1W3SA

The crystal structure of reco from deinococcus radiodurans.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
230
Chain Sequence
RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN DR0819
publication title Crystal Structure and DNA-Binding Analysis of Reco from Deinococcus Radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna repair
total genus 53
structure length 230
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1w3sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1w3sA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1w3sA03
1HNWQ 3HOVH 1NY4A 5LMUQ 2OQKA 4LFBQ 1VCIA 5C4XG 4P72A 2QA4A 3J7ZC 4A3GH 1YJNA 2ZM6Q 3GTOH 1FL0A 3B6YA 2VZAA 2OWOA 4HIDA 4GKKL 4GNXB 1X54A 2HQLA 2NZOA 2D0OA 1PH2A 1S3OA 1CSQA 1Y14B 2UXBQ 1E1OA 2D62A 2K75A 3K8AA 5GAEC 4DR7L 4YY3Q 3UE0A 4LF8Q 2NZHA 3HOVG 3HKSA 2A19A 4P75A 2VY3A 2NVQH 1U0LA 4FDBA 3WWVA 2R92H 3AFQA 4DR6L 5IP9H 5BR8L 4LF6L 4A3GG 4YCUA 4DV2Q 4A3KH 2GVBA 4Y7NH 3STBD 4DNIA 3UDXA 1KIXA 3CCMA 3H15A 3E0EA 4L5RC 1NTGA 1GO3E 2N8NA 2DGYA 4BXXH 4X6AH 1IYJB 4DKAC 3Q8DA 3E9IA 3PUZA 3J80c 4B3TQ 3PO2H 5JJIA 3BZKA 2E5LL 3CD6A 4R4QA 1AE3A 1HZAA 4IPHA 1OXSC 3KDFA 5AJ3Q 5LMNL 1N32Q 1X3GA 3HFZB 1YHQA 4C3JH 2R92G 4JV5L 2R93G 1PH3A 1IZ6A 4IPCA 3NBHB 5IYCH 1WJJA 4A3KG 4DV5L 3F2BA 5JJKA 1XNQL 2UXCQ 1YEZA 4BXXG 1D8LA 4JI5L 4X64L 1I94Q 1VQEA 4JI7L 1VQ4A 1XNRL 2R6GA 4DR3Q 4GLAC 3KJPA 3PO2G 1EWIA 3U4VA 5M5WH 2Q2UA 1IBLQ 1X6OA 4DV7Q 2YTVA 4GLXA 3EN2A 4A3IH 3KDFB 5JJLA 4YWMA 2JEBI 3F8TA 2LXKA 1QUQA 3KF8B 4AH6A 3HOWH 1CKMA 3K81C 4DR5L 2B63H 1OXUA 4B3SQ 2MO1A 2F4VQ 3I2ZA 3FHWA 4IO9A 3NENA 3E9HA 3UE1A 3RN5A 4O2DA 1KC8C 5M5XH 4B3MQ 4POGA 5M3FG 1C7YA 4A76A 2KCTA 4LNQA 2YU9H 2KCMA 3M7NA 4L5QA 1KXLA 1PH7A 4X66Q 2CWPA 3IRBA 1PYBA 1QUQB 2VS1A 3G71A 2UUBQ 1PYSB 1E1TA 1KHIA 2AHOB 4OWXB 