IGGA 2V6EA 1KIXA 1FYBA 1TWCB 1FAQA 1NNXA 1YNXA 1GUNA 1ASZA 4OX9Q 2RSOA 3DMUA 1S3OA 4C3JB 2HHHL 1DCZA 1H9MA 4LF4Q 1SYDA 1Q90A 1WTRA 2OEOA 2AHOB 5FLMH 5CV6A 4Y7NB 4DV4L 1NY4A 1ILQA 1R4QB 1RTOA 4A3IH 5I6WA 4PL4A 3I4NG 1TWCH 4CKEA 1KQSA 4V190 1VCIA 3E3XA 1EYDA 1SRUA 4C3JH 1K0SA 1XPRA 2VQEL 3GV6A 4CBVA 4JI5Q 4H13C 2F0LA 5EKKA 2OCEA 4Y7NH 1O7ZA 1EUJA 4KKSA 4DXGA 3L0IA 2MO0A 1K73C 1KRTA 4LF9L 1X54A 2B2UC 4OWXB 2UXBL 1B3AA 2JA7B 4ODGA 4O42A 3OXLA 4YCUA 3BVMA 3K5NA 2B2WC 4LJZC 5LMUQ 2ORWA 3RNUA 1YIJA 1XXGA 1BR9A 4MNOA 4OONA 3DLLA 4LFBL 1CT4I 1XJVA 4JI1Q 4C56C 2L1BA 1WTHA 4H44C 1ZKOA 1AEXA 2N78A 4LF6L 1PFNA 4DAYA 2JA7H 3M4OB 2EY1A 1PYBA 4DFAA 3P23A 4B3TL 3HKZE 4ID6A 1Z7TA 1SMXA 2DNCA 4LFCL 1VQ7A 5IYCH 3VR4A 7WGAA 4P74A 5BN4A 3J80c 4G75A 3HOZB 9WGAA 1LO5D 4IPGA 3B6YA 1XMQL 1EOVA 1NE3A 3UDXA 3M4OH 4IUPA 2UUBQ 1IKMA 4EQNA 5JEAH 4F8MA 4KHZA 1PZJD 3J81i 1MIUA 4IUUA 4FXGC 4RFBA 4BA1I 3L7ZC 5C0XH 3HOWB 3NUCA 1V1HA 4J1MA 1OXVA 5M3MB 1DS2I 2A8VA 2VW9A 4BA2I 3HOZH 4RWSC 3E9IA 3C46A 2PZTA 1EY8A 2FMCA 2UXDL 2VS1A 3D4DA 5J8FA 1H0ZA 3K5MA 4B3RL 1KDCA 4HFVA 3FPPA 2SOBA 1IBKL 4O1OA 2DB6A 1UAPA 2V4DA 1W4RA 3HOWH 2EY2A 1G6PA 5M3MH 2P22B 2KMQA 4G7ZC 4N9TA 4A3LH 4GN5A 1SXTA 3DEOA 3ICEA 1DOLA 1S5ED 2AQ1B 1L1OB 1WGCA 1TVXA 3K7UC 4JK1C 1PH6A 1RDPD 1EIHA 2CQAA 1BKBA 1X4SA 4KKUA 4UAIA 2JB1A 4CJ1B 1YHQA 4NW2A 2AUJD 3WOFA 4RH6A 2R7ZG 4LWCA 1ULMA 1O7LA 3UI2A 1JJCB 1QZGA 2EYMA 5HQ8A 1MJ9A 1U5KA 1SNPA 5JVG3 3RR5A 3JAMc 2MGSA 4A3EG 2GKRI 2B2VC 2D5DA 4K2KA 4A93G 4Q9VA 1IYJB 2AMCB 2AKWB 4MN3A 4OEMB 1U4PA 3BYTB 4B3ML 1PTRA 2CKZB 2NN6I 2R93G 3DHQA 4QIWB 4IPCA 3H09A 1EQTA 1UUCA 2YTXA 4JC0A 3VYUA 1IBLQ 1X74A 4OWTB 2E8GA 1D5XC 1SYBA 2WKCA 4YCWA 5LMNW 1I50B 2PO4A 4L5TA 1G2SA 4DR5L 1HNZQ 2IY5B 4DV3Q 4C3HG 2PPBC 4KD4A 1KHIA 3STBD 4A3GH 2ZTDA 4H7BA 1L0WA 1QE6A 2RHQB 4O0AA 4ZQ3A 1EWCA 1O7IA 3VDPA 4FF2A 1CKNB 2B63B 2JEAI 1GUGA 1TS3A 2GN5A 5C4JB 1TOTA 1YJNA 3I91A 1I50H 2QQDA 5JJKA 2F0EA 1CSPA 2JJQA 1OTCA 1YO7A 2K33A 3VR5A 2ZXOA 3NQTA 1TS2A 4B6DA 2ODDA 1SE4A 1JR0D 1LR8A 2AWNA 4F87A 2B63H 1NMGA 5HI7A 2C5CA 1N33Q 1EWHA 4K5VA 5C4JH 4IZ8A 4HJ5A 2O5JC 1I5FA 4A3IG 5A35A 1JWMD 2JE6I 1RKNA 2I5MX 3RZDB 3OTOQ 5J8CA 2A20A 5CCLA 4HGUA 4QF4A 4HIDA 1FY7A 2FNFX 4C3JG 2B2VA 3VA5A 4QQBX 2QILA 4JW0A 4FNFA 1PFSA 1FD7D 1H9SB 4FXDA 3IKJA 3OL0A 3RZDH 4NXNQ 3UEYA 3Q6SA 1JOOA 5C0XI 3DM1A 4NV5A 2F66B 1L0XB 4RGOS 2VB2X 2UUBL 1KABA 4MZ9A 3STBC 4B3SL 4XQQA 4JYAL 3OWEB 1ML0D 4Z7HA 4JI6Q 5IY0A 3CCJA 3T51B 1ASYA 4G7OC 2OTLA 2GA4B 4R4QA 1GHKA 5KNDA 3G6EA 3RN5A 4YZDA 1JC7A 2N88A 1STBA 2QDBA 2Z1CA 1GXDC 3UOEA 1P8LA 2EXDA 1EEFD 2JA7G 4A3FB 4NXML 4A75A 2D0PA 3F2DA 4KD3A 2Q2UA 2RLDA 3KK7A 1HPCA 1A0IA 2N1AB 1I3QB 2SGPI 5L37A 1HR0W 4R4OA 2N17A 5IYCG 1VQJA 2B2YC 1BF4A 3T1YL 2E73A 4YWMA 2PI2E 4XYQA 3UDFA 2I07B 5FJ8H 4BWGB 3IFTA 3LX0A 5E4WC 4HJ7A 1DOMA 1U9RA 1UUPA 5JEAG 4UY8C 4DWLA 2B8TA 5ELBA 1L1OC 3HOUB 4EQOA 5IOCA 5C0XJ 1I3QH 5CV8A 1STHA 5C0XG 3DM3A 1IBMQ 5M5YB 2WVJA 4U673 4DR3Q 5M3FB 1E7ZA 1SAPA 3HOZG 2FJ2A 4RHRA 2A69D 1HCZA 1WTPA 1Y8PB 3K8AA 4O1PA 1TU2B 3U4ZA 2BH8A 2J0TD 4N8FA 3Q23A 2A2CA 1N9WA 2QW7A 2XRSD 3HOUH 3DA4A 1EFID 4K8IA 1D1IA 3PCOB 2J7ZA 2KBNA 4G57A 4TSSA 1G6ZA 1S20A 1Y8FA 3LJ2A 3HOWG 2KKMA 4IUTA 5FO8B 5M3MG 2X69A 5M5YH 4PZ7A 4HIKA 1G291 3DO9A 4A3JB 5M3FH 4A3LG 1HUMA 2E76C 2F0KA 3GP7A 4AQYL 2HIXA 3SK6A 2FU2A 2OQ0A 1E2WA 2ES2A 3QJYA 1C48A 3KLSX 2NU3I 2F4VL 3AFPA 4QCLA 2KEDA 4ME3A 4QGUA 1CZWA 2XGTA 2F0GA 4A3JH 1N36L 2NZHA 3HG9A 3RLFA 3BDLA 3IAYA 3HZXA 3G48A 4OGQC 2DKVA 3CRLC 1Q3LA 5GAEC 3VYTA 1KDBA 1TR5A 4OAUC 2IX1A 1PRTF 5LHY1 2LSSA 2KCXA 2K7VA 5T1GA 1BQQT 2B2YA 1PH2A 2E2IB 3E59A 4FF4A 1KTKA 1Q12A 5D14A 1CI3M 2CW0D 2WFWA 1II3A 3CHBD 1SLJA 1LYLA 1KC8C 1JE4A 1NAPA 1VQGA 1JE5A 4BS9A 1E0BA 3TSSA 1L1OA 1LTBD 4CHTB 3KJPA 1PYWD 1VDZA 5FO9B 1Q86C 4PQXA 1GUWA 2KA7A 3HGBA 4FF3A 2OZUA 2FEFA 2E2IH 3R5AA 1X32A 1N34L 2CJSC 4RGMA 4J15A 3CXLA 3HS0C 3VYRA 4ZYSA 5JPMC 3F4MA 2E2JB 5M5XB 1E2VA 2LXJA 2WB1B 5C3WA 2M00A 2R61A 1Q81C 2QA4A 4AMLA 4BY7H 4K5WA 3C1EA 4EGVA 1HNXL 4DV0L 3NTIA 4DR1L 2ALYB 3I55A 2CWAA 1WKXA 3E6ZX 1PZID 4ABNA 3ND8A 3UE0A 5IYBH 2OXPA 4XDXA 4DXFA 5KGUA 2NU1I 3BJIA 3RMHA 2JP1A 2E2JH 5M5XH 5ELFA 2XVSA 1I4PA 3S2DH 1TWHB 4LF8Q 3IFDA 2RQXA 2IJ0A 2ZW3A 2KMOA 1R0RI 2XTIA 2MUYA 4JBJA 1JOKA 2QDLA 5M5WB 4YWLA 1YZ6A 1MI2A 4MTKA 3CPWA 2IPKD 3D8GA 2B63G 3MEFA 4GXTA 3A74A 4DAYB 1MJCA 4NDXA 3CC4A 3QG1A 2NVTB 4TQUS 4XXEA 3EIVA 2XWBB 2K75A 1J9OA 1IYUA 3E2IA 1TWHH 4JV5L 2B0UC 1Z7KB 1PRTD 2CW0C 5FK9C 4L6TB 4S3SA 3H3VC 5BN3A 2PI2A 1J8IA 3F1ZA 2YYZA 3A8JE 2FMMA 2VNUD 4YIJA 3SEBA 5M5WH 2HHHQ 3TO7A 1VF5C 3CU7A 1VQNA 1SJED 2IL8A 4DAPA 2NVTH 3WWVA 3H3VI 4FXKC 4DV4Q 4HJ8A 1Q82C 2Y0SB 2V1CA 1HFGA 3D31A 4RKLA 4DK6C 1F9SA 1BOSA 1FJGL 3NK9A 5A2QL 1IXRA 3CKIB 1HZCA 4LUZA 2VQEQ 3M85A 4KMUC 4LF5Q 1PDQA 1EEID 4DUZL 1WTXA 5I9PA 5KYLA 4LF9Q 5JOBA 1W6JA 4ZAIA 4HMIA 2MO1A 2VY3A 2UXBQ 2CCZA 1TKWB 1EY0A 2ICEC 4PZ6A 1BBXC 4CDEC 5C44B 1H9SA 3DA3A 2HCCA 4LFBQ 2WCYA 3UEJA 2JXDA 4X6AH 1QILA 5FJ8G 2F0FA 2YFBA 4LF6Q 3E0EA 4A3FG 2BL7A 2QPOA 1BXTA 1H9KA 1PH7A 4B3TQ 3K5LA 1E22A 4AYBB 4HCEA 5C44H 4ILWA 1LUZA 4LFCQ 1D5ZC 1JQOA 2KECA 5IGBA 4JI2L 3SGQI 1ZYRC 1SGDI 2KQ3A 1V1IA 4UP9A 3OXFA 4KN4C 2ZM6L 1XMQQ 3PF4A 4GKKL 4UHVA 2F0WA 3P7JA 5A2QE 3KLRA 3HOUG 1SFOB 1VQ8A 4RCOA 1EY7A 3CF5A 4ALPA 1N13A 5C3XA 2KVMA 1Q1BA 5HY6A 3ERQA 5M3FG 1SSOA 1SNDA 2K5HA 4DNIA 1K8OA 1V1PB 2UXDQ 2F0IA 1L0YB 4PG3A 4CDFC 1BBUA 3FNBA 3BZDB 4B3RQ 4POGA 3R5CA 3A7AB 4OELB 1QOHA 1SFOH 1IBKQ 2QSBA 5CR3A 4PL5A 1NSNS 2FUG1 1GVPA 2R7FA 4CJ2C 3G71A 4DK0A 4A3JG 1AFPA 4A3MB 3S1MB 4IOAA 1X55A 4NB3A 1TBOA 2JA8B 2EY6A 2ZTCA 1PJUA 1EYAA 3R3OA 3RU0A 1AN1I 4QY7A 1J5EL 1SE3A 1VQCA 4X66Q 2XIWA 4BBRB 1SMYD 1JWSD 2F3IA 2N52A 4E1RA 4A3MH 3S1MH 2IW3A 2R3ZA 3ULLA 1JWUD 1SYCA 3FDTA 4L63B 1SNQA 3T56B 1PTOB 3ULJA 3VA7A 1NTGA 4JBKA 2F0JA 4LF8L 2FXQA 1CFMA 3HKZB 5D65A 2F0PA 4P72A 2K5VA 2EQSA 2NVXB 2KEEA 4BBRH 3TO9A 2K05A 4WFN3 2RVLA 3MXPA 1X3GA 5EAYA 2E2HB 1F9QA 4TKOB 2K52A 2LMCB 1XNQL 2QEXA 1WYDA 1PTOH 1VQIA 4HEA1 4B3MQ 3HKSA 3SXHA 2J87A 4DN4M 5C6AA 2VUMB 2E2DC 4KJOA 2NVXH 2RKSA 1X56A 3BZKA 1I4XA 2M2LA 4X3UA 1TGSI 1WTJA 5ELEA 1B4OA 2QQEA 1HZAA 5IYBG 1I94L 2JA6B 1HRJA 2E2HH 2EOTA 2XWJB 4DR5Q 2WB1G 3EA6A 4R9WA 5G3LD 3V96A 3HOXB 4F7XA 2IX0A 2N8NA 2RBMA 3PUXA 2VUMH 5IGFA 3OOCA 3LJ1A 3OMGA 4JI0L 4JI4L 1GKHA 5D3IB 1BVSA 3D4WA 1O78A 1SJHD 1EIGA 5AJ3L 2JA6H 4OAVB 1D8LA 1C9OA 1TWAB 1T5XD 2L55A 1EQQA 3K7AB 4LF5L 1SMYC 3RD4A 1EZ6A 2L1LB 3H6MA 3J81L 1E24A 4DUYQ 1V43A 2I46A 2OQKA 3FHWA 3HOXH 4GLXA 2HGKA 4G76A 3M9BA 4KTAA 2BE5C 2X6GA 1Q7YC 2C9OA 1XMOL 1OXTA 4EVOA 3CP0A 1IL2A 1Z9FA 1OVOA 1C7YA 5CORA 3ND9A 4NV2A 3BU2A 1TWAH 3K7AH 1QCBD 1UE6A 1ZEQX 5FKAC 4X3SA 4ZKCB 4I7AA 2K5DA 4XT3B 3S1NB 2UUAL 4PZ8A 4OVOA 2RIOA 2PW7A 2ZT9C 4HR7B 4UXHA 1LACA 5J39A 1QJOA 1EY4A 1STNA 2Y0SG 3S1NH 5EJWA 2GVIA 2EYHA 1DM0B 2B29A 2LEOA 1PTQA 3F2CA 4B3SQ 2K9HA 4JYAQ 4XQJA 4IURA 3PIP3 1B3QA 1VQ9A 3URYA 4JI7L 2N71A 2H1EA 4BXXH 1A2UA 2EDGA 4NKLA 2KHIA 1B9MA 1JMCA 4R8IA 4NXMQ 3P75A 3DEPA 3H15A 1XBTA 2F0QA 1R4PB 3FKIH 1MJBA 3NTKA 5C44G 2E5RA 4J8QA 2EE1A 1CHQD 3X3NA 1UEAB 4YHHL 1ET6A 3T1YQ 2ENBA 4Q5VA 1ICFB 2KCTA 5CV4A 1SDFA 2JYYA 3A56A 3MA2B 1JB7A 2L7XA 4L8JA 3OIQA 3KBGA 3VR2A 3MC0B 1ENAA 1LT4D 2XSCA 3J7AF 1E3PA 2O4XA 1VQ6A 1TWGH 1JQYD 4AYBG 5C4ZA 3X3MA 1PA6A 1VMPA 3PO2H 1A15A 4X66L 5CV9A 1UE1A 2Z4HA 4POFA 4XTCS 3AEVA 1TS5A 3EN2A 1OXUA 1OXSC 1PTOC 4KV6A 3Q22A 2JBWA 2VRWB 4IN3A 4UXJA 5TSSA 1G8ZD 3R5BA 1H9RA 4YWKA 5HURA 1ENFA 1Y1CA 2YTYA 5FUWA 3SR1A 3I72A 5IGDA 3JC66 4ZUIA 1VQMA 5FUXA 4A3DB 1SGEI 2Q8IB 3FRPB 3DWPA 4AQYQ 1K7VA 3CCUA 2QGQA 4X62L 4NPSA 1HJPA 4DGZA 1RHPA 4L5RC 2UVOA 4OO1H 2F4VQ 2XRCA 3D00A 1GOZA 1K3BC 2ZRRA 1HTLD 2EYLA 4EX5A 4A3GB 3S2HB 2JB3A 3SEKC 1Z47A 4ZKBB 1ESRA 3CCMA 1U4LA 1WGTA 3PV0A 1UE7A 1V1PA 1N36Q 4A3KB 4A3DH 1B8AA 2H4OA 4A3MG 4YZ9A 1N32L 1A3UA 2Q8TA 2KCNA 3LNNA 1X6OA 4Q0FA 2JA8G 1D2BA 5EPLA 1X3EA 4U68A 1AZQA 1PH4A 1HNWL 4ZRZA 3S2HH 4BBRG 2D62A 2OVOA 2KMPA 1TURA 3OYYA 3J7A5 1GD7A 4A3KH 2IT1A 5I2YA 2LXKA 3LGJA 3TS2A 2JZMA 1R79A 1K8GA 4IALA 3VYSA 2ERWA 2UZ3A 4XT1B 4DUYL 1BO0A 1QZHA 1DYQA 3HKZG 3NE5B 4HIMA 3TZUA 5KYIA 1B44D 4H02A 2NYZD 1KMAA 1CKOA 1LM0A 2DNEA 3HP3A 1N34Q 4PMBA 2JEBI 1WFQA 2NZ1D 1TIID 3UFFA 2WIIB 1PH3A 4JOIA 3TDQA 5FLMG 3LWEA 3F2BA 1FNUA 1PH5A 4XQNA 2ZJRA 5BN5A 3GOXA 1LT3D 4IQZA 1DJRD 4MIUA 1HNXQ 1T5EA 2VUMG 3HOYB 1PYSB 4DV0Q 1FARA 2YU9B 3IRBA 4FO2A 4DR1Q 2MNAA 1EWIA 1L2FA 1BBWA 2CFMA 1ICWA 3FBVA 2ASBA 2BDNA 2JA6G 2EJMA 1MD2D 1YBYA 3CCLA 4DV6L 4X3KA 2MFIA 1A6XA 4GS3A 2CWHA 2EJGC 1CT2I 1B50A 5LMNL 3HOXG 5I6YA 3HOYH 4APVA 1HEVA 3NWTA 4GN3B 1EFWA 3R93A 2YU9H 3CCRA 3BJUA 2DIPA 1FVIA 1D6EC 1LTLA 3OIPA 3JSBA 4QB4A 2NB0A 3EQLC 1TT2A 2EYOA 1CQVA 1IYVA 2RDGA 4HMJA 4CKBA 1P16A 2VQFL 1VF7A 2ZXRA 4JV5Q 3OSOA 3TMEA 1TBRR 5KRUA 2CWPA 4DR2Q 1CM9A 4IJHA 2L4NA 4UPAA 4IOCA 2F03A 1D1KA 1PCEA 1KXLA 1XA6A 2F0NA 3HEJA 1WD0A 4KJNA 4C1NK 4L9MA 1KL9A 2OWOA 1KLGD 4L5SA 4KHPQ 5EPJA 1I4HA 2PMZE 2RCNA 1FJGQ 2WAQB 1MHWC 1LTRD 2D0OA 5DEHA 2WINB 3A8IE 1B1ZA 4RG1A 4HCSA 4KN7C 5K5PA 4DUZQ 2YFAA 1BUVT 4B9XA 4BXXG 1SE2A 2QEJC 3QB3A 4R8NA 3I8ZA 3FSXA 1QG7A 4GI3C 1IZ6A 1WTWA 3S15B 3CMAA 1SGPI 1CZGA 2DJGC 3BDCA 3NQIA 2KMRA 2RIJA 1QNKA 1CHOI 3M4PA 1E2ZA 1NCVA 4JBWA 3I4MB 1NR2A 3AFQA 1UWVA 3S24A 3T16A 5DLQE 3VR3A 1ONLA 2JA5B 2SGFI 3S15H 5C5MA 3KY9A 2BH2A 2ID0A 2J9RA 1HTPA 5IP9H 3DWAA 4P71A 2K14A 3HFZB 1QUQB 1B9NA 4RAUC 3I4MH 4JI2Q 3D3RA 1NJIC 2KCCA 1HR0L 2ZM6Q 5ELCA 3QOJA 4GKKQ 3AU7A 3PF5A 2K19A 5I4DA 3ER0A 3P1HA 2JA5H 1SN8A 3KJOA 1QB5D 2F3CI 4CGYB 4OWWB 3BS1A 2SNMA 2LB7A 1RIPA 2K4KA 4I1TA 3J7AV 2SGEI 