1VQMA 1JMCA 4QGUA 2B63G 2ZTDA 3TREA 5JEAG 4DUYL 1XTDA 4AQYQ 4XTCS 5DLQE 3VDYA 2N49A 4LUVA 1Y1WH 1T9HA 1PH4A 2JE6I 4DR2Q 4GN3B 3BU2A 3M4PA 3U4ZA 1V9PA 3PCOB 3TEHB 1HNWL 4YWKA 1VQIA 1ASZA 3CF5A 5LMUL 4HJ8A 4LFBL 4DR1L 3TS2A 2PQAA 4LF5Q 3AFPA 2K50A 4AYBE 1IBKL 5M3MH 4JI8L 4BA1I 5C4JH 2IX1A 2DUDA 1LTLA 2XTIA 1IL2A 3S16H 1EUJA 2ZJRA 3H3VH 3ZJYC 5GAGC 3A5UA 4X62Q 4BY1H 3K7UC 1L1OC 2D0PA 4YY3L 2EXDA 4A75A 4JBJA 1SMXA 4JI0Q 4LF8L 3T1HQ 2B29A 2Q2TA 4BA2I 5IY0A 2PQAB 3L7ZC 1BBWA 1FGUA 2JA7H 2VUMG 2ATWA 4DV2L 4GOPC 1B8AA 4LFAQ 1E7ZA 2BA1A 3K7AH 4TVAB 5M3MG 5GAHC 3G6EA 1HR0Q 2OTJA 4LF7L 4MTNA 4APVA 1Q12A 1SN8A 1LYLA 2Y0SG 1VQKA 4GKJL 1EIFA 1W2BA 1KRTA 3PUVA 1UE6A 2L15A 1LM0A 3CQZH 3TQYA 5C4XH 1ASYA 4B3TL 1FJGQ 1L1OA 3GTKH 1HH2P 4B3RQ 4RG1A 3CC7A 4A3DH 2PNHA 1IXRA 1VQJA 4GS3A 4LW1A 1VQBA 4C2MH 1K73C 3K80C 3ER0A 3CC4A 5IT9c 1VQ7A 1Q1EA 4GN5A 4Y52H 2R7FA 4LWCA 4R4IA 2JA5H 4P71A 3CCSA 1N36L 2VQEQ 4IFDI 2Z6KA 5C44H 3L2PA 2I5HA 2UXCL 4A3FH 2PI2E 4R4OA 1I94L 3GTMH 3L0OA 3T1YQ 2PMZE 2B3GA 4ME3A 4DR3L 4H02A 1VQ9A 1VQDA 4HIKA 1I50H 1L1OB 4DUZQ 3S15H 1C0AA 4DV7L 4HJ5A 4A3DG 2R7ZG 1VQPA 3CMEA 1XPOA 1PH8A 1VQ5A 1P8LA 4JBWA 1YITA 1NJIC 1W3SA 2NN6G 3F1ZA 5ELNA 1S72A 2JA5G 4JI6Q 4NXNQ 1HNZQ 3K0XA 5C44G 3ERSX 5FLMG 1YZ6A 2JK8A 3G48A 2CWAA 4A3FG 4B3ML 1N33Q 1JJ2A 3CC2A 5IYBG 3ULJA 3PIPA 2WFWA 2E2JH 1Q1BA 1WI5A 4A3EH 2R93H 2GN5A 1Q86C 1PVOA 4DV1Q 4TQUS 4DV6Q 2WP8J 2K4KA 4IOCA 1FVIA 1VQ6A 1BKBA 4JI2L 4GLVB 4MNOA 2QGQA 4WJ3M 3LGJA 1X56A 4A3MG 4DR4Q 1MKHA 1OXVA 4RMFA 1X55A 1S40A 1OXXK 2GVAA 3CCEA 1AE2A 1EOVA 2HHHQ 3MEFA 4DR2L 1G291 4IOAA 4A3EG 2E8GA 2A1AA 3I4OA 2JA6H 5IWAQ 1HNXL 1KD1C 4UP8A 4P74A 4DPGA 4LFCQ 3F2CA 1L0WA 1VQHA 2Q2IA 4YWLA 4K0KQ 3W5OA 3CMAA 5M3FH 2FXQA 4JBMA 4BY7G 3DLLA 2AWOA 4AYBG 1J5EQ 2UUCL 2ID0A 2UU9Q 4J15A 2K5NA 5GADC 2N78A 4X62L 1VQOA 4LF9Q 4PZ8A 5H1SE 4JBKA 4MZ9A 3H0GH 1HZ9A 5JEAJ 2H5XA 2JA6G 2ASBA 2XGTA 3T1HL 2RCNA 3KYHC 1XMOL 4KI0A 1NMFA 3AEVA 2AWNA 1WCMG 4PZ7A 3I4MH 4KHPQ 2IHEA 1N34Q 2KENA 2R7DA 4LFAL 5IP7G 4O0AA 3CCVA 1HR0L 1MJEA 4DV4Q 3JAMc 2BH8A 4HJAA 2YV5A 4OX9L 3CCJA 4X65L 1R9TH 1GM5A 1FJGL 4LF4Q 4DV3Q 1P16A 2BH2A 3H0GG 3CP0A 5GQOA 3UDFA 4B3RL 3J81i 3GO5A 4NPSA 2Q2HA 1TWAH 1E22A 3I4MG 3BZCA 4GKKQ 1LUZA 3RZOH 2VNUD 1KAWA 3OTOQ 3PV0A 3J7A5 4BBSH 4P73A 3RLNA 4DR7Q 4C3HH 2RHQB 1HZCA 1YBYA 3D31A 3EBEA 3PIOA 1AH9A 1YJWA 3S2HH 4DUZL 4DR6Q 3FKIH 5BR8Q 2VUMH 4DAYB 5FLXc 3CPWA 2ZM6L 3PUWA 3HOUH 1KL9A 1MIUA 4YHHQ 2YTXA 1DGSA 3UDGA 4NXNL 1VQGA 3EIVA 4R4CA 4JI6L 1OTCA 1HNZL 2UXBL 2V1CC 4BBSG 1YVCA 1N33L 3PF4A 2WAQE 1X65A 3J80i 2NVXH 2CQOA 4JV5Q 4JI3Q 3FKIG 4DV1L 4UP9A 4PZ6A 2MNAA 5C0XG 2OQ0A 3GD7A 3HOUG 4UP7A 3ULPA 2EIFA 1UE7A 3RNUA 1BVSA 4R4TA 3M3YH 4DR4L 1TWGH 4YCVA 4JI5Q 4X64Q 1BBUA 3H3VI 1E3PA 2KHJA 1Z47A 4IJHA 3S14H 4JC0A 1HJPA 1M1KC 2HHHL 1XPUA 2R7ZH 5AJ3L 4JOIC 1N32L 4HJ7A 5HY6A 3OYYA 1NMGA 4KLKA 2A8VA 5IWAL 5IYDH 1Y1VH 4DR5Q 4JI1Q 4GOPA 4LFCL 5IE8A 4GNXC 1YJ9A 1VQCA 3A5ZB 2NVYH 1PFSA 2IT1A 5FLMH 3RN2A 2JA8H 4DAMA 4NXMQ 4K0KL 1Z9FA 3MXNB 4OONA 2VW9A 4QQBX 5IYBH 2F3IA 4UPAA 1EIYB 1VQ8A 1J5EL 4LF9L 1IBLL 2AMCB 3NELA 1SFOH 4C3IH 3HOZH 4JI4Q 2LXJA 2Z0SA 3OW2A 2JA9A 1HZBA 4A3MH 4OO1G 3I7FA 5IYDG 1VQFA 1Y1VG 4GOPB 2BA0A 3I56A 4B3SL 2F4VL 1MJCA 3SGIA 2NN6I 3HOYH 1JJGA 1SR3A 2JA8G 4A3JH 4LUZA 2CFMA 4DV0Q 1PV4A 3KLWA 1K8GA 2OTLA 4JYAQ 4IJLA 2OCEA 4DV4L 1D7QA 3W1BA 2HT1A 2PI2A 3HKZE 1PH5A 4JCVE 2VL6A 4LF4L 1EQRA 3I55A 4DV3L 4DR1Q 3HOZG 1TXYA 4X66L 1PA6A 4R1JA 2RHSB 1UWVA 2ALYB 4DK6C 2ZTCA 1PH9A 2UUBL 3KFUA 2UXDQ 1IBKQ 1N9WA 1JJCB 4JI8Q 2ES2A 1VQNA 3GTLH 2WB1E 3HOYG 1GD7A 4LUOA 4BY7H 1SE8A 1NE3A 4AQYL 4A3CH 4A3JG 1NBWA 1KRSA 3PGZA 3OTOL 3RZDH 