3HH2C 4DKAC 3FVVA 1BCPB 3PO3B 1CE3A 4IFDH 2JXMB 2KHSA 2ATWA 1LR9A 1LT5D 1STEA 1SGQI 3J80L 2IWHA 3BG3A 3AJFA 2VZAA 4OO1G 3RLNA 2BUSA 2V1CC 4BY7B 3GO5A 2Q2HA 2WAQE 1M1KC 1TDPA 4M1UB 1SNCA 2EZVA 3PO3H 4A3DG 1XWEA 5IE8A 1AZPA 1HJAI 4DF7A 1SNMA 1CTMA 2C35B 4A3BB 1TS4A 3EJIA 1JICA 1NR4A 3H91A 3NSWA 2XTQA 3S2DB 1A2TA 1J5EQ 4A3GG 1WTOA 3LWUA 2F0MA 1YVCA 5IP7H 3P20A 4YY3L 4HJ9A 3BDOA 5CBAE 1OYVI 1YEZA 4IJLA 2D2CC 4HEDA 4A3BH 3GD7A 2B8GA 2RA4A 4IO9A 5CV5A 1GJXA 3A5ZB 2RDHA 4K6LA 5C4HA 2OTJA 1XPUA 3K0YA 1WTVA 3CCVA 1V1OA 3J80i 3T1HQ 5HGIA 3PUWA 2EPBA 1XNQQ 3VE5A 1I4QA 4K6DA 2TMPA 4YZCA 2B8FA 3SHLA 3G4SA 1M90C 2X6LA 1P9ZA 5E3FA 1TY0A 3UDIA 3NPPA 4DR2L 2K5NA 2CVRA 3QR8A 3CW2C 3SVMA 1I94Q 1OXXK 1ZYRD 1BDOA 5LNK1 1S5FD 2QZGA 3A7LA 3J81j 1LT6D 3KYHC 1EIFA 3JAML 4LFAQ 1EU4A 4KHPL 2BOSA 3VDUA 3W1BA 2L8EA 4JI0Q 4JI4Q 3HOYG 4FKDA 3I4LA 1HHVA 2X3TA 4KI0A 2FHTA 2PCFB 3B55A 3R8BA 5AJ3Q 1AH9A 2Z9HA 2NUCA 3NBIA 3PUVA 4PMCA 2DY8A 1IKLA 1BMOA 1Q9BA 1JORA 3BVGA 3QOLA 1GUTA 4NMZA 1HQMC 4X64L 1D5MC 4ULLA 3ULPA 3DXJC 2Z8LA 3K0XA 1KLUD 2DUDA 1S5BD 2R92B 3TP7A 1XMOQ 2A19A 3K59A 1HPTA 1NUCA 1EYGA 3M7GA 1X3FA 1LTTD 2K32A 3NHHA 2A1AA 3GQBA 3KF8A 4DV5L 1F2MA 1IY6A 4KLKA 1XTCD 4UXIA 3TO6A 1M4VA 2NVQB 2NU0I 2UUAQ 1GM5A 2YV5A 5CV7A 2K6AA 2R92H 4DV2L 2F0TA 3NP8A 1DGSA 4KKTA 3SK4A 3H94A 3CCEA 5GADC 5IT9L 3JAMi 1K7TA 2GVBA 3PUZA 1X65A 4RKBA 1UHAA 2NVQH 1ESFA 3EFXD 1QWYA 4JI8L 2YTVA 1MT1A 3CXCA 2WAQG 3E5SA 1CGII 2MHVA 3I70A 4UP7A 1A8VA 2K01A 3WOEA 1MJAA 1VQEA 2N3SA 1CSQA 5DM73 1VQDA 2QCPX 3I9V1 3MXNA 4JI7Q 5C4XB 1SYGA 3CRKC 2NWGA 4LAAA 1PZKD 2CQOA 1HA6A 1Q8KA 4FDBA 4R4IA 1S40A 2D9UA 3M3YB 1WOCA 2M5XA 2J4XA 1TXYA 3L2PA 2JAEA 4DR6L 1WJJA 3VR6A 4GLAC 5IP9G 2LFNA 4R1JA 4YHHQ 2F3WA 5G3LF 4A24A 3I4MG 2UUCL 1CA5A 2ENNA 5J22A 1XYIA 2P5ZX 5C4XH 2IP6A 1ULNA 5NUCA 1PHJA 4K5XA 1QNUA 3M3YH 5ELNA 2JA5G 1Z2IA 3OWFA 3TQYA 1PFBA 2E74C 3M4QA 1AE2A 2I0QA 1PH9A 1FL0A 2AWOA 3W5OA 3TN2A 4GNXB 3AYHB 3WDNA 3CQZB 5IT9E 1DXMA 4AS2A 1XTDA 4IFDJ 4N9PA 2JA1A 4IFDG 2PW5A 1PH8A 1Y69U 2BE5D 1PH1A 4PL3A 1PFMA 3TP8A 2ETDA 4IUQA 1QUQA 2PNHA 4WJWA 4YCVA 1YNND 3OW2A 4AIMA 3MHBA 3KLWA 2JYOA 3CQZH 1J6QA 4JPBW 3PO3G 3TZDA 1Y1VB 3CPFA 1SBBB 2O2LD 3VA9A 2UU9L 1SYEA 4RGTA 3BVZA 3UDGA 3T1HL 1Y14B 4X62Q 3IAS1 2K28A 4C1NI 1PTOF 4AS3A 1W6KA 1LLRD 1T9HA 4BY7G 2B3GA 5IP7G 1UEBA 1Y1VH 2NVYB 1BNZA 5C5LA 1N32Q 3K80C 4DR7L 1K7UA 3PIOA 4A3BG 2F0DA 1YHBA 2KCMA 4NP5A 4X3TA 5E3PA 1GUSA 4I7ZC 2E75C 3K57A 3PDNA 3CC7A 4QMGA 4LFAL 4DA2A 3RZOH 1HNWQ 2EJFC 4WJ3M 2ENZA 2F0OA 4HAEA 2NVYH 1K9MC 2B39A 2R7DA 3TP6A 3U50C 3G6JB 5FOBB 2AUKA 5H1SE 2K50A 3UITA 2AQ2B 3A55A 1ENCA 4KY6A 5KNCA 2NN6H 2YUUA 1DONA 1B70B 3PUYA 2G5DA 3MEHA 4P73A 4LMQD 2RDFA 1HXYD 4Z9CB 1YNNC 3TS0A 1B2TA 1TIHA 4A4IA 2PZUA 2LS01 2K1BA 4C3IB 4BY1B 3GTPB 4B08A 4GLVB 5GQOA 3AB9A 3QO2A 1RJTA 1KNEA 1F9PA 2KOLA 3KF6B 1WCMB 3GV3A 3J7ZC 1VQLA 3RLOA 3MXUA 1KAAA 2HCIA 1F2YA 4BBSB 2F0VA 1K28A 4DV6Q 2ZTEA 5J1ZA 4MPIA 1Y1BA 4J6HA 1PTOD 2DY7A 3SE0A 4C3IH 4K0KL 4BY1H 3GTPH 2HUGA 4LF7L 5LMNQ 4DV7Q 3MWYW 2CWFA 2PQAB 2G9HD 1QVFA 3QTLD 1WI5A 4DR4L 1VQFA 1WCMH 2BA0A 1Q1EA 3GTMB 1DD2A 3FKIB 1IHZA 5EBCA 3GTJB 4BBSH 3U9SA 3K58A 3D6CA 2VL6A 4F88A 2VQFQ 1IW7D 2Z0SA 1N8RC 3GTKB 3SK8A 2F0UA 3HOVB 3J81E 1TBQR 1PMRA 4KY7A 2ELIA 2R92G 1X3PA 3ONAB 1U4MA 2F6MB 2CH4A 3GTMH 4LK1C 3TOBA 3B4VC 1JCKB 3MFYA 4DNCA 3T53B 1FGBD 3GTJH 2W0TA 1TWGB 2BA1A 1B53A 2E5LL 4GN4B 5JHWC 4JI3L 3FPUB 5IWAL 4X65L 3PO2B 5E3QA 2L9HA 3GTKH 5EGTA 3HOVH 1OMUA 1HZBA 1LR7A 1LV9A 1XX8A 1S4ZA 1XNRL 2JA9A 1FGUA 4C2MB 4WORA 2GKTI 4GNXC 2A68D 3MXGA 1KDAA 3NELA 3U58A 2A6ED 3OXGA 4H0LC 1V9PA 3T4AC 5T1IA 4Z7GA 3C3LA 4GKJL 5IIFA 3TRZA 3OMCA 3FC3A 2SGDI 4CJ0B 1XPOA 4DNTB 2VB3X 1NXUA 4JOIC 4C2MH 2B2UA 1R9TB 5IGCA 1G2TA 1FR3A 1W2BA 1TUSA 2KENA 1HFNA 2B2WA 5C4XG 3MEKA 4MHEA 5AFWA 5COYA 4HIOA 4JBMA 2TSSA 4FP5D 1IW7C 1SEBD 4LUOA 3NEMA 1A3TA 1R9TH 2EXZA 3NWSA 3A0JA 2R6GA 2Y0MA 1PVOA 4E6IA 3PMFA 1VDDA 1HR0Q 2HIVA 3KUPA 4EQ5A 3ZYYX 3NTHA 3S16B 3I90A 2Z6KC 2UXCL 2QGMA 3FEWX 1UVFA 1PLFA 3S1RB 2RF4A 3ITPA 1VQHA 5CCMA 1SJ8A 2A68C 1W3SA 3D6WA 1Q8IA 1EIYB 3TEHB 2PMZB 3I3CA 2A6EC 3CD6A 4OX9L 5EPKA 3S16H 2EY5A 4ZK9B 2F0HA 4GNXA 4B9WA 2DGYA 3OW7A 5FUYA 1O7YA 1CQFA 1TWFB 5HGQA 1VQKA 4LF4L 3Q0AA 1U4RA 1VMCA 2BCOA 3S1RH 2Z4IA 3D4RA 3OPOA 5GAHC 1Y1VG 2SDFA 5I2XA 1NUBA 1Y1WB 3FVQA 2XN9C 2HQLA 5LL6S 4HJAA 4P2CB 1SGNI 4GOPB 1YI2A 4JI5L 2GIVA 1TWFH 4O1NA 3I4OA 1S72A 5M9OA 4YY3Q 1O80A 1EY5A 1ULKA 2L15A 2M9VA 2NBFA 5BR8Q 4QUCA 1WTQA 1TY2A 1Y1WH 2NTTA 1DZ1A 2ZJPA 5IT9c 1V8QA 2A74C 3KF8B 1RD9D 1JB3A 2XMXA 3QIAA 2NN6G 1SNOA 1I4RA 5LMUL 4DV7L 3GTQB 4CDDC 3OVOA 1KAWA 3L9AX 2L0CA 5CC4A 2RHSB 4R4TA 4ME5A 4RA8A 3KDFB 4JI1L 2KHJA 3M4YA 4A76A 5IGEA 1VQPA 2L12A 5HGTA 5C3EB 2Z6KA 4CDCC 4LUVA 3TOAA 2PYKA 3GTQH 5CMDA 1RCVD 3SDZA 1CSOI 1VQOA 1LTSD 5FLXL 2A6HD 1RF2D 1M8AA 3LJ0A 3TBIB 3ZJYC 1D7QA 4L5QA 4PNYA 5JJZA 3PIPA 1F77A 4C3IG 3BYYB 2NU4I 4BY1G 2EIFA 4IUVA 3K81C 1YHAA 4KHVA 2A2DA 4PV1C 3MXNB 5C3EH 2ZXPA 4QIWE 3K6OA 2MPMA 1WCMG 3W1GA 4MTNA 2OU2A 3W2DA 1PPFI 4K8JA 4BBSG 1RL2A 4RCNA 4XIGS 3RN2A 1AP0A 3NENA 1M8CA 1U0LA 2BDOA 5DM63 2WP8J 5DAUA 4X64Q 2K5WA 4WJ4A 4K2LA 3KF6A 1KBEA 2N55A 5IYDH 2LKVA 1KRSA 4DU9A 2CAZB 3N52A 2ORVA 1LTGD 4OIJA 2RCFA 5EQ0A 5D3DA 1MSHA 3FKIG 3A5UA 2P6AC 4DV5Q 4G7HC 3PQIA 2FFKB 3H3VH 3H0GB 4A3FH 5JEAJ 3AMUA 2PQAA 2LUYA 2GSCA 5DNFA 3FSYA 2G9DA 4RHSA 4DK1A 3HOVG 4OO1I 1F9RA 3I2ZA 4DPGA 1A63A 2EYJA 1VQ4A 2K5QA 3GDEA 4DV2Q 2SEBD 2JQOA 2JB2A 4A3CH 2EVBA 2OT2A 5DAEA 2MJFB 1KD1C 2XRQD 3KBXA 3DWQA 4UDUC 1UVGA 5FLXE 5KIXA 2DN8A 3S14B 1VQ5A 5FUVA 3H0GH 4EQPA 3L3OC 1LTID 3PO2G 2A6HC 2JK8A 4JI8Q 1MBYA 2JW6A 1EQRA 4R4CA 1EQVA 5KNBA 3R5DA 1Q46A 3NBHB 4UP8A 2A73B 2GVAA 5I9OA 1K8MA 4SGBI 4OIKA 1E1TA 3S14H 1Y8OB 4DV1Q 2RSNA 1GO3E 2NZOA 3SGBI 2I5HA 4RMFA 2IHFA 1MJEA 1GHJA 5JVH3 2I5LX 1PRTB 3R2IA 3SDJA 1CT0I 1B7YB 3MZ5A 5IODA 4QL5A 1ET9A 2EYPA 2B2TC 3D0FA 1OO9B 3J81c 4DR6Q 1IBLL 3FMCA 3KOJA 2KUMA 2F4IA 1K83B 1XX6A 2UUCQ 1HNZL 4ZUJA 4JG2A 3I56A 4DV3L 1FNVA 1BCPF 4E1PA 1F2ZA 1SGYI 1LABA 4N8X1 3GTLB 4GZYC 4GOPC 2O5IC 1JT8A 3CCSA 3E9HA 4AH6A 4LW1A 1CKMA 3Q8DA 1SR3A 4M8AA 3RUZA 1TBNA 2ARPF 2PQ8A 2WGCA 4KY5A 1K83H 3CC2A 3QWPA 2WV6D 3S17B 4ZCKA 5EBDA 5CYUA 3TREA 2EYFA 2A69C 3UGIA 4A3KG 3GTLH 5BR8L 2ROWA 1VS0A 3EBEA 1YU6C 1STAA 1WD1A 5K36H 3HRZC 1SROA 1N33L 4PMWA 2HQEA 1A3VA 2MJ8A 2GKVA 1PV4A 3A8KE 3DUZA 2A5HA 3S17H 3OTOL 3I4NB 5JAVA 2UU9Q 1P9GA 4G4KA 3S9WA 2QKIC 1KNAA 4CKCA 1G51A 4O2DA 4RGNA 1H9JA 5E7NA 3J80E 2X52A 1K0RA 1JJGA 2H5XA 1UE5A 1AE3A 1ZXTA 1STGA 4IUNA 2PQEA 2F3VA 1UNSA 5E3RA 2Z6BA 3EROA 2ZJQA 4WRDA 4P75A 2MQHA 4NXNL 4DNRB 1CA6A 3I4NH 1BUSA 1Y1WG 4DR7Q 1YITA 2B2TA 3J7YW 1VQBA 1HDLA 2HDLA 4HN7A 1EL0A 3PIO3 5EX3A 2CH4W 4ZLTF 3SGIA 4JI6L 1WVLA 1BCPD 5EKLA 5JJLA 1EU3A 1HH2P 4JVZA 1CKNA 1RFHA 3F2UA 5FO7B 4GOPA 1AW7A 2F52A 4XYOA 2SGQI 2BL8A 2OD1A 3MVVA 1YJ9A 3W3AA 1K8AC 3I7FA 1ILPA 5EX0A 4FYDA 4HSVA 4IPDA 1I4GA 3T13A 1FNWA 3UGLA 1HA5A 2PZWA 4HSPA 1MSGA 1I6HB 1PXUA 4V0BA 3NXWA 5GROA 2HT1A 3CAMA 5C3EG 5ELOA 2HD3A 3CMEA 3KDFA 1IBML 1CGJI 3SK5A 1EY9A 5EKIA 3V05A 1LTAD 4DR3L 3K5OA 4JCVE 1SE8A 2WB1E 3AQQA 4K0KQ 2IX3A 1I6HH 2K04A 3FP9A 1EYCA 4LF7Q 2SNSA 2XNAC 4K14A 2K03A 3JAME 3OHXC 3MAQA 4DR4Q 5IYDG 1EY6A 3CCQA 1C8CA 3KFUA 2JN4A 2DJFC 5ISRA 2V53A 3ERSX 5JPNC 1Y8NB 4HTHA 3UGDA 5E1FA 1G91A 2PNRC 4OL7A 3VDYA 1FYCA 4IFDI 5ELDA 2VXWA 1NMFA 3IAM1 2N49A 4I65A 1X9NA 1BCPC 4DV1L 1TQOA 1PRTC 3M7NA 1I6VC 3KLSA 4FVMA 1M8BA 3A54A 2IHEA 1MGSA 4Y52H 2CWGA 2L11A 2KJXA 1JJ2A 3C1FA 4A3CG 1HZ9A 2JSOA 2FINB 2AQ3B 4WP4A 4QUFA 2Q8RE 1YNJD 1IY5A 2E5LQ 1DOKA 3PGZA 2HDMA 3H0GG 5IWAQ 4X65Q 4JI3Q 1HQRD 1AN8A 4KK7A 3U9OA 2NTSA 5F2DA 1Z6HA 2R7ZB 4DK3C 1SYFA 1KBFA 3V2TA 1X3QA 1NBWA 1XNRQ 3PSIA 2CHBD 3GTGB 1SGRI 1C4QA 4A3EB 5CBEE 2WKDA 3TP5A 4A93B 1K3RA 3C2PA 3QAHA 4IPHA 2XTRA 1A62A 2Y0SE 5KEEA 3Q24A 4GKJQ 1HUNA 2F1MA 2R7ZH 2R93B 1YJWA 3GTGH 1CT1D 2LY7A 4OHJA 4DAMA 1MKHA 1DS3I 1IL8A 1VQAA 4A3EH 1CUKA 1EOTA 2Q2IA 3MTSA 4TRDA 2QQ0A 4A93H 1STYA 2WACA 1IW4A 1S5DD 5JJIA 3L0OA 4C3HB 3I73A 3S1QB 4QJFA 2NU2I 2R93H 3F8TA 3NBHA 2RC4A 5J3BA 2YQPA 1QVGA 1JOQA 3GTOB 3G7LA 1GUOA 3O13A 3R2TA
chains in the Genus database with same CATH topology