2RF4A 1J6QA 3PF5A 4A3BH 3PO3G 4IPGA 1EQQA 1I6HH 1V1QA 3RR5A 3A0JA 1QVFA 2YTYA 5C3EH 1RL2A 2MO0A 3CPFA 2YYZA 1WCMH 1X3FA 4OWTB 5HGQA 4LF5L 1RIPA 4POFA 1A8VA 1Q81C 5K36G 1YNXA 1XMQQ 1PH6A 3GTGH 2Y0SE 4HIOA 5IP7H 1JT8A 1QZHA 4YHHL 2JQOA 2F52A 3KF6A 3CXCA 4LF7Q 2NVTH 1K83H 4HJ9A 1IBMQ 4A3CG 1X3EA 4GKJQ 1Q8KA 4WJ4A 1WFQA 2UUAQ 3I4NH 3D0FA 4A3BG 1U5KA 4JI0L 1G51A 1K8AC 5C3EG 1B7YB 2WAQG 4JI3L 4IPDA 5IP9G 1UEBA 2N3SA 2VQFQ 4XIGS 4AIMA 1Q7YC 1Q82C 1KQSA 2I0QA 4A4IA 1EYGA 1N36Q 4PG3A 3CCQA 3GTPH 3KF6B 2E2HH 2HIXA 2E2IH 4QL5A 1QVCA 1E24A 2C35B 5FJ8H 5ELOA 3I4NG 3STBC 3M4OH 3TRZA 1K3RA 1A63A 3M9BA 3HOXH 3F2DA 4BBRH 1K0RA 3S2DH 2CKZB 2KBNA 3KJOA 4A93H 3AYHB 1CKOA 3U50C 5IYCG 4JI1L 2EQSA 3W1GA 3S1QH 1SLJA 2ZJQA 2VQEL 2JJQA 3FP9A 3S17H 4HIMA 1K9MC 3M4QA 1N8RC 4NXML 3PUXA 3J81j 3T1YL 5C0XJ 5M5YH 5FJ8G 4QY7A 1A0IA 2IHFA 3KOJA 1CKNA 1GKHA 1VQAA 5J3BA 3HOXG 3ULLA 1JE5A 1X9NA 4BBRG 4LF6Q 4A3IG 4JI4L 4JI2Q 4A93G 1L2FA 3UDIA 3GTQH 5EAYA 3S1MH 3HOWG 4A3LH 4L5TA 1WYDA 1UE1A 4QIWE 3U58A 5GROA 1B70B 1OXTA 5LMNW 4DV0L 4PMWA 1H95A 1GVPA 2E5LQ 1Q46A 4JYAL 3CAMA 5LMNQ 1SRUA 4QJFA 3CCUA 1C9OA 4EX5A 2K52A 3CCLA 1CKNB 4JG2A 1WOCA 2ZTEA 4DV6L 2IY5B 1HNXQ 5C0XI 5E7NA 4L5SA 4DV5Q 2MFIA 3HKZG 2JEAI 2I5MX 3S24A 1XNQQ 2UXDL 2HIVA 3CCRA 1PHJA 4A3LG 4JI7Q 1PH1A 3PUYA 3G4SA 1VQLA 1XNRQ 2AKWB 4NB3A 2UUCQ 4YCWA 2WB1G 2I5LX 1Y1WG 1I3QH 3RLOA 1JB7A 3RLFA 3AQQA 2KHIA 3BJUA 3NEMA 3S1NH 3M85A 4ALPA 1YHAA 4IFDJ 1M90C 1XMOQ 1YHBA 3GDEA 1TWHH 3PSIA 4EQ5A 1HR0W 1XMQL 1CUKA 4KHZA 3JC66 2ZJPA 2K14A 3CW2C 2Z6KC 3DM3A 2IX0A 1I5FA 1TWFH 1IBML 2UU9L 1VS0A 1UE5A 4OX9Q 4OWWB 4X65Q 3TS0A 4BY1G 2UUAL 1SROA 2MQHA 4JOIA 3JAMi 1EFWA 4UY8C 2CCZA 1YIJA 1O7IA 1TWCH 4DK3C 2LSSA 4OO1I 1XJVA 1QVGA 1QZGA 1YI2A 4OXPA 4KHPL 4GNXA 2VQFL 4DUYQ 1N34L 2JA7G 3A74A 3GTJH 1CSPA 4IFDG 2K5VA 2QEXA 1A62A 1V43A 3S1RH 4GN4B 3PO3H 1XPRA 3ICEA 2K5HA 1G6PA 3J81c
chains in the Genus database with same CATH superfamily
1DONA 3HOVH 2OQKA 2ENNA 2LFNA 4K2KA 5HURA 1I4PA 4FXKC 1WTJA 2BOSA 4HIDA 2L11A 4NV5A 1X54A 2F0DA 2NZOA 2D0OA 2ZT9C 2UXBQ 2Y0MA 1Y14B 2D62A 3UI2A 2IPKD 3K8AA 4DR7L 4YY3Q 5M5WB 3HOVG 3HKSA 4P75A 1HDLA 2VY3A 2F0UA 5BR8L 4GZYC 4K6DA 4KV6A 4DV2Q 1W4RA 3NBHA 1KIXA 3HOWB 4L5RC 4DNIA 4RH6A 2D5DA 1JWMD 2N8NA 4X6AH 1TURA 4DKAC 2CVRA 3DUZA 2OT2A 3E9IA 3PUZA 2B2TC 3TP7A 5HQ8A 2DJFC 5JJIA 2YU9B 1AE3A 1JCKB 1HZAA 5LMNL 1T5EA 1IKLA 3JAME 2SGDI 3KF8A 2LUYA 3SVMA 1IZ6A 3I3CA 4IPCA 4ABNA 1WJJA 1GUSA 2PO4A 1I4QA 5JJKA 5KNDA 4WP4A 1TR5A 4JI5L 3IL8A 4JI7L 3FMCA 2WB1B 1XNRL 2R6GA 5EKLA 1EWIA 1IBLQ 1KBEA 3KLSA 4A3IH 3D4RA 4I65A 1BQQT 4PMCA 4RKLA 1CKMA 4B3SQ 1CT1D 3FHWA 2K32A 1SGPI 3NENA 1KC8C 4B3MQ 1X4SA 4POGA 5M5XH 2Y0SB 3QR8A 2JSOA 1IL8A 1C7YA 1AN1I 4A76A 2KECA 2KCTA 2XMXA 4TKOB 1ZEQX 3NPPA 1BXTA 1LTGD 2B2WC 3D8GA 3V05A 1KXLA 1SGEI 3IRBA 2CH4A 1QUQB 3G71A 5I4DA 1PYSB 1VQMA 1JMCA 2ZTDA 3TREA 5D14A 5DLQE 4PV1C 1U4RA 4LUVA 3VDYA 2ICIA 1PH4A 1STGA 3CQZB 3U4ZA 3GTKB 3BVGA 1MJAA 3TEHB 1FNVA 1VQIA 4CGYB 5LMUL 1TU2B 4HJ8A 2H1EA 1SNMA 2PZWA 4C2MB 4LF5Q 4G75A 3J7YW 2K50A 4AYBE 1Z6HA 2F0IA 1STYA 2JA5B 3QB3A 2DUDA 1I4HA 1IL2A 3QTLD 4PL5A 4ZKCB 3A5UA 3IFDA 2JB1A 4R8NA 1I50B 3S15B 3VYRA 2JW6A 2EYMA 4FF4A 2B29A 1F2ZA 4H13C 1JQOA 3RU0A 2JA7H 2ATWA 1B8AA 4O1NA 3G6EA 2ENZA 4MTNA 3EJIA 4KMUC 1Q12A 1SN8A 3VYUA 2L9HA 1HA6A 1VQKA 1EY7A 5CCMA 1FJGQ 3TQYA 2E2JB 2ORVA 3BYYB 4A3DH 4WFN3 3CD6A 1VQJA 1SMYC 1VQBA 5BN3A 5LNK1 3R5AA 3C46A 3NQTA 3BVMA 1TS2A 1VMCA 2KOLA 1CHPD 3CHBD 1SYBA 2UXCL 4A3FH 3GTMH 4R8IA 1M8AA 4ME3A 2EY2A 4H02A 2RSOA 4G57A 1VQ9A 2RDFA 1L1OB 2Z4IA 2EXZA 1RKNA 4HJ5A 4A3DG 3CMEA 2WKCA 4F87A 4JBWA 1YITA 3HG9A 1NJIC 2NN6G 2M5XA 2B8FA 