3TJQA 2JA8H 3UE1A 4C3HH 5GAGC 1OMTA 3S1QH 1V1QA 5FLXc 4OXPA 4U6RA 1YTPA 1H95A 3U4VA 3BZCA 1E1OA 1QVCA 3GTOH 2Q2TA 4LNQA 4AYBE 2UXCQ 5K36G 2QQCA 1C0AA 4TVAB 3KP9A 1FYBA 2V6EA 1KIXA 1FAQA 1YNXA 1ASZA 4OX9Q 1S3OA 2HHHL 4LF4Q 2AHOB 5FLMH 4DV4L 1NY4A 4A3IH 4PL4A 3I4NG 1TWCH 1KQSA 1VCIA 1SRUA 4C3JH 1XPRA 2VQEL 4JI5Q 2OCEA 4Y7NH 1EUJA 3L0IA 2MO0A 1K73C 1KRTA 4LF9L 1X54A 4OWXB 2UXBL 3OXLA 4YCUA 5LMUQ 2ORWA 3RNUA 1YIJA 4MNOA 4OONA 3DLLA 1CT4I 4LFBL 1XJVA 4JI1Q 2N78A 4LF6L 2JA7H 1PYBA 3P23A 4B3TL 3HKZE 1SMXA 4LFCL 1VQ7A 5IYCH 4P74A 3J80c 4G75A 4IPGA 3B6YA 1XMQL 1EOVA 1NE3A 3UDXA 3M4OH 2UUBQ 4KHZA 3J81i 1MIUA 4BA1I 3L7ZC 1V1HA 1OXVA 1DS2I 2A8VA 2VW9A 4BA2I 3HOZH 3E9IA 2UXDL 2VS1A 1H0ZA 4B3RL 4HFVA 1IBKL 4O1OA 2DB6A 1W4RA 3HOWH 1G6PA 5M3MH 2P22B 2KMQA 4A3LH 4GN5A 3ICEA 1L1OB 3K7UC 1PH6A 1BKBA 1X4SA 2JB1A 1YHQA 2R7ZG 4LWCA 1JJCB 1QZGA 5HQ8A 1U5KA 3RR5A 3JAMc 4A3EG 2GKRI 4A93G 4Q9VA 1IYJB 2AMCB 2AKWB 4B3ML 1PTRA 2CKZB 2NN6I 2R93G 4IPCA 1UUCA 2YTXA 4JC0A 1IBLQ 1X74A 4OWTB 2E8GA 4YCWA 5LMNW 4L5TA 4DR5L 1HNZQ 2IY5B 4DV3Q 1KHIA 3STBD 4A3GH 2ZTDA 1L0WA 2RHQB 4O0AA 1O7IA 3VDPA 1CKNB 2JEAI 2GN5A 1TOTA 1YJNA 1I50H 2QQDA 5JJKA 1CSPA 2JJQA 1OTCA 1YO7A 4B6DA 2ODDA 1LR8A 2AWNA 2B63H 1NMGA 5HI7A 1N33Q 5C4JH 4HJ5A 1I5FA 4A3IG 2JE6I 2I5MX 3OTOQ 2A20A 5CCLA 4HGUA 4HIDA 2FNFX 4QQBX 1PFSA 3OL0A 3RZDH 4NXNQ 3UEYA 5C0XI 4NV5A 2F66B 2UUBL 4MZ9A 3STBC 4B3SL 4JYAL 4Z7HA 4JI6Q 5IY0A 3CCJA 1ASYA 2OTLA 4R4QA 3G6EA 3RN5A 4YZDA 1P8LA 2EXDA 2JA7G 4NXML 4A75A 2D0PA 3F2DA 2Q2UA 1A0IA 2N1AB 2SGPI 1HR0W 4R4OA 2N17A 5IYCG 1VQJA 3T1YL 2E73A 4YWMA 2PI2E 3UDFA 5FJ8H 4HJ7A 5JEAG 4UY8C 4DWLA 2B8TA 1L1OC 5C0XJ 1I3QH 5C0XG 3DM3A 1IBMQ 2WVJA 4DR3Q 3HOZG 1E7ZA 3K8AA 4O1PA 3U4ZA 2BH8A 3HOUH 2A2CA 1N9WA 3DA4A 3PCOB 2KBNA 1Y8FA 3LJ2A 3HOWG 2KKMA 5M3MG 5M5YH 4PZ7A 4HIKA 1G291 3DO9A 5M3FH 4A3LG 4AQYL 2HIXA 2OQ0A 2ES2A 2NU3I 2F4VL 3AFPA 4ME3A 4QGUA 2XGTA 4A3JH 1N36L 2NZHA 3RLFA 3G48A 5GAEC 4OAUC 2IX1A 2KCXA 2LSSA 1PH2A 3E59A 1Q12A 2WFWA 1SLJA 1LYLA 1KC8C 1VQGA 1JE5A 3KJPA 1L1OA 1Q86C 2E2IH 1N34L 2CJSC 4J15A 3CXLA 3F4MA 2LXJA 1Q81C 2QA4A 4BY7H 1HNXL 4DV0L 4DR1L 2ALYB 3I55A 2CWAA 3UE0A 5IYBH 2NU1I 3BJIA 2E2JH 5M5XH 3S2DH 4LF8Q 2KMOA 1R0RI 2XTIA 4JBJA 4YWLA 1YZ6A 3CPWA 2B63G 3MEFA 4GXTA 3A74A 4DAYB 1MJCA 3CC4A 4TQUS 3EIVA 2K75A 3E2IA 1TWHH 4JV5L 2B0UC 1Z7KB 2PI2A 3F1ZA 2YYZA 2VNUD 5M5WH 2HHHQ 1VQNA 2NVTH 3WWVA 3H3VI 4DV4Q 4HJ8A 1Q82C 2V1CA 3D31A 4DK6C 1FJGL 1IXRA 1HZCA 4LUZA 2VQEQ 3M85A 4LF5Q 4DUZL 4LF9Q 2MO1A 2VY3A 2UXBQ 2CCZA 4PZ6A 3DA3A 4LFBQ 2WCYA 3UEJA 2JXDA 4X6AH 5FJ8G 2YFBA 4LF6Q 3E0EA 4A3FG 2QPOA 1PH7A 4B3TQ 1E22A 5C44H 1LUZA 4LFCQ 4JI2L 3SGQI 1SGDI 1V1IA 4UP9A 3OXFA 2ZM6L 1XMQQ 3PF4A 4GKKL 3HOUG 1VQ8A 3CF5A 4ALPA 1N13A 1Q1BA 5HY6A 5M3FG 2K5HA 4DNIA 2UXDQ 4PG3A 4B3RQ 1BBUA 4POGA 1SFOH 1IBKQ 4PL5A 2FUG1 1GVPA 2R7FA 3G71A 4A3JG 4IOAA 1X55A 4NB3A 1TBOA 2ZTCA 1PJUA 3RU0A 1AN1I 4QY7A 1J5EL 1VQCA 4X66Q 2F3IA 2N52A 4E1RA 4A3MH 3S1MH 3ULLA 3ULJA 4JBKA 1NTGA 4LF8L 2FXQA 4P72A 2K5VA 2EQSA 4BBRH 1X3GA 5EAYA 2K52A 1XNQL 2QEXA 1WYDA 1VQIA 4HEA1 4B3MQ 3HKSA 2J87A 2NVXH 1TGSI 1X56A 3BZKA 2QQEA 1HZAA 5IYBG 1I94L 2E2HH 4DR5Q 2WB1G 2IX0A 2N8NA 3PUXA 2VUMH 4JI0L 3LJ1A 4JI4L 1GKHA 1BVSA 5AJ3L 2JA6H 4OAVB 1D8LA 1C9OA 1EQQA 4LF5L 2L1LB 1E24A 4DUYQ 1V43A 2OQKA 3FHWA 3HOXH 4GLXA 4G76A 3M9BA 1Q7YC 1XMOL 1IL2A 1OXTA 3CP0A 1Z9FA 1OVOA 1C7YA 4NV2A 3BU2A 1TWAH 3K7AH 1UE6A 2UUAL 4PZ8A 4OVOA 2RIOA 4UXHA 2Y0SG 3S1NH 2GVIA 2B29A 2LEOA 1PTQA 3F2CA 4B3SQ 2K9HA 4JYAQ 1VQ9A 4JI7L 2N71A 4BXXH 2KHIA 1JMCA 4NXMQ 3H15A 1XBTA 3FKIH 5C44G 2E5RA 4YHHL 3T1YQ 2KCTA 2JYYA 1JB7A 2L7XA 1E3PA 1VQ6A 1TWGH 4AYBG 1PA6A 3PO2H 4X66L 1UE1A 4POFA 4XTCS 3AEVA 3EN2A 1OXUA 1OXSC 2VRWB 4UXJA 4YWKA 1Y1CA 2YTYA 5FUWA 3JC66 1VQMA 5FUXA 1SGEI 4AQYQ 3CCUA 2QGQA 4X62L 4NPSA 1HJPA 4L5RC 2F4VQ 2XRCA 3D00A 2ZRRA 4EX5A 2JB3A 3SEKC 1Z47A 3CCMA 4A3DH 3PV0A 1UE7A 1N36Q 1B8AA 4A3MG 4YZ9A 1N32L 1X6OA 2JA8G 1X3EA 1PH4A 1HNWL 3S2HH 4BBRG 2D62A 2OVOA 2KMPA 1TURA 3OYYA 3J7A5 1GD7A 4A3KH 2IT1A 2LXKA 3LGJA 3TS2A 2JZMA 1R79A 1K8GA 2ERWA 2UZ3A 4DUYL 1QZHA 3HKZG 4HIMA 4H02A 1KMAA 1CKOA 1LM0A 1N34Q 2JEBI 1WFQA 3UFFA 1PH3A 4JOIA 5FLMG 3F2BA 1PH5A 2ZJRA 3GOXA 1HNXQ 2VUMG 1PYSB 4DV0Q 1FARA 3IRBA 4DR1Q 2MNAA 1EWIA 1L2FA 1BBWA 2CFMA 2ASBA 3FBVA 2JA6G 3CCLA 1YBYA 4DV6L 2MFIA 4GS3A 1CT2I 5LMNL 3HOXG 3HOYH 4APVA 4GN3B 1EFWA 2YU9H 3CCRA 3BJUA 2DIPA 1FVIA 1LTLA 3JSBA 4JV5Q 1P16A 2VQFL 1TBRR 2CWPA 4DR2Q 4IJHA 4UPAA 4IOCA 1PCEA 1KXLA 1XA6A 4L9MA 1KL9A 2OWOA 4L5SA 4KHPQ 2PMZE 2RCNA 1FJGQ 2D0OA 4RG1A 4DUZQ 2YFAA 4BXXG 4GI3C 1IZ6A 3CMAA 1SGPI 2KMRA 1CHOI 3M4PA 4JBWA 3AFQA 1UWVA 3S24A 5DLQE 2SGFI 3S15H 3KY9A 2BH2A 2ID0A 2J9RA 5IP9H 4P71A 2K14A 3HFZB 1QUQB 3I4MH 4JI2Q 1NJIC 1HR0L 2ZM6Q 4GKKQ 3PF5A 2K19A 3ER0A 2JA5H 1SN8A 3KJOA 2F3CI 4OWWB 1RIPA 2K4KA 4I1TA 2SGEI 3HH2C 4DKAC 1CE3A 2ATWA 1LR9A 1SGQI 3AJFA 2VZAA 4OO1G 3RLNA 2BUSA 2V1CC 3GO5A 2Q2HA 2WAQE 1M1KC 3PO3H 4A3DG 5IE8A 1HJAI 2C35B 2XTQA 1J5EQ 4A3GG 1YVCA 5IP7H 4YY3L 4HJ9A 1OYVI 1YEZA 4IJLA 4A3BH 3GD7A 4IO9A 3A5ZB 2OTJA 1XPUA 3CCVA 3J80i 3T1HQ 5HGIA 3PUWA 3VE5A 1XNQQ 4YZCA 3G4SA 1M90C 3UDIA 4DR2L 2K5NA 3CW2C 1I94Q 1OXXK 5LNK1 3J81j 3KYHC 1EIFA 4LFAQ 4KHPL 3VDUA 3W1BA 2L8EA 4JI0Q 4JI4Q 3HOYG 4FKDA 4KI0A 5AJ3Q 1AH9A 3PUVA 1BMOA 4X64L 3ULPA 3K0XA 2DUDA 1XMOQ 2A19A 1HPTA 1EYGA 1X3FA 2A1AA 4DV5L 1IY6A 4KLKA 4UXIA 2NU0I 2UUAQ 1GM5A 2YV5A 2R92H 4DV2L 1DGSA 3CCEA 5GADC 3JAMi 2GVBA 3PUZA 1X65A 2NVQH 4JI8L 2YTVA 1MT1A 3CXCA 2WAQG 1CGII 4UP7A 1A8VA 1VQEA 2N3SA 1CSQA 1VQDA 3I9V1 4JI7Q 2CQOA 1Q8KA 4FDBA 4R4IA 1S40A 1WOCA 2M5XA 1TXYA 3L2PA 2JAEA 4DR6L 1WJJA 5IP9G 4GLAC 4R1JA 4YHHQ 4A24A 3I4MG 2UUCL 2ENNA 5C4XH 2IP6A 1PHJA 3M3YH 5ELNA 2JA5G 3TQYA 3M4QA 1AE2A 2I0QA 1PH9A 1FL0A 2AWOA 3W5OA 4GNXB 3AYHB 4AS2A 1XTDA 4IFDJ 2JA1A 4IFDG 1PH8A 1PH1A 4PL3A 1QUQA 2PNHA 4YCVA 3OW2A 4AIMA 3KLWA 3CQZH 1J6QA 3PO3G 3CPFA 3VA9A 2UU9L 3UDGA 3T1HL 1Y14B 4X62Q 3IAS1 4AS3A 1T9HA 4BY7G 2B3GA 5IP7G 1UEBA 1Y1VH 1N32Q 3K80C 4DR7L 3PIOA 4A3BG 1YHBA 2KCMA 3PDNA 3CC7A 4LFAL 3RZOH 1HNWQ 4WJ3M 2ENZA 2NVYH 1K9MC 2R7DA 3U50C 5H1SE 2K50A 3UITA 2YUUA 1B70B 3PUYA 4P73A 3TS0A 1TIHA 4A4IA 4GLVB 5GQOA 3KF6B 3J7ZC 1VQLA 3RLOA 4DV6Q 2ZTEA 1Y1BA 4K0KL 4C3IH 4BY1H 3GTPH 4LF7L 5LMNQ 4DV7Q 3QTLD 2PQAB 1QVFA 1WI5A 4DR4L 1VQFA 1WCMH 2BA0A 1Q1EA 4BBSH 2VL6A 2VQFQ 2Z0SA 1N8RC 1TBQR 2ELIA 2R92G 2F6MB 3GTMH 3B4VC 3GTJH 2W0TA 2BA1A 2E5LL 4GN4B 5JHWC 4JI3L 5IWAL 4X65L 3GTKH 1OMUA 3HOVH 1HZBA 1LR7A 1XNRL 2JA9A 1FGUA 2GKTI 4GNXC 3NELA 3U58A 3OXGA 1V9PA 4Z7GA 4GKJL 3TRZA 3FC3A 2SGDI 1XPOA 4JOIC 4C2MH 1TUSA 1W2BA 2KENA 5C4XG 3MEKA 4HIOA 4JBMA 4LUOA 3NEMA 1R9TH 3A0JA 2R6GA 1PVOA 1VDDA 1HR0Q 2HIVA 4EQ5A 2Z6KC 2UXCL 1UVFA 2RF4A 1VQHA 5CCMA 1SJ8A 1W3SA 1EIYB 3TEHB 3CD6A 4OX9L 3S16H 4GNXA 2DGYA 5FUYA 5HGQA 1VQKA 4LF4L 3S1RH 5GAHC 1Y1VG 1NUBA 2HQLA 4HJAA 1SGNI 4GOPB 1YI2A 4JI5L 1TWFH 3I4OA 1S72A 4YY3Q 2L15A 5BR8Q 1Y1WH 2ZJPA 5IT9c 3KF8B 2XMXA 2NN6G 5LMUL 4DV7L 3OVOA 1KAWA 2RHSB 4R4TA 3KDFB 4JI1L 2KHJA 4A76A 1VQPA 2Z6KA 4LUVA 3GTQH 1CSOI 1VQOA 3LJ0A 3ZJYC 1D7QA 4L5QA 3PIPA 2NU4I 4BY1G 2EIFA 3K81C 1YHAA 2A2DA 3MXNB 5C3EH 4QIWE 1WCMG 3W1GA 4MTNA 1PPFI 4BBSG 1RL2A 4XIGS 3RN2A 3NENA 1M8CA 1U0LA 2WP8J 4X64Q 4WJ4A 3KF6A 1KBEA 5IYDH 1KRSA 2CAZB 2ORVA 3FKIG 3A5UA 2P6AC 4DV5Q 3H3VH 4A3FH 5JEAJ 2PQAA 2LUYA 3HOVG 4OO1I 3I2ZA 4DPGA 1A63A 1VQ4A 3GDEA 4DV2Q 2JQOA 2JB2A 4A3CH 5DAEA 2MJFB 1KD1C 1UVGA 1VQ5A 5FUVA 3H0GH 3PO2G 2JK8A 4JI8Q 2JW6A 1EQRA 4R4CA 1Q46A 3NBHB 4UP8A 2GVAA 4SGBI 1E1TA 3S14H 4DV1Q 1GO3E 2NZOA 3SGBI 2I5HA 4RMFA 2IHFA 1MJEA 2I5LX 3SDJA 1CT0I 1B7YB 4QL5A 3D0FA 3J81c 4DR6Q 1IBLL 3KOJA 1XX6A 2UUCQ 1HNZL 4JG2A 3I56A 4DV3L 4E1PA 1SGYI 4GOPC 1JT8A 3CCSA 3E9HA 4AH6A 4LW1A 1CKMA 3Q8DA 1SR3A 1TBNA 2ARPF 1K83H 3CC2A 3QWPA 3TREA 3UGIA 4A3KG 3GTLH 5BR8L 2ROWA 1VS0A 3EBEA 1YU6C 1N33L 1SROA 4PMWA 2GKVA 1PV4A 3S17H 3OTOL 2UU9Q 1G51A 4O2DA 5E7NA 1K0RA 1JJGA 2H5XA 1UE5A 1AE3A 2ZJQA 4P75A 2MQHA 4NXNL 3I4NH 1BUSA 1Y1WG 4DR7Q 1YITA 1VQBA 1HDLA 5EX3A 3SGIA 4JI6L 5JJLA 1HH2P 1CKNA 1RFHA 4GOPA 2F52A 2SGQI 2OD1A 1YJ9A 1K8AC 3I7FA 5EX0A 4IPDA 3UGLA 5GROA 2HT1A 3CAMA 5C3EG 5ELOA 3CMEA 3KDFA 1IBML 1CGJI 4DR3L 4JCVE 1SE8A 2WB1E 3AQQA 4K0KQ 1I6HH 3FP9A 4LF7Q 4DR4Q 5IYDG 3CCQA 3KFUA 2V53A 3ERSX 3UGDA 3VDYA 4IFDI 1NMFA 3IAM1 2N49A 1X9NA 4DV1L 3M7NA 1M8BA 4Y52H 2IHEA 1JJ2A 4A3CG 1HZ9A 1IY5A 2E5LQ 3PGZA 3H0GG 5IWAQ 4X65Q 4JI3Q 4DK3C 1KBFA 1NBWA 1XNRQ 3PSIA 1SGRI 1K3RA 4IPHA 2XTRA 1A62A 2Y0SE 4GKJQ 2R7ZH 1YJWA 3GTGH 4DAMA 1MKHA 1DS3I 1VQAA 4A3EH 1CUKA 2Q2IA 2QQ0A 4A93H 1IW4A 5JJIA 3L0OA 4QJFA 2NU2I 2R93H 3F8TA 5J3BA 2YQPA 1QVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2M H;  1TWH H;  2RCN A;  4JV5 L;  1FJG Q;  2JA8 H;  2D0O A;  1W2B A;  2KEN A;  3UE1 A;  2PI2 A;  4RG1 A;  4C3H H;  3F1Z A;  2YYZ A;  5GAG C;  2VNU D;  5M5W H;  3S1Q H;  1V1Q A;  5FLX c;  4GKJ L;  4OXP A;  2HHH Q;  5C4X G;  3U4V A;  1VQN A;  1H95 A;  4DUZ Q;  3BZC A;  1E1O A;  1QVC A;  2NVT H;  4HIO A;  3WWV A;  2Q2T A;  4JBM A;  4LNQ A;  4AYB E;  4DV4 Q;  1IL2 A;  3GTO H;  3H3V I;  4HJ8 A;  1Q82 C;  2UXC Q;  5K36 G;  4LUO A;  1IZ6 A;  3NEM A;  1R9T H;  3D31 A;  3CMA A;  4DK6 C;  1C0A A;  3A0J A;  2R6G A;  4TVA B;  1FJG L;  1KIX A;  1IXR A;  1PVO A;  1HZC A;  1YNX A;  4LUZ A;  3M4P A;  2VQE Q;  1ASZ A;  4OX9 Q;  4JBW A;  3M85 A;  1HR0 Q;  1S3O A;  3AFQ A;  1UWV A;  2HIV A;  4EQ5 A;  4LF5 Q;  3S24 A;  2HHH L;  5DLQ E;  4DUZ L;  4LF4 Q;  2AHO B;  4LF9 Q;  5FLM H;  4DV4 L;  1NY4 A;  3S15 H;  2MO1 A;  2Z6K C;  2VY3 A;  4A3I H;  2UXC L;  2CCZ A;  2UXB Q;  2BH2 A;  2ID0 A;  2RF4 A;  3I4N G;  5IP9 H;  1TWC H;  1VQH A;  4P71 A;  4PZ6 A;  2K14 A;  3HFZ B;  1KQS A;  1QUQ B;  4BXX G;  1VCI A;  1W3S A;  3I4M H;  1SRU A;  4JI2 Q;  4C3J H;  1EIY B;  3TEH B;  1XPR A;  2VQE L;  3CD6 A;  4OX9 L;  4JI5 Q;  1NJI C;  1HR0 L;  4LFB Q;  3S16 H;  2ZM6 Q;  4GKK Q;  3PF5 A;  4GNX A;  4X6A H;  2DGY A;  3ER0 A;  2OCE A;  5FJ8 G;  4Y7N H;  2JA5 H;  5HGQ A;  1EUJ A;  1VQK A;  4LF4 L;  4LF6 Q;  3E0E A;  2MO0 A;  1SN8 A;  1K73 C;  1KRT A;  3KJO A;  4LF9 L;  3S1R H;  4A3F G;  1X54 A;  4OWW B;  1PH7 A;  4OWX B;  4B3T Q;  2UXB L;  5GAH C;  1RIP A;  1Y1V G;  2K4K A;  1E22 A;  5C44 H;  4DKA C;  1LUZ A;  4YCU A;  4LFC Q;  2HQL A;  4HJA A;  5LMU Q;  4JI2 L;  2ATW A;  3RNU A;  4GOP B;  4MNO A;  4OON A;  4JI5 L;  3DLL A;  1YI2 A;  4UP9 A;  1YIJ A;  4LFB L;  1TWF H;  2ZM6 L;  1XMQ Q;  3PF4 A;  4GKK L;  2VZA A;  1XJV A;  4OO1 G;  3RLN A;  3I4O A;  4JI1 Q;  1S72 A;  2V1C C;  4YY3 Q;  2N78 A;  3GO5 A;  2L15 A;  2Q2H A;  2WAQ E;  4LF6 L;  1M1K C;  2JA7 H;  3HOU G;  1PYB A;  5BR8 Q;  1VQ8 A;  1Y1W H;  3PO3 H;  2ZJP A;  4B3T L;  4A3D G;  3HKZ E;  5IT9 c;  3CF5 A;  5IE8 A;  4ALP A;  3KF8 B;  1SMX A;  2C35 B;  4LFC L;  1Q1B A;  5HY6 A;  1VQ7 A;  5IYC H;  5M3F G;  2NN6 G;  5LMU L;  2K5H A;  4DNI A;  4P74 A;  3J80 c;  4DV7 L;  2UXD Q;  1KAW A;  4PG3 A;  1J5E Q;  4IPG A;  3B6Y A;  2RHS B;  4R4T A;  1EOV A;  1BBU A;  1NE3 A;  1XMQ L;  3UDX A;  4POG A;  3KDF B;  4A3G G;  4B3R Q;  3M4O H;  4JI1 L;  2UUB Q;  2KHJ A;  1SFO H;  1IBK Q;  4A76 A;  1YVC A;  5IP7 H;  4YY3 L;  4HJ9 A;  1VQP A;  4KHZ A;  3J81 i;  1MIU A;  1GVP A;  1YEZ A;  2R7F A;  4IJL A;  3L7Z C;  4BA1 I;  3G71 A;  4A3B H;  3GD7 A;  1OXV A;  2Z6K A;  4A3J G;  4LUV A;  4IOA A;  1X55 A;  4IO9 A;  2A8V A;  2VW9 A;  3GTQ H;  4BA2 I;  4NB3 A;  3HOZ H;  2ZTC A;  3A5Z B;  1VQO A;  3E9I A;  2OTJ A;  1XPU A;  2UXD L;  3ZJY C;  2VS1 A;  4QY7 A;  1J5E L;  1D7Q A;  4L5Q A;  1VQC A;  4X66 Q;  4B3R L;  3CCV A;  3PIP A;  2F3I A;  4BY1 G;  2EIF A;  1IBK L;  3K81 C;  3J80 i;  3T1H Q;  1YHA A;  3PUW A;  1XNQ Q;  3HOW H;  3MXN B;  5C3E H;  4QIW E;  5M3M H;  4A3M H;  3S1M H;  1G6P A;  3ULL A;  1WCM G;  3W1G A;  4MTN A;  3ULJ A;  3G4S A;  1M90 C;  4JBK A;  4A3L H;  3UDI A;  1NTG A;  4DR2 L;  2K5N A;  1RL2 A;  2FXQ A;  4GN5 A;  4LF8 L;  3CW2 C;  4XIG S;  4BBS G;  4P72 A;  2K5V A;  2EQS A;  3RN2 A;  3ICE A;  3NEN A;  1I94 Q;  1OXX K;  1U0L A;  4BBR H;  2WP8 J;  4X64 Q;  3J81 j;  4WJ4 A;  1L1O B;  3KF6 A;  3KYH C;  3K7U C;  1EIF A;  1X3G A;  5EAY A;  5IYD H;  1KRS A;  4LFA Q;  1PH6 A;  2K52 A;  4KHP L;  1XNQ L;  3W1B A;  1BKB A;  2QEX A;  1WYD A;  4JI0 Q;  4JI4 Q;  3HOY G;  1VQI A;  3FKI G;  4B3M Q;  3A5U A;  3HKS A;  4DV5 Q;  1YHQ A;  4KI0 A;  3H3V H;  2NVX H;  1X56 A;  3BZK A;  5JEA J;  4A3F H;  5AJ3 Q;  1AH9 A;  2R7Z G;  4LWC A;  2PQA A;  3PUV A;  1JJC B;  1HZA A;  5IYB G;  1I94 L;  1QZG A;  3HOV G;  4OO1 I;  3I2Z A;  1U5K A;  4DPG A;  1A63 A;  2E2H H;  4X64 L;  1VQ4 A;  3RR5 A;  3GDE A;  3ULP A;  4DV2 Q;  3JAM c;  2JQO A;  4DR5 Q;  4A3E G;  3K0X A;  4A3C H;  2DUD A;  2WB1 G;  4A93 G;  1IYJ B;  1KD1 C;  2AMC B;  2AKW B;  1XMO Q;  2A19 A;  2IX0 A;  2N8N A;  3PUX A;  1EYG A;  2VUM H;  1X3F A;  1VQ5 A;  4JI0 L;  4JI4 L;  3H0G H;  1GKH A;  4B3M L;  1BVS A;  2A1A A;  4DV5 L;  2CKZ B;  3PO2 G;  2NN6 I;  2R93 G;  4KLK A;  2JK8 A;  4IPC A;  4JI8 Q;  5AJ3 L;  2JA6 H;  1D8L A;  1C9O A;  1EQQ A;  2YTX A;  1EQR A;  4JC0 A;  4R4C A;  1IBL Q;  2UUA Q;  4OWT B;  2E8G A;  1GM5 A;  4LF5 L;  2YV5 A;  1E24 A;  1Q46 A;  4YCW A;  3NBH B;  4DUY Q;  5LMN W;  2R92 H;  1V43 A;  2OQK A;  3FHW A;  4UP8 A;  4DV2 L;  3HOX H;  4L5T A;  4DR5 L;  1HNZ Q;  2GVA A;  4GLX A;  1N33 Q;  2IY5 B;  4DV3 Q;  1E1T A;  3M9B A;  3S14 H;  4DV1 Q;  1DGS A;  1Q7Y C;  1KHI A;  3STB D;  4A3G H;  1GO3 E;  1OXT A;  2NZO A;  2ZTD A;  3CP0 A;  3CCE A;  1XMO L;  2I5H A;  1Z9F A;  2IHF A;  4RMF A;  5GAD C;  3JAM i;  1MJE A;  1L0W A;  2I5L X;  2RHQ B;  1C7Y A;  2GVB A;  3PUZ A;  4O0A A;  1O7I A;  1B7Y B;  1X65 A;  3BU2 A;  1TWA H;  1CKN B;  2JEA I;  3K7A H;  4QL5 A;  2NVQ H;  1UE6 A;  4JI8 L;  2GN5 A;  2YTV A;  3D0F A;  1YJN A;  3CXC A;  2WAQ G;  1I50 H;  3J81 c;  4DR6 Q;  1IBL L;  2UUA L;  4UP7 A;  3KOJ A;  1A8V A;  5JJK A;  1CSP A;  1VQE A;  2JJQ A;  1OTC A;  4PZ8 A;  2N3S A;  2UUC Q;  1CSQ A;  1HNZ L;  4JG2 A;  3I56 A;  4DV3 L;  1VQD A;  4JI7 Q;  2AWN A;  2B63 H;  1NMG A;  2CQO A;  4GOP C;  1JT8 A;  1Q8K A;  4FDB A;  4R4I A;  5C4J H;  3E9H A;  4AH6 A;  3CCS A;  1S40 A;  4LW1 A;  2Y0S G;  1CKM A;  1WOC A;  3Q8D A;  1SR3 A;  4HJ5 A;  1I5F A;  3S1N H;  4A3I G;  2JE6 I;  2B29 A;  1TXY A;  3L2P A;  2I5M X;  1K83 H;  3OTO Q;  1WJJ A;  3CC2 A;  4DR6 L;  5IP9 G;  4GLA C;  4R1J A;  4YHH Q;  4HID A;  3TRE A;  3F2C A;  4B3S Q;  3I4M G;  2UUC L;  4JYA Q;  4A3K G;  3GTL H;  5C4X H;  5BR8 L;  1VQ9 A;  1PHJ A;  4QQB X;  4JI7 L;  1VS0 A;  3EBE A;  4BXX H;  3M3Y H;  5ELN A;  2JA5 G;  1PFS A;  2KHI A;  3TQY A;  1N33 L;  1SRO A;  1JMC A;  4PMW A;  4NXM Q;  3M4Q A;  1AE2 A;  3H15 A;  3RZD H;  2I0Q A;  1PH9 A;  1FL0 A;  2AWO A;  4NXN Q;  3FKI H;  3W5O A;  5C0X I;  1PV4 A;  4GNX B;  3S17 H;  3AYH B;  5C44 G;  3OTO L;  2UU9 Q;  4YHH L;  2UUB L;  1XTD A;  4IFD J;  4MZ9 A;  3STB C;  4B3S L;  3T1Y Q;  4IFD G;  1G51 A;  4O2D A;  4JYA L;  2KCT A;  4JI6 Q;  5E7N A;  5IY0 A;  3CCJ A;  1PH8 A;  1JB7 A;  1ASY A;  2OTL A;  4R4Q A;  1PH1 A;  1K0R A;  3G6E A;  1JJG A;  2H5X A;  1UE5 A;  3RN5 A;  1AE3 A;  1QUQ A;  2PNH A;  4YCV A;  3OW2 A;  1E3P A;  1P8L A;  2EXD A;  4AIM A;  3KLW A;  2JA7 G;  2ZJQ A;  1TWG H;  1VQ6 A;  4P75 A;  3CQZ H;  4NXM L;  4AYB G;  2MQH A;  1J6Q A;  2D0P A;  4NXN L;  3F2D A;  4A75 A;  3I4N H;  1Y1W G;  3PO3 G;  1YIT A;  2Q2U A;  4DR7 Q;  3CPF A;  1PA6 A;  3PO2 H;  1A0I A;  4X66 L;  1UE1 A;  2UU9 L;  1VQB A;  1HR0 W;  4R4O A;  3UDG A;  4POF A;  1VQJ A;  4XTC S;  5IYC G;  3T1H L;  1Y14 B;  4X62 Q;  3T1Y L;  3AEV A;  3EN2 A;  4YWM A;  1OXU A;  2PI2 E;  1OXS C;  3UDF A;  3SGI A;  4JI6 L;  5FJ8 H;  5JJL A;  1T9H A;  4BY7 G;  1HH2 P;  4YWK A;  4HJ7 A;  2B3G A;  2YTY A;  1CKN A;  5IP7 G;  5JEA G;  1UEB A;  4UY8 C;  1Y1V H;  1L1O C;  4GOP A;  5C0X J;  3JC6 6;  1N32 Q;  1I3Q H;  3K80 C;  1VQM A;  4DR7 L;  2F52 A;  5C0X G;  3DM3 A;  3PIO A;  4A3B G;  1YHB A;  2KCM A;  1IBM Q;  1YJ9 A;  1K8A C;  3I7F A;  4AQY Q;  4DR3 Q;  3CC7 A;  3CCU A;  1E7Z A;  3HOZ G;  4LFA L;  4IPD A;  2QGQ A;  4X62 L;  3RZO H;  1HNW Q;  4NPS A;  1HJP A;  4L5R C;  2F4V Q;  4WJ3 M;  3K8A A;  4EX5 A;  3U4Z A;  2BH8 A;  2NVY H;  1Z47 A;  1K9M C;  1N9W A;  2R7D A;  3HOU H;  3U50 C;  3CCM A;  5GRO A;  3PCO B;  2KBN A;  2HT1 A;  3PV0 A;  1UE7 A;  3CAM A;  5H1S E;  1N36 Q;  3HOW G;  2K50 A;  4A3D H;  5C3E G;  1B8A A;  5ELO A;  4A3M G;  5M3M G;  5M5Y H;  1N32 L;  4PZ7 A;  4HIK A;  1G29 1;  3CME A;  3KDF A;  5M3F H;  4A3L G;  1X6O A;  1IBM L;  2JA8 G;  1B70 B;  1X3E A;  2HIX A;  4AQY L;  4DR3 L;  2OQ0 A;  3PUY A;  2ES2 A;  4JCV E;  4P73 A;  1PH4 A;  1HNW L;  1SE8 A;  3S2H H;  2WB1 E;  3AQQ A;  2D62 A;  4BBR G;  2F4V L;  4K0K Q;  1I6H H;  3AFP A;  3FP9 A;  3TS0 A;  3OYY A;  4LF7 Q;  3J7A 5;  4ME3 A;  4A4I A;  1GD7 A;  4A3K H;  4DR4 Q;  5IYD G;  4QGU A;  3CCQ A;  4GLV B;  2IT1 A;  5GQO A;  3KFU A;  2LXK A;  3LGJ A;  3TS2 A;  2XGT A;  4A3J H;  3ERS X;  1N36 L;  2NZH A;  1K8G A;  3RLF A;  3KF6 B;  3J7Z C;  3VDY A;  1VQL A;  4DUY L;  1QZH A;  3RLO A;  3HKZ G;  4HIM A;  3G48 A;  4IFD I;  1NMF A;  4H02 A;  2N49 A;  5GAE C;  1CKO A;  1LM0 A;  1X9N A;  4DV1 L;  1N34 Q;  4DV6 Q;  2IX1 A;  2ZTE A;  2LSS A;  3M7N A;  2JEB I;  1PH2 A;  1WFQ A;  4K0K L;  4C3I H;  4Y52 H;  2IHE A;  4BY1 H;  3GTP H;  1Q12 A;  1PH3 A;  4JOI A;  1JJ2 A;  4LF7 L;  5LMN Q;  2WFW A;  4DV7 Q;  4A3C G;  1HZ9 A;  2PQA B;  5FLM G;  1QVF A;  1SLJ A;  1LYL A;  1WI5 A;  3F2B A;  1KC8 C;  4DR4 L;  1VQF A;  1PH5 A;  1WCM H;  2ZJR A;  1VQG A;  1Q1E A;  2BA0 A;  1JE5 A;  1HNX Q;  2E5L Q;  2VUM G;  3PGZ A;  3KJP A;  1L1O A;  1PYS B;  3H0G G;  4DV0 Q;  5IWA Q;  3IRB A;  4X65 Q;  4DR1 Q;  2MNA A;  1EWI A;  1L2F A;  1BBW A;  4JI3 Q;  4BBS H;  1Q86 C;  2CFM A;  2ASB A;  2E2I H;  2JA6 G;  2VL6 A;  4DK3 C;  1YBY A;  2VQF Q;  1N34 L;  3CCL A;  2Z0S A;  4J15 A;  1NBW A;  4DV6 L;  1N8R C;  1XNR Q;  3PSI A;  2MFI A;  4GS3 A;  2R92 G;  2LXJ A;  3HOX G;  5LMN L;  1K3R A;  3GTM H;  4APV A;  3HOY H;  1Q81 C;  2QA4 A;  4GN3 B;  1EFW A;  4IPH A;  3GTJ H;  2YU9 H;  4BY7 H;  1A62 A;  3CCR A;  2BA1 A;  2Y0S E;  1HNX L;  3BJU A;  2E5L L;  1FVI A;  1LTL A;  4GKJ Q;  4GN4 B;  4DV0 L;  4JI3 L;  5IWA L;  4X65 L;  2ALY B;  3I55 A;  4DR1 L;  2CWA A;  2R7Z H;  1YJW A;  3UE0 A;  3GTK H;  5IYB H;  3HOV H;  1HZB A;  3GTG H;  4JV5 Q;  1P16 A;  2VQF L;  4DAM A;  1MKH A;  2E2J H;  1VQA A;  5M5X H;  4A3E H;  2JA9 A;  1XNR L;  1CUK A;  1FGU A;  2Q2I A;  2CWP A;  3S2D H;  4DR2 Q;  4LF8 Q;  4A93 H;  4IJH A;  4UPA A;  4IOC A;  4GNX C;  5JJI A;  3NEL A;  3U58 A;  1KXL A;  3L0O A;  2XTI A;  4JBJ A;  1V9P A;  1YZ6 A;  4YWL A;  4QJF A;  3CPW A;  2R93 H;  3F8T A;  2B63 G;  5J3B A;  3MEF A;  1KL9 A;  3A74 A;  4DAY B;  1MJC A;  1QVG A;  3CC4 A;  2OWO A;  4L5S A;  3TRZ A;  4KHP Q;  4TQU S;  1XPO A;  3EIV A;  2K75 A;  2PMZ E;  4JOI C; 
#chains in the Genus database with same CATH topology
 1CK1 A;  3RZO B;  1F2L A;  3TJQ A;  2RAD A;  2JA8 H;  1EZ8 A;  3N6R A;  3UE1 A;  4C3H H;  5GAG C;  2MP1 A;  1OMT A;  3S1Q H;  1V1Q A;  1YNJ C;  5FLX c;  2OF1 A;  4OXP A;  4U6R A;  1YTP A;  1RTN A;  1CHP D;  1S5C D;  1H95 A;  3MFG A;  3U4V A;  4DAV A;  2ICI A;  3BZC A;  5E4X A;  3EVQ A;  1ROD A;  1E1O A;  2QF7 A;  3IL8 A;  1QVC A;  3GTO H;  3E0J A;  2Q2T A;  4LNQ A;  4AYB E;  2F0S A;  2UXC Q;  5K36 G;  5LL6 X;  2QQC A;  4FF1 A;  4A3I B;  5CGK A;  1C0A A;  2L5T A;  3QWN A;  4TVA B;  3KP9 A;  5IGG A;  2V6E A;  1KIX A;  1FYB A;  1TWC B;  1FAQ A;  1NNX A;  1YNX A;  1GUN A;  1ASZ A;  4OX9 Q;  2RSO A;  3DMU A;  1S3O A;  4C3J B;  2HHH L;  1DCZ A;  1H9M A;  4LF4 Q;  1SYD A;  1Q90 A;  1WTR A;  2OEO A;  2AHO B;  5FLM H;  5CV6 A;  4Y7N B;  4DV4 L;  1NY4 A;  1ILQ A;  1R4Q B;  1RTO A;  4A3I H;  5I6W A;  4PL4 A;  3I4N G;  1TWC H;  4CKE A;  1KQS A;  4V19 0;  1VCI A;  3E3X A;  1EYD A;  1SRU A;  4C3J H;  1K0S A;  1XPR A;  2VQE L;  3GV6 A;  4CBV A;  4JI5 Q;  4H13 C;  2F0L A;  5EKK A;  2OCE A;  4Y7N H;  1O7Z A;  1EUJ A;  4KKS A;  4DXG A;  3L0I A;  2MO0 A;  1K73 C;  1KRT A;  4LF9 L;  1X54 A;  2B2U C;  4OWX B;  2UXB L;  1B3A A;  2JA7 B;  4ODG A;  4O42 A;  3OXL A;  4YCU A;  3BVM A;  3K5N A;  2B2W C;  4LJZ C;  5LMU Q;  2ORW A;  3RNU A;  1YIJ A;  1XXG A;  1BR9 A;  4MNO A;  4OON A;  3DLL A;  4LFB L;  1CT4 I;  1XJV A;  4JI1 Q;  4C56 C;  2L1B A;  1WTH A;  4H44 C;  1ZKO A;  1AEX A;  2N78 A;  4LF6 L;  1PFN A;  4DAY A;  2JA7 H;  3M4O B;  2EY1 A;  1PYB A;  4DFA A;  3P23 A;  4B3T L;  3HKZ E;  4ID6 A;  1Z7T A;  1SMX A;  2DNC A;  4LFC L;  1VQ7 A;  5IYC H;  3VR4 A;  7WGA A;  4P74 A;  5BN4 A;  3J80 c;  4G75 A;  3HOZ B;  9WGA A;  1LO5 D;  