4A3FG 4FF3A 3BDLA 1CM9A 1QJOA 1ZYRC 2K05A 2L5TA 2EJFC 2GN5A 3H0GB 2WP8J 1FVIA 1BKBA 1RTOA 4GLVB 4MNOA 3LGJA 4A3MG 4IALA 1LLRD 1OXXK 2GVAA 2K33A 2RDGA 1FGBD 1AE2A 5J1ZA 1PRTF 4O1OA 3SXHA 4L9MA 7WGAA 2JA6H 2L8EA 4P74A 1YNJD 4LFCQ 3F2CA 1I4XA 2QQEA 2VXWA 1L0YB 3I9V1 3MXPA 4K0KQ 3CMAA 5M3FH 1SBBB 1EU4A 4AYBG 3VR5A 3S9WA 2F6MB 5JAVA 5GADC 4JBKA 2B2UA 2F0JA 5JEAJ 1ULNA 2JA6G 2XGTA 1EL0A 3T1HL 3FC3A 1XMOL 4ZRZA 1NMFA 3HOUB 4PZ7A 4KHPQ 1GXDC 1VF5C 3G6JB 1N34Q 2KENA 1RDPD 1HR0L 1IHZA 2YV5A 4E6IA 1R9TH 3OXFA 5EQ0A 4LF4Q 1P16A 2BH2A 5DNFA 4A24A 1EIGA 2NVXB 4B3RL 3UDFA 3J81i 4NPSA 4DAYA 1IY6A 1AP0A 2Q2HA 5IT9L 4NW2A 4O42A 5C5MA 2VNUD 1TWGB 4RGNA 3J7A5 3FDTA 3S14B 3QWPA 4C3HH 3GQBA 1AH9A 1WKXA 3E0JA 2JA1A 4G7OC 4K5WA 4YHHQ 5A2QL 3F4MA 5C44B 3EIVA 1C4QA 2NYZD 1HNZL 2BCOA 5CV8A 5KNCA 2UXBL 3PF4A 1BUSA 1HQRD 2BE5D 1ILQA 1SFOB 3FVQA 4UP9A 1I4GA 4PZ6A 2MNAA 2E74C 2KA7A 3I4LA 3CRKC 1D5XC 2Q8TA 4DR4L 3MXNA 2XN9C 3BJIA 3H3VI 3T51B 1E3PA 2WINB 1UEAB 3RD4A 3SGQI 2R7ZH 3DA4A 3E3XA 4CKEA 2SGFI 4OO1H 3J81E 1Y1VH 4FVMA 2ZXRA 3A8JE 2IY5B 4IUVA 2NVYH 4DAMA 3G7LA 3D00A 5CV5A 2F3IA 4TRDA 4UPAA 1J5EL 1IBLL 1I6HB 2Z4HA 2IX3A 2LXJA 3M4YA 1HZBA 4OO1G 4QMGA 1Y1VG 1NCVA 4B3SL 1JJGA 1MJCA 2EVBA 1SR3A 1NUCA 4A3JH 4LUZA 1SE2A 1NR4A 1K83B 1K8GA 2NZ1D 4L63B 1PFMA 4DV4L 2OCEA 1YTPA 3I4NB 5I2YA 1BNZA 2PI2A 3HKZE 3JAML 4MPIA 1EQRA 3I55A 1CZGA 4R1JA 1EOTA 1UWVA 2ZTCA 2E75C 1IBKQ 5EX0A 1M8CA 3GTLH 1MJ9A 3VA7A 3UGIA 1NE3A 3GTPB 4A3CH 4A3JG 4MIUA 1NBWA 3OTOL 2RIOA 2E2IB 4A3BH 1EQQA 3RR5A 1GUNA 2MO0A 1X3FA 4LF5L 1RIPA 5K36G 1A8VA 3NWTA 1YNXA 2G5DA 4HIOA 1JT8A 3TJQA 4LF7Q 5AFWA 4HJ9A 4A3CG 1D6EC 1X3EA 4B6DA 1QNKA 2DNCA 4A3BG 3D0FA 5M5YB 1CSOI 4H44C 1TBOA 1SAPA 4CJ2C 5HGIA 1QOHA 3F2UA 3VR2A 4JI3L 1Q7YC 2N3SA 3L3OC 4A4IA 1EYGA 3CCQA 1HRJA 1EYCA 2ROWA 2WV6D 1EU3A 3M4OH 