4IPG A;  3B6Y A;  1XMQ L;  1EOV A;  1NE3 A;  3UDX A;  3M4O H;  4IUP A;  2UUB Q;  1IKM A;  4EQN A;  5JEA H;  4F8M A;  4KHZ A;  1PZJ D;  3J81 i;  1MIU A;  4IUU A;  4FXG C;  4RFB A;  4BA1 I;  3L7Z C;  5C0X H;  3HOW B;  3NUC A;  1V1H A;  4J1M A;  1OXV A;  5M3M B;  1DS2 I;  2A8V A;  2VW9 A;  4BA2 I;  3HOZ H;  4RWS C;  3E9I A;  3C46 A;  2PZT A;  1EY8 A;  2FMC A;  2UXD L;  2VS1 A;  3D4D A;  5J8F A;  1H0Z A;  3K5M A;  4B3R L;  1KDC A;  4HFV A;  3FPP A;  2SOB A;  1IBK L;  4O1O A;  2DB6 A;  1UAP A;  2V4D A;  1W4R A;  3HOW H;  2EY2 A;  1G6P A;  5M3M H;  2P22 B;  2KMQ A;  4G7Z C;  4N9T A;  4A3L H;  4GN5 A;  1SXT A;  3DEO A;  3ICE A;  1DOL A;  1S5E D;  2AQ1 B;  1L1O B;  1WGC A;  1TVX A;  3K7U C;  4JK1 C;  1PH6 A;  1RDP D;  1EIH A;  2CQA A;  1BKB A;  1X4S A;  4KKU A;  4UAI A;  2JB1 A;  4CJ1 B;  1YHQ A;  4NW2 A;  2AUJ D;  3WOF A;  4RH6 A;  2R7Z G;  4LWC A;  1ULM A;  1O7L A;  3UI2 A;  1JJC B;  1QZG A;  2EYM A;  5HQ8 A;  1MJ9 A;  1U5K A;  1SNP A;  5JVG 3;  3RR5 A;  3JAM c;  2MGS A;  4A3E G;  2GKR I;  2B2V C;  2D5D A;  4K2K A;  4A93 G;  4Q9V A;  1IYJ B;  2AMC B;  2AKW B;  4MN3 A;  4OEM B;  1U4P A;  3BYT B;  4B3M L;  1PTR A;  2CKZ B;  2NN6 I;  2R93 G;  3DHQ A;  4QIW B;  4IPC A;  3H09 A;  1EQT A;  1UUC A;  2YTX A;  4JC0 A;  3VYU A;  1IBL Q;  1X74 A;  4OWT B;  2E8G A;  1D5X C;  1SYB A;  2WKC A;  4YCW A;  5LMN W;  1I50 B;  2PO4 A;  4L5T A;  1G2S A;  4DR5 L;  1HNZ Q;  2IY5 B;  4DV3 Q;  4C3H G;  2PPB C;  4KD4 A;  1KHI A;  3STB D;  4A3G H;  2ZTD A;  4H7B A;  1L0W A;  1QE6 A;  2RHQ B;  4O0A A;  4ZQ3 A;  1EWC A;  1O7I A;  3VDP A;  4FF2 A;  1CKN B;  2B63 B;  2JEA I;  1GUG A;  1TS3 A;  2GN5 A;  5C4J B;  1TOT A;  1YJN A;  3I91 A;  1I50 H;  2QQD A;  5JJK A;  2F0E A;  1CSP A;  2JJQ A;  1OTC A;  1YO7 A;  2K33 A;  3VR5 A;  2ZXO A;  3NQT A;  1TS2 A;  4B6D A;  2ODD A;  1SE4 A;  1JR0 D;  1LR8 A;  2AWN A;  4F87 A;  2B63 H;  1NMG A;  5HI7 A;  2C5C A;  1N33 Q;  1EWH A;  4K5V A;  5C4J H;  4IZ8 A;  4HJ5 A;  2O5J C;  1I5F A;  4A3I G;  5A35 A;  1JWM D;  2JE6 I;  1RKN A;  2I5M X;  3RZD B;  3OTO Q;  5J8C A;  2A20 A;  5CCL A;  4HGU A;  4QF4 A;  4HID A;  1FY7 A;  2FNF X;  4C3J G;  2B2V A;  3VA5 A;  4QQB X;  2QIL A;  4JW0 A;  4FNF A;  1PFS A;  1FD7 D;  1H9S B;  4FXD A;  3IKJ A;  3OL0 A;  3RZD H;  4NXN Q;  3UEY A;  3Q6S A;  1JOO A;  5C0X I;  3DM1 A;  4NV5 A;  2F66 B;  1L0X B;  4RGO S;  2VB2 X;  2UUB L;  1KAB A;  4MZ9 A;  3STB C;  4B3S L;  4XQQ A;  4JYA L;  3OWE B;  1ML0 D;  4Z7H A;  4JI6 Q;  5IY0 A;  3CCJ A;  3T51 B;  1ASY A;  4G7O C;  2OTL A;  2GA4 B;  4R4Q A;  1GHK A;  5KND A;  3G6E A;  3RN5 A;  4YZD A;  1JC7 A;  2N88 A;  1STB A;  2QDB A;  2Z1C A;  1GXD C;  3UOE A;  1P8L A;  2EXD A;  1EEF D;  2JA7 G;  4A3F B;  4NXM L;  4A75 A;  2D0P A;  3F2D A;  4KD3 A;  2Q2U A;  2RLD A;  3KK7 A;  1HPC A;  1A0I A;  2N1A B;  1I3Q B;  2SGP I;  5L37 A;  1HR0 W;  4R4O A;  2N17 A;  5IYC G;  1VQJ A;  2B2Y C;  1BF4 A;  3T1Y L;  2E73 A;  4YWM A;  2PI2 E;  4XYQ A;  3UDF A;  2I07 B;  5FJ8 H;  4BWG B;  3IFT A;  3LX0 A;  5E4W C;  4HJ7 A;  1DOM A;  1U9R A;  1UUP A;  5JEA G;  4UY8 C;  4DWL A;  2B8T A;  5ELB A;  1L1O C;  3HOU B;  4EQO A;  5IOC A;  5C0X J;  1I3Q H;  5CV8 A;  1STH A;  5C0X G;  3DM3 A;  1IBM Q;  5M5Y B;  2WVJ A;  4U67 3;  4DR3 Q;  5M3F B;  1E7Z A;  1SAP A;  3HOZ G;  2FJ2 A;  4RHR A;  2A69 D;  1HCZ A;  1WTP A;  1Y8P B;  3K8A A;  4O1P A;  1TU2 B;  3U4Z A;  2BH8 A;  2J0T D;  4N8F A;  3Q23 A;  2A2C A;  1N9W A;  2QW7 A;  2XRS D;  3HOU H;  3DA4 A;  1EFI D;  4K8I A;  1D1I A;  3PCO B;  2J7Z A;  2KBN A;  4G57 A;  4TSS A;  1G6Z A;  1S20 A;  1Y8F A;  3LJ2 A;  3HOW G;  2KKM A;  4IUT A;  5FO8 B;  5M3M G;  2X69 A;  5M5Y H;  4PZ7 A;  4HIK A;  1G29 1;  3DO9 A;  4A3J B;  5M3F H;  4A3L G;  1HUM A;  2E76 C;  2F0K A;  3GP7 A;  4AQY L;  2HIX A;  3SK6 A;  2FU2 A;  2OQ0 A;  1E2W A;  2ES2 A;  3QJY A;  1C48 A;  3KLS X;  2NU3 I;  2F4V L;  3AFP A;  4QCL A;  2KED A;  4ME3 A;  4QGU A;  1CZW A;  2XGT A;  2F0G A;  4A3J H;  1N36 L;  2NZH A;  3HG9 A;  3RLF A;  3BDL A;  3IAY A;  3HZX A;  3G48 A;  4OGQ C;  2DKV A;  3CRL C;  1Q3L A;  5GAE C;  3VYT A;  1KDB A;  1TR5 A;  4OAU C;  2IX1 A;  1PRT F;  5LHY 1;  2LSS A;  2KCX A;  2K7V A;  5T1G A;  1BQQ T;  2B2Y A;  1PH2 A;  2E2I B;  3E59 A;  4FF4 A;  1KTK A;  1Q12 A;  5D14 A;  1CI3 M;  2CW0 D;  2WFW A;  1II3 A;  3CHB D;  1SLJ A;  1LYL A;  1KC8 C;  1JE4 A;  1NAP A;  1VQG A;  1JE5 A;  4BS9 A;  1E0B A;  3TSS A;  1L1O A;  1LTB D;  4CHT B;  3KJP A;  1PYW D;  1VDZ A;  5FO9 B;  1Q86 C;  4PQX A;  1GUW A;  2KA7 A;  3HGB A;  4FF3 A;  2OZU A;  2FEF A;  2E2I H;  3R5A A;  1X32 A;  1N34 L;  2CJS C;  4RGM A;  4J15 A;  3CXL A;  3HS0 C;  3VYR A;  4ZYS A;  5JPM C;  3F4M A;  2E2J B;  5M5X B;  1E2V A;  2LXJ A;  2WB1 B;  5C3W A;  2M00 A;  2R61 A;  1Q81 C;  2QA4 A;  4AML A;  4BY7 H;  4K5W A;  3C1E A;  4EGV A;  1HNX L;  4DV0 L;  3NTI A;  4DR1 L;  2ALY B;  3I55 A;  2CWA A;  1WKX A;  3E6Z X;  1PZI D;  4ABN A;  3ND8 A;  3UE0 A;  5IYB H;  2OXP A;  4XDX A;  4DXF A;  5KGU A;  2NU1 I;  3BJI A;  3RMH A;  2JP1 A;  2E2J H;  5M5X H;  5ELF A;  2XVS A;  1I4P A;  3S2D H;  1TWH B;  4LF8 Q;  3IFD A;  2RQX A;  2IJ0 A;  2ZW3 A;  2KMO A;  1R0R I;  2XTI A;  2MUY A;  4JBJ A;  1JOK A;  2QDL A;  5M5W B;  4YWL A;  1YZ6 A;  1MI2 A;  4MTK A;  3CPW A;  2IPK D;  3D8G A;  2B63 G;  3MEF A;  4GXT A;  3A74 A;  4DAY B;  1MJC A;  4NDX A;  3CC4 A;  3QG1 A;  2NVT B;  4TQU S;  4XXE A;  3EIV A;  2XWB B;  2K75 A;  1J9O A;  1IYU A;  3E2I A;  1TWH H;  4JV5 L;  2B0U C;  1Z7K B;  1PRT D;  2CW0 C;  5FK9 C;  4L6T B;  4S3S A;  3H3V C;  5BN3 A;  2PI2 A;  1J8I A;  3F1Z A;  2YYZ A;  3A8J E;  2FMM A;  2VNU D;  4YIJ A;  3SEB A;  5M5W H;  2HHH Q;  3TO7 A;  1VF5 C;  3CU7 A;  1VQN A;  1SJE D;  2IL8 A;  4DAP A;  2NVT H;  3WWV A;  3H3V I;  4FXK C;  4DV4 Q;  4HJ8 A;  1Q82 C;  2Y0S B;  2V1C A;  1HFG A;  3D31 A;  4RKL A;  4DK6 C;  1F9S A;  1BOS A;  1FJG L;  3NK9 A;  5A2Q L;  1IXR A;  3CKI B;  1HZC A;  4LUZ A;  2VQE Q;  3M85 A;  4KMU C;  4LF5 Q;  1PDQ A;  1EEI D;  4DUZ L;  1WTX A;  5I9P A;  5KYL A;  4LF9 Q;  5JOB A;  1W6J A;  4ZAI A;  4HMI A;  2MO1 A;  2VY3 A;  2UXB Q;  2CCZ A;  1TKW B;  1EY0 A;  2ICE C;  4PZ6 A;  1BBX C;  4CDE C;  5C44 B;  1H9S A;  3DA3 A;  2HCC A;  4LFB Q;  2WCY A;  3UEJ A;  2JXD A;  4X6A H;  1QIL A;  5FJ8 G;  2F0F A;  2YFB A;  4LF6 Q;  3E0E A;  4A3F G;  2BL7 A;  2QPO A;  1BXT A;  1H9K A;  1PH7 A;  4B3T Q;  3K5L A;  1E22 A;  4AYB B;  4HCE A;  5C44 H;  4ILW A;  1LUZ A;  4LFC Q;  1D5Z C;  1JQO A;  2KEC A;  5IGB A;  4JI2 L;  3SGQ I;  1ZYR C;  1SGD I;  2KQ3 A;  1V1I A;  4UP9 A;  3OXF A;  4KN4 C;  2ZM6 L;  1XMQ Q;  3PF4 A;  4GKK L;  4UHV A;  2F0W A;  3P7J A;  5A2Q E;  3KLR A;  3HOU G;  1SFO B;  1VQ8 A;  4RCO A;  1EY7 A;  3CF5 A;  4ALP A;  1N13 A;  5C3X A;  2KVM A;  1Q1B A;  5HY6 A;  3ERQ A;  5M3F G;  1SSO A;  1SND A;  2K5H A;  4DNI A;  1K8O A;  1V1P B;  2UXD Q;  2F0I A;  1L0Y B;  4PG3 A;  4CDF C;  1BBU A;  3FNB A;  3BZD B;  4B3R Q;  4POG A;  3R5C A;  3A7A B;  4OEL B;  1QOH A;  1SFO H;  1IBK Q;  2QSB A;  5CR3 A;  4PL5 A;  1NSN S;  2FUG 1;  1GVP A;  2R7F A;  4CJ2 C;  3G71 A;  4DK0 A;  4A3J G;  1AFP A;  4A3M B;  3S1M B;  4IOA A;  1X55 A;  4NB3 A;  1TBO A;  2JA8 B;  2EY6 A;  2ZTC A;  1PJU A;  1EYA A;  3R3O A;  3RU0 A;  1AN1 I;  4QY7 A;  1J5E L;  1SE3 A;  1VQC A;  4X66 Q;  2XIW A;  4BBR B;  1SMY D;  1JWS D;  2F3I A;  2N52 A;  4E1R A;  4A3M H;  3S1M H;  2IW3 A;  2R3Z A;  3ULL A;  1JWU D;  1SYC A;  3FDT A;  4L63 B;  1SNQ A;  3T56 B;  1PTO B;  3ULJ A;  3VA7 A;  1NTG A;  4JBK A;  2F0J A;  4LF8 L;  2FXQ A;  1CFM A;  3HKZ B;  5D65 A;  2F0P A;  4P72 A;  2K5V A;  2EQS A;  2NVX B;  2KEE A;  4BBR H;  3TO9 A;  2K05 A;  4WFN 3;  2RVL A;  3MXP A;  1X3G A;  5EAY A;  2E2H B;  1F9Q A;  4TKO B;  2K52 A;  2LMC B;  1XNQ L;  2QEX A;  1WYD A;  1PTO H;  1VQI A;  4HEA 1;  4B3M Q;  3HKS A;  3SXH A;  2J87 A;  4DN4 M;  5C6A A;  2VUM B;  2E2D C;  4KJO A;  2NVX H;  2RKS A;  1X56 A;  3BZK A;  1I4X A;  2M2L A;  4X3U A;  1TGS I;  1WTJ A;  5ELE A;  1B4O A;  2QQE A;  1HZA A;  5IYB G;  1I94 L;  2JA6 B;  1HRJ A;  2E2H H;  2EOT A;  2XWJ B;  4DR5 Q;  2WB1 G;  3EA6 A;  4R9W A;  5G3L D;  3V96 A;  3HOX B;  4F7X A;  2IX0 A;  2N8N A;  2RBM A;  3PUX A;  2VUM H;  5IGF A;  3OOC A;  3LJ1 A;  3OMG A;  4JI0 L;  4JI4 L;  1GKH A;  5D3I B;  1BVS A;  3D4W A;  1O78 A;  1SJH D;  1EIG A;  5AJ3 L;  2JA6 H;  4OAV B;  1D8L A;  1C9O A;  1TWA B;  1T5X D;  2L55 A;  1EQQ A;  3K7A B;  4LF5 L;  1SMY C;  3RD4 A;  1EZ6 A;  2L1L B;  3H6M A;  3J81 L;  1E24 A;  4DUY Q;  1V43 A;  2I46 A;  2OQK A;  3FHW A;  3HOX H;  4GLX A;  2HGK A;  4G76 A;  3M9B A;  4KTA A;  2BE5 C;  2X6G A;  1Q7Y C;  2C9O A;  1XMO L;  1OXT A;  4EVO A;  3CP0 A;  1IL2 A;  1Z9F A;  1OVO A;  1C7Y A;  5COR A;  3ND9 A;  4NV2 A;  3BU2 A;  1TWA H;  3K7A H;  1QCB D;  1UE6 A;  1ZEQ X;  5FKA C;  4X3S A;  4ZKC B;  4I7A A;  2K5D A;  4XT3 B;  3S1N B;  2UUA L;  4PZ8 A;  4OVO A;  2RIO A;  2PW7 A;  2ZT9 C;  4HR7 B;  4UXH A;  1LAC A;  5J39 A;  1QJO A;  1EY4 A;  1STN A;  2Y0S G;  3S1N H;  5EJW A;  2GVI A;  2EYH A;  1DM0 B;  2B29 A;  2LEO A;  1PTQ A;  3F2C A;  4B3S Q;  2K9H A;  4JYA Q;  4XQJ A;  4IUR A;  3PIP 3;  1B3Q A;  1VQ9 A;  3URY A;  4JI7 L;  2N71 A;  2H1E A;  4BXX H;  1A2U A;  2EDG A;  4NKL A;  2KHI A;  1B9M A;  1JMC A;  4R8I A;  4NXM Q;  3P75 A;  3DEP A;  3H15 A;  1XBT A;  2F0Q A;  1R4P B;  3FKI H;  1MJB A;  3NTK A;  5C44 G;  2E5R A;  4J8Q A;  2EE1 A;  1CHQ D;  3X3N A;  1UEA B;  4YHH L;  1ET6 A;  3T1Y Q;  2ENB A;  4Q5V A;  1ICF B;  2KCT A;  5CV4 A;  1SDF A;  2JYY A;  3A56 A;  3MA2 B;  1JB7 A;  2L7X A;  4L8J A;  3OIQ A;  3KBG A;  3VR2 A;  3MC0 B;  1ENA A;  1LT4 D;  2XSC A;  3J7A F;  1E3P A;  2O4X A;  1VQ6 A;  1TWG H;  1JQY D;  4AYB G;  5C4Z A;  3X3M A;  1PA6 A;  1VMP A;  3PO2 H;  1A15 A;  4X66 L;  5CV9 A;  1UE1 A;  2Z4H A;  4POF A;  4XTC S;  3AEV A;  1TS5 A;  3EN2 A;  1OXU A;  1OXS C;  1PTO C;  4KV6 A;  3Q22 A;  2JBW A;  2VRW B;  4IN3 A;  4UXJ A;  5TSS A;  1G8Z D;  3R5B A;  1H9R A;  4YWK A;  5HUR A;  1ENF A;  1Y1C A;  2YTY A;  5FUW A;  3SR1 A;  3I72 A;  5IGD A;  3JC6 6;  4ZUI A;  1VQM A;  5FUX A;  4A3D B;  1SGE I;  2Q8I B;  3FRP B;  3DWP A;  4AQY Q;  1K7V A;  3CCU A;  2QGQ A;  4X62 L;  4NPS A;  1HJP A;  4DGZ A;  1RHP A;  4L5R C;  2UVO A;  4OO1 H;  2F4V Q;  2XRC A;  3D00 A;  1GOZ A;  1K3B C;  2ZRR A;  1HTL D;  2EYL A;  4EX5 A;  4A3G B;  3S2H B;  2JB3 A;  3SEK C;  1Z47 A;  4ZKB B;  1ESR A;  3CCM A;  1U4L A;  1WGT A;  3PV0 A;  1UE7 A;  1V1P A;  1N36 Q;  4A3K B;  4A3D H;  1B8A A;  2H4O A;  4A3M G;  4YZ9 A;  1N32 L;  1A3U A;  2Q8T A;  2KCN A;  3LNN A;  1X6O A;  4Q0F A;  2JA8 G;  1D2B A;  5EPL A;  1X3E A;  4U68 A;  1AZQ A;  1PH4 A;  1HNW L;  4ZRZ A;  3S2H H;  4BBR G;  2D62 A;  2OVO A;  2KMP A;  1TUR A;  3OYY A;  3J7A 5;  1GD7 A;  4A3K H;  2IT1 A;  5I2Y A;  2LXK A;  3LGJ A;  3TS2 A;  2JZM A;  1R79 A;  1K8G A;  4IAL A;  3VYS A;  2ERW A;  2UZ3 A;  4XT1 B;  4DUY L;  1BO0 A;  1QZH A;  1DYQ A;  3HKZ G;  3NE5 B;  4HIM A;  3TZU A;  5KYI A;  1B44 D;  4H02 A;  2NYZ D;  1KMA A;  1CKO A;  1LM0 A;  2DNE A;  3HP3 A;  1N34 Q;  4PMB A;  2JEB I;  1WFQ A;  2NZ1 D;  1TII D;  3UFF A;  2WII B;  1PH3 A;  4JOI A;  3TDQ A;  5FLM G;  3LWE A;  3F2B A;  1FNU A;  1PH5 A;  4XQN A;  2ZJR A;  5BN5 A;  3GOX A;  1LT3 D;  4IQZ A;  1DJR D;  4MIU A;  1HNX Q;  1T5E A;  2VUM G;  3HOY B;  1PYS B;  4DV0 Q;  1FAR A;  2YU9 B;  3IRB A;  4FO2 A;  4DR1 Q;  2MNA A;  1EWI A;  1L2F A;  1BBW A;  2CFM A;  1ICW A;  3FBV A;  2ASB A;  2BDN A;  2JA6 G;  2EJM A;  1MD2 D;  1YBY A;  3CCL A;  4DV6 L;  4X3K A;  2MFI A;  1A6X A;  4GS3 A;  2CWH A;  2EJG C;  1CT2 I;  1B50 A;  5LMN L;  3HOX G;  5I6Y A;  3HOY H;  4APV A;  1HEV A;  3NWT A;  4GN3 B;  1EFW A;  3R93 A;  2YU9 H;  3CCR A;  3BJU A;  2DIP A;  1FVI A;  1D6E C;  1LTL A;  3OIP A;  3JSB A;  4QB4 A;  2NB0 A;  3EQL C;  1TT2 A;  2EYO A;  1CQV A;  1IYV A;  2RDG A;  4HMJ A;  4CKB A;  1P16 A;  2VQF L;  1VF7 A;  2ZXR A;  4JV5 Q;  3OSO A;  3TME A;  1TBR R;  5KRU A;  2CWP A;  4DR2 Q;  1CM9 A;  4IJH A;  2L4N A;  4UPA A;  4IOC A;  2F03 A;  1D1K A;  1PCE A;  1KXL A;  1XA6 A;  2F0N A;  3HEJ A;  1WD0 A;  4KJN A;  4C1N K;  4L9M A;  1KL9 A;  2OWO A;  1KLG D;  4L5S A;  4KHP Q;  5EPJ A;  1I4H A;  2PMZ E;  2RCN A;  1FJG Q;  2WAQ B;  1MHW C;  1LTR D;  2D0O A;  5DEH A;  2WIN B;  3A8I E;  1B1Z A;  4RG1 A;  4HCS A;  4KN7 C;  5K5P A;  4DUZ Q;  2YFA A;  1BUV T;  4B9X A;  4BXX G;  1SE2 A;  2QEJ C;  3QB3 A;  4R8N A;  3I8Z A;  3FSX A;  1QG7 A;  4GI3 C;  1IZ6 A;  1WTW A;  3S15 B;  3CMA A;  1SGP I;  1CZG A;  2DJG C;  3BDC A;  3NQI A;  2KMR A;  2RIJ A;  1QNK A;  1CHO I;  3M4P A;  1E2Z A;  1NCV A;  4JBW A;  3I4M B;  1NR2 A;  3AFQ A;  1UWV A;  3S24 A;  3T16 A;  5DLQ E;  3VR3 A;  1ONL A;  2JA5 B;  2SGF I;  3S15 H;  5C5M A;  3KY9 A;  2BH2 A;  2ID0 A;  2J9R A;  1HTP A;  5IP9 H;  3DWA A;  4P71 A;  2K14 A;  3HFZ B;  1QUQ B;  1B9N A;  4RAU C;  3I4M H;  4JI2 Q;  3D3R A;  1NJI C;  2KCC A;  1HR0 L;  2ZM6 Q;  5ELC A;  3QOJ A;  4GKK Q;  3AU7 A;  3PF5 A;  2K19 A;  5I4D A;  3ER0 A;  3P1H A;  2JA5 H;  1SN8 A;  3KJO A;  1QB5 D;  2F3C I;  4CGY B;  4OWW B;  3BS1 A;  2SNM A;  2LB7 A;  1RIP A;  2K4K A;  4I1T A;  3J7A V;  2SGE I;  3HH2 C;  4DKA C;  3FVV A;  1BCP B;  3PO3 B;  1CE3 A;  4IFD H;  2JXM B;  2KHS A;  2ATW A;  1LR9 A;  1LT5 D;  1STE A;  1SGQ I;  3J80 L;  2IWH A;  3BG3 A;  3AJF A;  2VZA A;  4OO1 G;  3RLN A;  2BUS A;  2V1C C;  4BY7 B;  3GO5 A;  2Q2H A;  2WAQ E;  1M1K C;  1TDP A;  4M1U B;  1SNC A;  2EZV A;  3PO3 H;  4A3D G;  1XWE A;  5IE8 A;  1AZP A;  1HJA I;  4DF7 A;  1SNM A;  1CTM A;  2C35 B;  4A3B B;  1TS4 A;  3EJI A;  1JIC A;  1NR4 A;  3H91 A;  3NSW A;  2XTQ A;  3S2D B;  1A2T A;  1J5E Q;  4A3G G;  1WTO A;  3LWU A;  2F0M A;  1YVC A;  5IP7 H;  3P20 A;  4YY3 L;  4HJ9 A;  3BDO A;  5CBA E;  1OYV I;  1YEZ A;  4IJL A;  2D2C C;  4HED A;  4A3B H;  3GD7 A;  2B8G A;  2RA4 A;  4IO9 A;  5CV5 A;  1GJX A;  3A5Z B;  2RDH A;  4K6L A;  5C4H A;  2OTJ A;  1XPU A;  3K0Y A;  1WTV A;  3CCV A;  1V1O A;  3J80 i;  3T1H Q;  5HGI A;  3PUW A;  2EPB A;  1XNQ Q;  3VE5 A;  1I4Q A;  4K6D A;  2TMP A;  4YZC A;  2B8F A;  3SHL A;  3G4S A;  1M90 C;  2X6L A;  1P9Z A;  5E3F A;  1TY0 A;  3UDI A;  3NPP A;  4DR2 L;  2K5N A;  2CVR A;  3QR8 A;  3CW2 C;  3SVM A;  1I94 Q;  1OXX K;  1ZYR D;  1BDO A;  5LNK 1;  1S5F D;  2QZG A;  3A7L A;  3J81 j;  1LT6 D;  3KYH C;  1EIF A;  3JAM L;  4LFA Q;  1EU4 A;  4KHP L;  2BOS A;  3VDU A;  3W1B A;  2L8E A;  4JI0 Q;  4JI4 Q;  3HOY G;  4FKD A;  3I4L A;  1HHV A;  2X3T A;  4KI0 A;  2FHT A;  2PCF B;  3B55 A;  3R8B A;  5AJ3 Q;  1AH9 A;  2Z9H A;  2NUC A;  3NBI A;  3PUV A;  4PMC A;  2DY8 A;  1IKL A;  1BMO A;  1Q9B A;  1JOR A;  3BVG A;  3QOL A;  1GUT A;  4NMZ A;  1HQM C;  4X64 L;  1D5M C;  4ULL A;  3ULP A;  3DXJ C;  2Z8L A;  3K0X A;  1KLU D;  2DUD A;  1S5B D;  2R92 B;  3TP7 A;  1XMO Q;  2A19 A;  3K59 A;  1HPT A;  1NUC A;  1EYG A;  3M7G A;  1X3F A;  1LTT D;  2K32 A;  3NHH A;  2A1A A;  3GQB A;  3KF8 A;  4DV5 L;  1F2M A;  1IY6 A;  4KLK A;  1XTC D;  4UXI A;  3TO6 A;  1M4V A;  2NVQ B;  2NU0 I;  2UUA Q;  1GM5 A;  2YV5 A;  5CV7 A;  2K6A A;  2R92 H;  4DV2 L;  2F0T A;  3NP8 A;  1DGS A;  4KKT A;  3SK4 A;  3H94 A;  3CCE A;  5GAD C;  5IT9 L;  3JAM i;  1K7T A;  2GVB A;  3PUZ A;  1X65 A;  4RKB A;  1UHA A;  2NVQ H;  1ESF A;  3EFX D;  1QWY A;  4JI8 L;  2YTV A;  1MT1 A;  3CXC A;  2WAQ G;  3E5S A;  1CGI I;  2MHV A;  3I70 A;  4UP7 A;  1A8V A;  2K01 A;  3WOE A;  1MJA A;  1VQE A;  2N3S A;  1CSQ A;  5DM7 3;  1VQD A;  2QCP X;  3I9V 1;  3MXN A;  4JI7 Q;  5C4X B;  1SYG A;  3CRK C;  2NWG A;  4LAA A;  1PZK D;  2CQO A;  1HA6 A;  1Q8K A;  4FDB A;  4R4I A;  1S40 A;  2D9U A;  3M3Y B;  1WOC A;  2M5X A;  2J4X A;  1TXY A;  3L2P A;  2JAE A;  4DR6 L;  1WJJ A;  3VR6 A;  4GLA C;  5IP9 G;  2LFN A;  4R1J A;  4YHH Q;  2F3W A;  5G3L F;  4A24 A;  3I4M G;  2UUC L;  1CA5 A;  2ENN A;  5J22 A;  1XYI A;  2P5Z X;  5C4X H;  2IP6 A;  1ULN A;  5NUC A;  1PHJ A;  4K5X A;  1QNU A;  3M3Y H;  5ELN A;  2JA5 G;  1Z2I A;  3OWF A;  3TQY A;  1PFB A;  2E74 C;  3M4Q A;  1AE2 A;  2I0Q A;  1PH9 A;  1FL0 A;  2AWO A;  3W5O A;  3TN2 A;  4GNX B;  3AYH B;  3WDN A;  3CQZ B;  5IT9 E;  1DXM A;  4AS2 A;  1XTD A;  4IFD J;  4N9P A;  2JA1 A;  4IFD G;  2PW5 A;  1PH8 A;  1Y69 U;  2BE5 D;  1PH1 A;  4PL3 A;  1PFM A;  3TP8 A;  2ETD A;  4IUQ A;  1QUQ A;  2PNH A;  4WJW A;  4YCV A;  1YNN D;  3OW2 A;  4AIM A;  3MHB A;  3KLW A;  2JYO A;  3CQZ H;  1J6Q A;  4JPB W;  3PO3 G;  3TZD A;  1Y1V B;  3CPF A;  1SBB B;  2O2L D;  3VA9 A;  2UU9 L;  1SYE A;  4RGT A;  3BVZ A;  3UDG A;  3T1H L;  1Y14 B;  4X62 Q;  3IAS 1;  2K28 A;  4C1N I;  1PTO F;  4AS3 A;  1W6K A;  1LLR D;  1T9H A;  4BY7 G;  2B3G A;  5IP7 G;  1UEB A;  1Y1V H;  2NVY B;  1BNZ A;  5C5L A;  1N32 Q;  3K80 C;  4DR7 L;  1K7U A;  3PIO A;  4A3B G;  2F0D A;  1YHB A;  2KCM A;  4NP5 A;  4X3T A;  5E3P A;  1GUS A;  4I7Z C;  2E75 C;  3K57 A;  3PDN A;  3CC7 A;  4QMG A;  4LFA L;  4DA2 A;  3RZO H;  1HNW Q;  2EJF C;  4WJ3 M;  2ENZ A;  2F0O A;  4HAE A;  2NVY H;  1K9M C;  2B39 A;  2R7D A;  3TP6 A;  3U50 C;  3G6J B;  5FOB B;  2AUK A;  5H1S E;  2K50 A;  3UIT A;  2AQ2 B;  3A55 A;  1ENC A;  4KY6 A;  5KNC A;  2NN6 H;  2YUU A;  1DON A;  1B70 B;  3PUY A;  2G5D A;  3MEH A;  4P73 A;  4LMQ D;  2RDF A;  1HXY D;  4Z9C B;  1YNN C;  3TS0 A;  1B2T A;  1TIH A;  4A4I A;  2PZU A;  2LS0 1;  2K1B A;  4C3I B;  4BY1 B;  3GTP B;  4B08 A;  4GLV B;  5GQO A;  3AB9 A;  3QO2 A;  1RJT A;  1KNE A;  1F9P A;  2KOL A;  3KF6 B;  1WCM B;  3GV3 A;  3J7Z C;  1VQL A;  3RLO A;  3MXU A;  1KAA A;  2HCI A;  1F2Y A;  4BBS B;  2F0V A;  1K28 A;  4DV6 Q;  2ZTE A;  5J1Z A;  4MPI A;  1Y1B A;  4J6H A;  1PTO D;  2DY7 A;  3SE0 A;  4C3I H;  4K0K L;  4BY1 H;  3GTP H;  2HUG A;  4LF7 L;  5LMN Q;  4DV7 Q;  3MWY W;  2CWF A;  2PQA B;  2G9H D;  1QVF A;  3QTL D;  1WI5 A;  4DR4 L;  1VQF A;  1WCM H;  2BA0 A;  1Q1E A;  3GTM B;  1DD2 A;  3FKI B;  1IHZ A;  5EBC A;  3GTJ B;  4BBS H;  3U9S A;  3K58 A;  3D6C A;  2VL6 A;  4F88 A;  2VQF Q;  1IW7 D;  2Z0S A;  1N8R C;  3GTK B;  3SK8 A;  2F0U A;  3HOV B;  3J81 E;  1TBQ R;  1PMR A;  4KY7 A;  2ELI A;  2R92 G;  1X3P A;  3ONA B;  1U4M A;  2F6M B;  2CH4 A;  3GTM H;  4LK1 C;  3TOB A;  3B4V C;  1JCK B;  3MFY A;  4DNC A;  3T53 B;  1FGB D;  3GTJ H;  2W0T A;  1TWG B;  2BA1 A;  1B53 A;  2E5L L;  4GN4 B;  5JHW C;  4JI3 L;  3FPU B;  5IWA L;  4X65 L;  3PO2 B;  5E3Q A;  2L9H A;  3GTK H;  5EGT A;  3HOV H;  1OMU A;  1HZB A;  1LR7 A;  1LV9 A;  1XX8 A;  1S4Z A;  1XNR L;  2JA9 A;  1FGU A;  4C2M B;  4WOR A;  2GKT I;  4GNX C;  2A68 D;  3MXG A;  1KDA A;  3NEL A;  3U58 A;  2A6E D;  3OXG A;  4H0L C;  1V9P A;  3T4A C;  5T1I A;  4Z7G A;  3C3L A;  4GKJ L;  5IIF A;  3TRZ A;  3OMC A;  3FC3 A;  2SGD I;  4CJ0 B;  1XPO A;  4DNT B;  2VB3 X;  1NXU A;  4JOI C;  4C2M H;  2B2U A;  1R9T B;  5IGC A;  1G2T A;  1FR3 A;  1W2B A;  1TUS A;  2KEN A;  1HFN A;  2B2W A;  5C4X G;  3MEK A;  4MHE A;  5AFW A;  5COY A;  4HIO A;  4JBM A;  2TSS A;  4FP5 D;  1IW7 C;  1SEB D;  4LUO A;  3NEM A;  1A3T A;  1R9T H;  2EXZ A;  3NWS A;  3A0J A;  2R6G A;  2Y0M A;  1PVO A;  4E6I A;  3PMF A;  1VDD A;  1HR0 Q;  2HIV A;  3KUP A;  4EQ5 A;  3ZYY X;  3NTH A;  3S16 B;  3I90 A;  2Z6K C;  2UXC L;  2QGM A;  3FEW X;  1UVF A;  1PLF A;  3S1R B;  2RF4 A;  3ITP A;  1VQH A;  5CCM A;  1SJ8 A;  2A68 C;  1W3S A;  3D6W A;  1Q8I A;  1EIY B;  3TEH B;  2PMZ B;  3I3C A;  2A6E C;  3CD6 A;  4OX9 L;  5EPK A;  3S16 H;  2EY5 A;  4ZK9 B;  2F0H A;  4GNX A;  4B9W A;  2DGY A;  3OW7 A;  5FUY A;  1O7Y A;  1CQF A;  1TWF B;  5HGQ A;  1VQK A;  4LF4 L;  3Q0A A;  1U4R A;  1VMC A;  2BCO A;  3S1R H;  2Z4I A;  3D4R A;  3OPO A;  5GAH C;  1Y1V G;  2SDF A;  5I2X A;  1NUB A;  1Y1W B;  3FVQ A;  2XN9 C;  2HQL A;  5LL6 S;  4HJA A;  4P2C B;  1SGN I;  4GOP B;  1YI2 A;  4JI5 L;  2GIV A;  1TWF H;  4O1N A;  3I4O A;  1S72 A;  5M9O A;  4YY3 Q;  1O80 A;  1EY5 A;  1ULK A;  2L15 A;  2M9V A;  2NBF A;  5BR8 Q;  4QUC A;  1WTQ A;  1TY2 A;  1Y1W H;  2NTT A;  1DZ1 A;  2ZJP A;  5IT9 c;  1V8Q A;  2A74 C;  3KF8 B;  1RD9 D;  1JB3 A;  2XMX A;  3QIA A;  2NN6 G;  1SNO A;  1I4R A;  5LMU L;  4DV7 L;  3GTQ B;  4CDD C;  3OVO A;  1KAW A;  3L9A X;  2L0C A;  5CC4 A;  2RHS B;  4R4T A;  4ME5 A;  4RA8 A;  3KDF B;  4JI1 L;  2KHJ A;  3M4Y A;  4A76 A;  5IGE A;  1VQP A;  2L12 A;  5HGT A;  5C3E B;  2Z6K A;  4CDC C;  4LUV A;  3TOA A;  2PYK A;  3GTQ H;  5CMD A;  1RCV D;  3SDZ A;  1CSO I;  1VQO A;  1LTS D;  5FLX L;  2A6H D;  1RF2 D;  1M8A A;  3LJ0 A;  3TBI B;  3ZJY C;  1D7Q A;  4L5Q A;  4PNY A;  5JJZ A;  3PIP A;  1F77 A;  4C3I G;  3BYY B;  2NU4 I;  4BY1 G;  2EIF A;  4IUV A;  3K81 C;  1YHA A;  4KHV A;  2A2D A;  4PV1 C;  3MXN B;  5C3E H;  2ZXP A;  4QIW E;  3K6O A;  2MPM A;  1WCM G;  3W1G A;  4MTN A;  2OU2 A;  3W2D A;  1PPF I;  4K8J A;  4BBS G;  1RL2 A;  4RCN A;  4XIG S;  3RN2 A;  1AP0 A;  3NEN A;  1M8C A;  1U0L A;  2BDO A;  5DM6 3;  2WP8 J;  5DAU A;  4X64 Q;  2K5W A;  4WJ4 A;  4K2L A;  3KF6 A;  1KBE A;  2N55 A;  5IYD H;  2LKV A;  1KRS A;  4DU9 A;  2CAZ B;  3N52 A;  2ORV A;  1LTG D;  4OIJ A;  2RCF A;  5EQ0 A;  5D3D A;  1MSH A;  3FKI G;  3A5U A;  2P6A C;  4DV5 Q;  4G7H C;  3PQI A;  2FFK B;  3H3V H;  3H0G B;  4A3F H;  5JEA J;  3AMU A;  2PQA A;  2LUY A;  2GSC A;  5DNF A;  3FSY A;  2G9D A;  4RHS A;  4DK1 A;  3HOV G;  4OO1 I;  1F9R A;  3I2Z A;  4DPG A;  1A63 A;  2EYJ A;  1VQ4 A;  2K5Q A;  3GDE A;  4DV2 Q;  2SEB D;  2JQO A;  2JB2 A;  4A3C H;  2EVB A;  2OT2 A;  5DAE A;  2MJF B;  1KD1 C;  2XRQ D;  3KBX A;  3DWQ A;  4UDU C;  1UVG A;  5FLX E;  5KIX A;  2DN8 A;  3S14 B;  1VQ5 A;  5FUV A;  3H0G H;  4EQP A;  3L3O C;  1LTI D;  3PO2 G;  2A6H C;  2JK8 A;  4JI8 Q;  1MBY A;  2JW6 A;  1EQR A;  4R4C A;  1EQV A;  5KNB A;  3R5D A;  1Q46 A;  3NBH B;  4UP8 A;  2A73 B;  2GVA A;  5I9O A;  1K8M A;  4SGB I;  4OIK A;  1E1T A;  3S14 H;  1Y8O B;  4DV1 Q;  2RSN A;  1GO3 E;  2NZO A;  3SGB I;  2I5H A;  4RMF A;  2IHF A;  1MJE A;  1GHJ A;  5JVH 3;  2I5L X;  1PRT B;  3R2I A;  3SDJ A;  1CT0 I;  1B7Y B;  3MZ5 A;  5IOD A;  4QL5 A;  1ET9 A;  2EYP A;  2B2T C;  3D0F A;  1OO9 B;  3J81 c;  4DR6 Q;  1IBL L;  3FMC A;  3KOJ A;  2KUM A;  2F4I A;  1K83 B;  1XX6 A;  2UUC Q;  1HNZ L;  4ZUJ A;  4JG2 A;  3I56 A;  4DV3 L;  1FNV A;  1BCP F;  4E1P A;  1F2Z A;  1SGY I;  1LAB A;  4N8X 1;  3GTL B;  4GZY C;  4GOP C;  2O5I C;  1JT8 A;  3CCS A;  3E9H A;  4AH6 A;  4LW1 A;  1CKM A;  3Q8D A;  1SR3 A;  4M8A A;  3RUZ A;  1TBN A;  2ARP F;  2PQ8 A;  2WGC A;  4KY5 A;  1K83 H;  3CC2 A;  3QWP A;  2WV6 D;  3S17 B;  4ZCK A;  5EBD A;  5CYU A;  3TRE A;  2EYF A;  2A69 C;  3UGI A;  4A3K G;  3GTL H;  5BR8 L;  2ROW A;  1VS0 A;  3EBE A;  1YU6 C;  1STA A;  1WD1 A;  5K36 H;  3HRZ C;  1SRO A;  1N33 L;  4PMW A;  2HQE A;  1A3V A;  2MJ8 A;  2GKV A;  1PV4 A;  3A8K E;  3DUZ A;  2A5H A;  3S17 H;  3OTO L;  3I4N B;  5JAV A;  2UU9 Q;  1P9G A;  4G4K A;  3S9W A;  2QKI C;  1KNA A;  4CKC A;  1G51 A;  4O2D A;  4RGN A;  1H9J A;  5E7N A;  3J80 E;  2X52 A;  1K0R A;  1JJG A;  2H5X A;  1UE5 A;  1AE3 A;  1ZXT A;  1STG A;  4IUN A;  2PQE A;  2F3V A;  1UNS A;  5E3R A;  2Z6B A;  3ERO A;  2ZJQ A;  4WRD A;  4P75 A;  2MQH A;  4NXN L;  4DNR B;  1CA6 A;  3I4N H;  1BUS A;  1Y1W G;  4DR7 Q;  1YIT A;  2B2T A;  3J7Y W;  1VQB A;  1HDL A;  2HDL A;  4HN7 A;  1EL0 A;  3PIO 3;  5EX3 A;  2CH4 W;  4ZLT F;  3SGI A;  4JI6 L;  1WVL A;  1BCP D;  5EKL A;  5JJL A;  1EU3 A;  1HH2 P;  4JVZ A;  1CKN A;  1RFH A;  3F2U A;  5FO7 B;  4GOP A;  1AW7 A;  2F52 A;  4XYO A;  2SGQ I;  2BL8 A;  2OD1 A;  3MVV A;  1YJ9 A;  3W3A A;  1K8A C;  3I7F A;  1ILP A;  5EX0 A;  4FYD A;  4HSV A;  4IPD A;  1I4G A;  3T13 A;  1FNW A;  3UGL A;  1HA5 A;  2PZW A;  4HSP A;  1MSG A;  1I6H B;  1PXU A;  4V0B A;  3NXW A;  5GRO A;  2HT1 A;  3CAM A;  5C3E G;  5ELO A;  2HD3 A;  3CME A;  3KDF A;  1IBM L;  1CGJ I;  3SK5 A;  1EY9 A;  5EKI A;  3V05 A;  1LTA D;  4DR3 L;  3K5O A;  4JCV E;  1SE8 A;  2WB1 E;  3AQQ A;  4K0K Q;  2IX3 A;  1I6H H;  2K04 A;  3FP9 A;  1EYC A;  4LF7 Q;  2SNS A;  2XNA C;  4K14 A;  2K03 A;  3JAM E;  3OHX C;  3MAQ A;  4DR4 Q;  5IYD G;  1EY6 A;  3CCQ A;  1C8C A;  3KFU A;  2JN4 A;  2DJF C;  5ISR A;  2V53 A;  3ERS X;  5JPN C;  1Y8N B;  4HTH A;  3UGD A;  5E1F A;  1G91 A;  2PNR C;  4OL7 A;  3VDY A;  1FYC A;  4IFD I;  5ELD A;  2VXW A;  1NMF A;  3IAM 1;  2N49 A;  4I65 A;  1X9N A;  1BCP C;  4DV1 L;  1TQO A;  1PRT C;  3M7N A;  1I6V C;  3KLS A;  4FVM A;  1M8B A;  3A54 A;  2IHE A;  1MGS A;  4Y52 H;  2CWG A;  2L11 A;  2KJX A;  1JJ2 A;  3C1F A;  4A3C G;  1HZ9 A;  2JSO A;  2FIN B;  2AQ3 B;  4WP4 A;  4QUF A;  2Q8R E;  1YNJ D;  1IY5 A;  2E5L Q;  1DOK A;  3PGZ A;  2HDM A;  3H0G G;  5IWA Q;  4X65 Q;  4JI3 Q;  1HQR D;  1AN8 A;  4KK7 A;  3U9O A;  2NTS A;  5F2D A;  1Z6H A;  2R7Z B;  4DK3 C;  1SYF A;  1KBF A;  3V2T A;  1X3Q A;  1NBW A;  1XNR Q;  3PSI A;  2CHB D;  3GTG B;  1SGR I;  1C4Q A;  4A3E B;  5CBE E;  2WKD A;  3TP5 A;  4A93 B;  1K3R A;  3C2P A;  3QAH A;  4IPH A;  2XTR A;  1A62 A;  2Y0S E;  5KEE A;  3Q24 A;  4GKJ Q;  1HUN A;  2F1M A;  2R7Z H;  2R93 B;  1YJW A;  3GTG H;  1CT1 D;  2LY7 A;  4OHJ A;  4DAM A;  1MKH A;  1DS3 I;  1IL8 A;  1VQA A;  4A3E H;  1CUK A;  1EOT A;  2Q2I A;  3MTS A;  4TRD A;  2QQ0 A;  4A93 H;  1STY A;  2WAC A;  1IW4 A;  1S5D D;  5JJI A;  3L0O A;  4C3H B;  3I73 A;  3S1Q B;  4QJF A;  2NU2 I;  2R93 H;  3F8T A;  3NBH A;  2RC4 A;  5J3B A;  2YQP A;  1QVG A;  1JOQ A;  3GTO B;  3G7L A;  1GUO A;  3O13 A;  3R2T A; 
#chains in the Genus database with same CATH homology
 3TJQ A;  2JA8 H;  3UE1 A;  4C3H H;  5GAG C;  1OMT A;  3S1Q H;  1V1Q A;  5FLX c;  4OXP A;  4U6R A;  1YTP A;  1H95 A;  3U4V A;  3BZC A;  1E1O A;  1QVC A;  3GTO H;  2Q2T A;  4LNQ A;  4AYB E;  2UXC Q;  5K36 G;  2QQC A;  1C0A A;  4TVA B;  3KP9 A;  1FYB A;  2V6E A;  1KIX A;  1FAQ A;  1YNX A;  1ASZ A;  4OX9 Q;  1S3O A;  2HHH L;  4LF4 Q;  2AHO B;  5FLM H;  4DV4 L;  1NY4 A;  4A3I H;  4PL4 A;  3I4N G;  1TWC H;  1KQS A;  1VCI A;  1SRU A;  4C3J H;  1XPR A;  2VQE L;  4JI5 Q;  2OCE A;  4Y7N H;  1EUJ A;  3L0I A;  2MO0 A;  1K73 C;  1KRT A;  4LF9 L;  1X54 A;  4OWX B;  2UXB L;  3OXL A;  4YCU A;  5LMU Q;  2ORW A;  3RNU A;  1YIJ A;  4MNO A;  4OON A;  3DLL A;  1CT4 I;  4LFB L;  1XJV A;  4JI1 Q;  2N78 A;  4LF6 L;  2JA7 H;  1PYB A;  3P23 A;  4B3T L;  3HKZ E;  1SMX A;  4LFC L;  1VQ7 A;  5IYC H;  4P74 A;  3J80 c;  4G75 A;  4IPG A;  3B6Y A;  1XMQ L;  1EOV A;  1NE3 A;  3UDX A;  3M4O H;  2UUB Q;  4KHZ A;  3J81 i;  1MIU A;  4BA1 I;  3L7Z C;  1V1H A;  1OXV A;  1DS2 I;  2A8V A;  2VW9 A;  4BA2 I;  3HOZ H;  3E9I A;  2UXD L;  2VS1 A;  1H0Z A;  4B3R L;  4HFV A;  1IBK L;  4O1O A;  2DB6 A;  1W4R A;  3HOW H;  1G6P A;  5M3M H;  2P22 B;  2KMQ A;  4A3L H;  4GN5 A;  3ICE A;  1L1O B;  3K7U C;  1PH6 A;  1BKB A;  1X4S A;  2JB1 A;  1YHQ A;  2R7Z G;  4LWC A;  1JJC B;  1QZG A;  5HQ8 A;  1U5K A;  3RR5 A;  3JAM c;  4A3E G;  2GKR I;  4A93 G;  4Q9V A;  1IYJ B;  2AMC B;  2AKW B;  4B3M L;  1PTR A;  2CKZ B;  2NN6 I;  2R93 G;  4IPC A;  1UUC A;  2YTX A;  4JC0 A;  1IBL Q;  1X74 A;  4OWT B;  2E8G A;  4YCW A;  5LMN W;  4L5T A;  4DR5 L;  1HNZ Q;  2IY5 B;  4DV3 Q;  1KHI A;  3STB D;  4A3G H;  2ZTD A;  1L0W A;  2RHQ B;  4O0A A;  1O7I A;  3VDP A;  1CKN B;  2JEA I;  2GN5 A;  1TOT A;  1YJN A;  1I50 H;  2QQD A;  5JJK A;  1CSP A;  2JJQ A;  1OTC A;  1YO7 A;  4B6D A;  2ODD A;  1LR8 A;  2AWN A;  2B63 H;  1NMG A;  5HI7 A;  1N33 Q;  5C4J H;  4HJ5 A;  1I5F A;  4A3I G;  2JE6 I;  2I5M X;  3OTO Q;  2A20 A;  5CCL A;  4HGU A;  4HID A;  2FNF X;  4QQB X;  1PFS A;  3OL0 A;  3RZD H;  4NXN Q;  3UEY A;  5C0X I;  4NV5 A;  2F66 B;  2UUB L;  4MZ9 A;  3STB C;  4B3S L;  4JYA L;  4Z7H A;  4JI6 Q;  5IY0 A;  3CCJ A;  1ASY A;  2OTL A;  4R4Q A;  3G6E A;  3RN5 A;  4YZD A;  1P8L A;  2EXD A;  2JA7 G;  4NXM L;  4A75 A;  2D0P A;  3F2D A;  2Q2U A;  1A0I A;  2N1A B;  2SGP I;  1HR0 W;  4R4O A;  2N17 A;  5IYC G;  1VQJ A;  3T1Y L;  2E73 A;  4YWM A;  2PI2 E;  3UDF A;  5FJ8 H;  4HJ7 A;  5JEA G;  4UY8 C;  4DWL A;  2B8T A;  1L1O C;  5C0X J;  1I3Q H;  5C0X G;  3DM3 A;  1IBM Q;  2WVJ A;  4DR3 Q;  3HOZ G;  1E7Z A;  3K8A A;  4O1P A;  3U4Z A;  2BH8 A;  3HOU H;  2A2C A;  1N9W A;  3DA4 A;  3PCO B;  2KBN A;  1Y8F A;  3LJ2 A;  3HOW G;  2KKM A;  5M3M G;  5M5Y H;  4PZ7 A;  4HIK A;  1G29 1;  3DO9 A;  5M3F H;  4A3L G;  4AQY L;  2HIX A;  2OQ0 A;  2ES2 A;  2NU3 I;  2F4V L;  3AFP A;  4ME3 A;  4QGU A;  2XGT A;  4A3J H;  1N36 L;  2NZH A;  3RLF A;  3G48 A;  5GAE C;  4OAU C;  2IX1 A;  2KCX A;  2LSS A;  1PH2 A;  3E59 A;  1Q12 A;  2WFW A;  1SLJ A;  1LYL A;  1KC8 C;  1VQG A;  1JE5 A;  3KJP A;  1L1O A;  1Q86 C;  2E2I H;  1N34 L;  2CJS C;  4J15 A;  3CXL A;  3F4M A;  2LXJ A;  1Q81 C;  2QA4 A;  4BY7 H;  1HNX L;  4DV0 L;  4DR1 L;  2ALY B;  3I55 A;  2CWA A;  3UE0 A;  5IYB H;  2NU1 I;  3BJI A;  2E2J H;  5M5X H;  3S2D H;  4LF8 Q;  2KMO A;  1R0R I;  2XTI A;  4JBJ A;  4YWL A;  1YZ6 A;  3CPW A;  2B63 G;  3MEF A;  4GXT A;  3A74 A;  4DAY B;  1MJC A;  3CC4 A;  4TQU S;  3EIV A;  2K75 A;  3E2I A;  1TWH H;  4JV5 L;  2B0U C;  1Z7K B;  2PI2 A;  3F1Z A;  2YYZ A;  2VNU D;  5M5W H;  2HHH Q;  1VQN A;  2NVT H;  3WWV A;  3H3V I;  4DV4 Q;  4HJ8 A;  1Q82 C;  2V1C A;  3D31 A;  4DK6 C;  1FJG L;  1IXR A;  1HZC A;  4LUZ A;  2VQE Q;  3M85 A;  4LF5 Q;  4DUZ L;  4LF9 Q;  2MO1 A;  2VY3 A;  2UXB Q;  2CCZ A;  4PZ6 A;  3DA3 A;  4LFB Q;  2WCY A;  3UEJ A;  2JXD A;  4X6A H;  5FJ8 G;  2YFB A;  4LF6 Q;  3E0E A;  4A3F G;  2QPO A;  1PH7 A;  4B3T Q;  1E22 A;  5C44 H;  1LUZ A;  4LFC Q;  4JI2 L;  3SGQ I;  1SGD I;  1V1I A;  4UP9 A;  3OXF A;  2ZM6 L;  1XMQ Q;  3PF4 A;  4GKK L;  3HOU G;  1VQ8 A;  3CF5 A;  4ALP A;  1N13 A;  1Q1B A;  5HY6 A;  5M3F G;  2K5H A;  4DNI A;  2UXD Q;  4PG3 A;  4B3R Q;  1BBU A;  4POG A;  1SFO H;  1IBK Q;  4PL5 A;  2FUG 1;  1GVP A;  2R7F A;  3G71 A;  4A3J G;  4IOA A;  1X55 A;  4NB3 A;  1TBO A;  2ZTC A;  1PJU A;  3RU0 A;  1AN1 I;  4QY7 A;  1J5E L;  1VQC A;  4X66 Q;  2F3I A;  2N52 A;  4E1R A;  4A3M H;  3S1M H;  3ULL A;  3ULJ A;  4JBK A;  1NTG A;  4LF8 L;  2FXQ A;  4P72 A;  2K5V A;  2EQS A;  4BBR H;  1X3G A;  5EAY A;  2K52 A;  1XNQ L;  2QEX A;  1WYD A;  1VQI A;  4HEA 1;  4B3M Q;  3HKS A;  2J87 A;  2NVX H;  1TGS I;  1X56 A;  3BZK A;  2QQE A;  1HZA A;  5IYB G;  1I94 L;  2E2H H;  4DR5 Q;  2WB1 G;  2IX0 A;  2N8N A;  3PUX A;  2VUM H;  4JI0 L;  3LJ1 A;  4JI4 L;  1GKH A;  1BVS A;  5AJ3 L;  2JA6 H;  4OAV B;  1D8L A;  1C9O A;  1EQQ A;  4LF5 L;  2L1L B;  1E24 A;  4DUY Q;  1V43 A;  2OQK A;  3FHW A;  3HOX H;  4GLX A;  4G76 A;  3M9B A;  1Q7Y C;  1XMO L;  1IL2 A;  1OXT A;  3CP0 A;  1Z9F A;  1OVO A;  1C7Y A;  4NV2 A;  3BU2 A;  1TWA H;  3K7A H;  1UE6 A;  2UUA L;  4PZ8 A;  4OVO A;  2RIO A;  4UXH A;  2Y0S G;  3S1N H;  2GVI A;  2B29 A;  2LEO A;  1PTQ A;  3F2C A;  4B3S Q;  2K9H A;  4JYA Q;  1VQ9 A;  4JI7 L;  2N71 A;  4BXX H;  2KHI A;  1JMC A;  4NXM Q;  3H15 A;  1XBT A;  3FKI H;  5C44 G;  2E5R A;  4YHH L;  3T1Y Q;  2KCT A;  2JYY A;  1JB7 A;  2L7X A;  1E3P A;  1VQ6 A;  1TWG H;  4AYB G;  1PA6 A;  3PO2 H;  4X66 L;  1UE1 A;  4POF A;  4XTC S;  3AEV A;  3EN2 A;  1OXU A;  1OXS C;  2VRW B;  4UXJ A;  4YWK A;  1Y1C A;  2YTY A;  5FUW A;  3JC6 6;  1VQM A;  5FUX A;  1SGE I;  4AQY Q;  3CCU A;  2QGQ A;  4X62 L;  4NPS A;  1HJP A;  4L5R C;  2F4V Q;  2XRC A;  3D00 A;  2ZRR A;  4EX5 A;  2JB3 A;  3SEK C;  1Z47 A;  3CCM A;  4A3D H;  3PV0 A;  1UE7 A;  1N36 Q;  1B8A A;  4A3M G;  4YZ9 A;  1N32 L;  1X6O A;  2JA8 G;  1X3E A;  1PH4 A;  1HNW L;  3S2H H;  4BBR G;  2D62 A;  2OVO A;  2KMP A;  1TUR A;  3OYY A;  3J7A 5;  1GD7 A;  4A3K H;  2IT1 A;  2LXK A;  3LGJ A;  3TS2 A;  2JZM A;  1R79 A;  1K8G A;  2ERW A;  2UZ3 A;  4DUY L;  1QZH A;  3HKZ G;  4HIM A;  4H02 A;  1KMA A;  1CKO A;  1LM0 A;  1N34 Q;  2JEB I;  1WFQ A;  3UFF A;  1PH3 A;  4JOI A;  5FLM G;  3F2B A;  1PH5 A;  2ZJR A;  3GOX A;  1HNX Q;  2VUM G;  1PYS B;  4DV0 Q;  1FAR A;  3IRB A;  4DR1 Q;  2MNA A;  1EWI A;  1L2F A;  1BBW A;  2CFM A;  2ASB A;  3FBV A;  2JA6 G;  3CCL A;  1YBY A;  4DV6 L;  2MFI A;  4GS3 A;  1CT2 I;  5LMN L;  3HOX G;  3HOY H;  4APV A;  4GN3 B;  1EFW A;  2YU9 H;  3CCR A;  3BJU A;  2DIP A;  1FVI A;  1LTL A;  3JSB A;  4JV5 Q;  1P16 A;  2VQF L;  1TBR R;  2CWP A;  4DR2 Q;  4IJH A;  4UPA A;  4IOC A;  1PCE A;  1KXL A;  1XA6 A;  4L9M A;  1KL9 A;  2OWO A;  4L5S A;  4KHP Q;  2PMZ E;  2RCN A;  1FJG Q;  2D0O A;  4RG1 A;  4DUZ Q;  2YFA A;  4BXX G;  4GI3 C;  1IZ6 A;  3CMA A;  1SGP I;  2KMR A;  1CHO I;  3M4P A;  4JBW A;  3AFQ A;  1UWV A;  3S24 A;  5DLQ E;  2SGF I;  3S15 H;  3KY9 A;  2BH2 A;  2ID0 A;  2J9R A;  5IP9 H;  4P71 A;  2K14 A;  3HFZ B;  1QUQ B;  3I4M H;  4JI2 Q;  1NJI C;  1HR0 L;  2ZM6 Q;  4GKK Q;  3PF5 A;  2K19 A;  3ER0 A;  2JA5 H;  1SN8 A;  3KJO A;  2F3C I;  4OWW B;  1RIP A;  2K4K A;  4I1T A;  2SGE I;  3HH2 C;  4DKA C;  1CE3 A;  2ATW A;  1LR9 A;  1SGQ I;  3AJF A;  2VZA A;  4OO1 G;  3RLN A;  2BUS A;  2V1C C;  3GO5 A;  2Q2H A;  2WAQ E;  1M1K C;  3PO3 H;  4A3D G;  5IE8 A;  1HJA I;  2C35 B;  2XTQ A;  1J5E Q;  4A3G G;  1YVC A;  5IP7 H;  4YY3 L;  4HJ9 A;  1OYV I;  1YEZ A;  4IJL A;  4A3B H;  3GD7 A;  4IO9 A;  3A5Z B;  2OTJ A;  1XPU A;  3CCV A;  3J80 i;  3T1H Q;  5HGI A;  3PUW A;  3VE5 A;  1XNQ Q;  4YZC A;  3G4S A;  1M90 C;  3UDI A;  4DR2 L;  2K5N A;  3CW2 C;  1I94 Q;  1OXX K;  5LNK 1;  3J81 j;  3KYH C;  1EIF A;  4LFA Q;  4KHP L;  3VDU A;  3W1B A;  2L8E A;  4JI0 Q;  4JI4 Q;  3HOY G;  4FKD A;  4KI0 A;  5AJ3 Q;  1AH9 A;  3PUV A;  1BMO A;  4X64 L;  3ULP A;  3K0X A;  2DUD A;  1XMO Q;  2A19 A;  1HPT A;  1EYG A;  1X3F A;  2A1A A;  4DV5 L;  1IY6 A;  4KLK A;  4UXI A;  2NU0 I;  2UUA Q;  1GM5 A;  2YV5 A;  2R92 H;  4DV2 L;  1DGS A;  3CCE A;  5GAD C;  3JAM i;  2GVB A;  3PUZ A;  1X65 A;  2NVQ H;  4JI8 L;  2YTV A;  1MT1 A;  3CXC A;  2WAQ G;  1CGI I;  4UP7 A;  1A8V A;  1VQE A;  2N3S A;  1CSQ A;  1VQD A;  3I9V 1;  4JI7 Q;  2CQO A;  1Q8K A;  4FDB A;  4R4I A;  1S40 A;  1WOC A;  2M5X A;  1TXY A;  3L2P A;  2JAE A;  4DR6 L;  1WJJ A;  5IP9 G;  4GLA C;  4R1J A;  4YHH Q;  4A24 A;  3I4M G;  2UUC L;  2ENN A;  5C4X H;  2IP6 A;  1PHJ A;  3M3Y H;  5ELN A;  2JA5 G;  3TQY A;  3M4Q A;  1AE2 A;  2I0Q A;  1PH9 A;  1FL0 A;  2AWO A;  3W5O A;  4GNX B;  3AYH B;  4AS2 A;  1XTD A;  4IFD J;  2JA1 A;  4IFD G;  1PH8 A;  1PH1 A;  4PL3 A;  1QUQ A;  2PNH A;  4YCV A;  3OW2 A;  4AIM A;  3KLW A;  3CQZ H;  1J6Q A;  3PO3 G;  3CPF A;  3VA9 A;  2UU9 L;  3UDG A;  3T1H L;  1Y14 B;  4X62 Q;  3IAS 1;  4AS3 A;  1T9H A;  4BY7 G;  2B3G A;  5IP7 G;  1UEB A;  1Y1V H;  1N32 Q;  3K80 C;  4DR7 L;  3PIO A;  4A3B G;  1YHB A;  2KCM A;  3PDN A;  3CC7 A;  4LFA L;  3RZO H;  1HNW Q;  4WJ3 M;  2ENZ A;  2NVY H;  1K9M C;  2R7D A;  3U50 C;  5H1S E;  2K50 A;  3UIT A;  2YUU A;  1B70 B;  3PUY A;  4P73 A;  3TS0 A;  1TIH A;  4A4I A;  4GLV B;  5GQO A;  3KF6 B;  3J7Z C;  1VQL A;  3RLO A;  4DV6 Q;  2ZTE A;  1Y1B A;  4K0K L;  4C3I H;  4BY1 H;  3GTP H;  4LF7 L;  5LMN Q;  4DV7 Q;  3QTL D;  2PQA B;  1QVF A;  1WI5 A;  4DR4 L;  1VQF A;  1WCM H;  2BA0 A;  1Q1E A;  4BBS H;  2VL6 A;  2VQF Q;  2Z0S A;  1N8R C;  1TBQ R;  2ELI A;  2R92 G;  2F6M B;  3GTM H;  3B4V C;  3GTJ H;  2W0T A;  2BA1 A;  2E5L L;  4GN4 B;  5JHW C;  4JI3 L;  5IWA L;  4X65 L;  3GTK H;  1OMU A;  3HOV H;  1HZB A;  1LR7 A;  1XNR L;  2JA9 A;  1FGU A;  2GKT I;  4GNX C;  3NEL A;  3U58 A;  3OXG A;  1V9P A;  4Z7G A;  4GKJ L;  3TRZ A;  3FC3 A;  2SGD I;  1XPO A;  4JOI C;  4C2M H;  1TUS A;  1W2B A;  2KEN A;  5C4X G;  3MEK A;  4HIO A;  4JBM A;  4LUO A;  3NEM A;  1R9T H;  3A0J A;  2R6G A;  1PVO A;  1VDD A;  1HR0 Q;  2HIV A;  4EQ5 A;  2Z6K C;  2UXC L;  1UVF A;  2RF4 A;  1VQH A;  5CCM A;  1SJ8 A;  1W3S A;  1EIY B;  3TEH B;  3CD6 A;  4OX9 L;  3S16 H;  4GNX A;  2DGY A;  5FUY A;  5HGQ A;  1VQK A;  4LF4 L;  3S1R H;  5GAH C;  1Y1V G;  1NUB A;  2HQL A;  4HJA A;  1SGN I;  4GOP B;  1YI2 A;  4JI5 L;  1TWF H;  3I4O A;  1S72 A;  4YY3 Q;  2L15 A;  5BR8 Q;  1Y1W H;  2ZJP A;  5IT9 c;  3KF8 B;  2XMX A;  2NN6 G;  5LMU L;  4DV7 L;  3OVO A;  1KAW A;  2RHS B;  4R4T A;  3KDF B;  4JI1 L;  2KHJ A;  4A76 A;  1VQP A;  2Z6K A;  4LUV A;  3GTQ H;  1CSO I;  1VQO A;  3LJ0 A;  3ZJY C;  1D7Q A;  4L5Q A;  3PIP A;  2NU4 I;  4BY1 G;  2EIF A;  3K81 C;  1YHA A;  2A2D A;  3MXN B;  5C3E H;  4QIW E;  1WCM G;  3W1G A;  4MTN A;  1PPF I;  4BBS G;  1RL2 A;  4XIG S;  3RN2 A;  3NEN A;  1M8C A;  1U0L A;  2WP8 J;  4X64 Q;  4WJ4 A;  3KF6 A;  1KBE A;  5IYD H;  1KRS A;  2CAZ B;  2ORV A;  3FKI G;  3A5U A;  2P6A C;  4DV5 Q;  3H3V H;  4A3F H;  5JEA J;  2PQA A;  2LUY A;  3HOV G;  4OO1 I;  3I2Z A;  4DPG A;  1A63 A;  1VQ4 A;  3GDE A;  4DV2 Q;  2JQO A;  2JB2 A;  4A3C H;  5DAE A;  2MJF B;  1KD1 C;  1UVG A;  1VQ5 A;  5FUV A;  3H0G H;  3PO2 G;  2JK8 A;  4JI8 Q;  2JW6 A;  1EQR A;  4R4C A;  1Q46 A;  3NBH B;  4UP8 A;  2GVA A;  4SGB I;  1E1T A;  3S14 H;  4DV1 Q;  1GO3 E;  2NZO A;  3SGB I;  2I5H A;  4RMF A;  2IHF A;  1MJE A;  2I5L X;  3SDJ A;  1CT0 I;  1B7Y B;  4QL5 A;  3D0F A;  3J81 c;  4DR6 Q;  1IBL L;  3KOJ A;  1XX6 A;  2UUC Q;  1HNZ L;  4JG2 A;  3I56 A;  4DV3 L;  4E1P A;  1SGY I;  4GOP C;  1JT8 A;  3CCS A;  3E9H A;  4AH6 A;  4LW1 A;  1CKM A;  3Q8D A;  1SR3 A;  1TBN A;  2ARP F;  1K83 H;  3CC2 A;  3QWP A;  3TRE A;  3UGI A;  4A3K G;  3GTL H;  5BR8 L;  2ROW A;  1VS0 A;  3EBE A;  1YU6 C;  1N33 L;  1SRO A;  4PMW A;  2GKV A;  1PV4 A;  3S17 H;  3OTO L;  2UU9 Q;  1G51 A;  4O2D A;  5E7N A;  1K0R A;  1JJG A;  2H5X A;  1UE5 A;  1AE3 A;  2ZJQ A;  4P75 A;  2MQH A;  4NXN L;  3I4N H;  1BUS A;  1Y1W G;  4DR7 Q;  1YIT A;  1VQB A;  1HDL A;  5EX3 A;  3SGI A;  4JI6 L;  5JJL A;  1HH2 P;  1CKN A;  1RFH A;  4GOP A;  2F52 A;  2SGQ I;  2OD1 A;  1YJ9 A;  1K8A C;  3I7F A;  5EX0 A;  4IPD A;  3UGL A;  5GRO A;  2HT1 A;  3CAM A;  5C3E G;  5ELO A;  3CME A;  3KDF A;  1IBM L;  1CGJ I;  4DR3 L;  4JCV E;  1SE8 A;  2WB1 E;  3AQQ A;  4K0K Q;  1I6H H;  3FP9 A;  4LF7 Q;  4DR4 Q;  5IYD G;  3CCQ A;  3KFU A;  2V53 A;  3ERS X;  3UGD A;  3VDY A;  4IFD I;  1NMF A;  3IAM 1;  2N49 A;  1X9N A;  4DV1 L;  3M7N A;  1M8B A;  4Y52 H;  2IHE A;  1JJ2 A;  4A3C G;  1HZ9 A;  1IY5 A;  2E5L Q;  3PGZ A;  3H0G G;  5IWA Q;  4X65 Q;  4JI3 Q;  4DK3 C;  1KBF A;  1NBW A;  1XNR Q;  3PSI A;  1SGR I;  1K3R A;  4IPH A;  2XTR A;  1A62 A;  2Y0S E;  4GKJ Q;  2R7Z H;  1YJW A;  3GTG H;  4DAM A;  1MKH A;  1DS3 I;  1VQA A;  4A3E H;  1CUK A;  2Q2I A;  2QQ0 A;  4A93 H;  1IW4 A;  5JJI A;  3L0O A;  4QJF A;  2NU2 I;  2R93 H;  3F8T A;  5J3B A;  2YQP A;  1QVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...