3TRZA 4B08A 3S2DH 1K7VA 2KBNA 3AYHB 1CKOA 2F0TA 4C3JG 1STHA 5C6AA 5I6YA 5IYCG 3W1GA 4HEA1 3S1QH 2ZJQA 2QDBA 4RWSC 4Q5VA 3PUXA 1SYGA 2EE1A 3MEKA 1I3QB 5COYA 2V53A 4QY7A 2IHFA 2EYLA 4FYDA 5J3BA 3W3AA 4KTAA 1K8MA 4JI4L 2VB3X 4HTHA 2NU0I 1TWHB 3Q22A 3DO9A 3S1MH 1SMYD 4RGOS 3T16A 1U4PA 2NU2I 1B70B 2GA4B 1Q46A 2F03A 3CAMA 1L0XB 1OO9B 2XRSD 1TQOA 5LMNQ 3CCUA 1AEXA 2K52A 3K5MA 4JG2A 5E7NA 1EWHA 2MFIA 3HKZG 1PLFA 2TMPA 3GTJB 2L1LB 4JI7Q 1PH1A 4IURA 4CDFC 1XNRQ 1SYCA 2JB3A 3S1RB 4C1NK 3FBVA 2AKWB 2G9DA 2L1BA 4K8IA 4NB3A 2OU2A 4YCWA 2M9VA 1JB7A 2MJ8A 3RLFA 1GUOA 5LHY1 3AQQA 3WOEA 1IW4A 1ZYRD 1P9ZA 1SGQI 4OGQC 1M90C 5IODA 4HFVA 1HR0W 3FEWX 1HCZA 1I4RA 2K14A 4HMJA 3DM3A 5F2DA 1V8QA 1IBML 2QW7A 4BY1G 2UUAL 2ENBA 1EFWA 4DK3C 4M8AA 1QVGA 1QZGA 5E3PA 1G2TA 4OXPA 4KHPL 1N34L 4OEMB 2Z1CA 1MT1A 1F2YA 3OVOA 3VDUA 3PO3H 3BDCA 2JP1A 3P23A 1EQVA 4KN4C 4R9WA 1DS2I 2X52A 5LMUQ 2DJGC 2GIVA 5C4XG 1KLUD 4P72A 3J7ZC 2Q8IB 1PFBA 3GTOH 2OWOA 1NSNS 3TSSA 1KDAA 1IKMA 5CMDA 5ELCA 4EQPA 4G7HC 2WVJA 4P2CB 3UE0A 2NZHA 3OL0A 3KBXA 2A19A 9WGAA 4A3IB 1U0LA 3WWVA 3SDJA 3AFQA 5IP9H 3FVVA 3VR3A 2NTTA 3STBD 4Y7NH 2M2LA 1NR2A 4OIKA 2F3VA 3E0EA 1NTGA 2RQXA 3IKJA 1GO3E 3H15A 1P9GA 1IYUA 4BXXH 3P20A 3H3VC 2SGPI 4X3TA 1CA6A 1KLGD 5M5XB 3LJ0A 1AN8A 4DF7A 1EY0A 3BZKA 2NU1I 2EYHA 2B2UC 3KDFA 1TBQR 2JYOA 1X32A 2D2CC 5I2XA 2R93G 4HSVA 3NBHB 4F88A 4FXDA 2KMPA 2LEOA 5C3XA 3H09A 1W6JA 3R93A 5K5PA 2UXCQ 4PNYA 5FUVA 4BXXG 1VQ4A 1B9NA 1A3UA 3TOBA 1DD2A 2RSNA 3KJPA 2Q2UA 1X6OA 4GLXA 1B9MA 1BUVT 1K28A 3EN2A 5JJLA 3L0IA 2LXKA 3KF8B 3K81C 5JEAH 4QUFA 3RN5A 4O2DA 3T56B 5CV4A 5I9OA 2XWJB 4L5QA 1WTWA 1PH7A 5D65A 1Y8FA 2VS1A 3K59A 1UUCA 2JA7B 1E1TA 1KHIA 2CH4W 4QGUA 1JOKA 5JEAG 2A2DA 1XTDA 4Q0FA 4XTCS 2F0WA 4KKSA 2N49A 1Y1WH 4M1UB 2NBFA 4MN3A 4YWKA 3J81L 5CORA 3CF5A 4A3DB 4LFBL 1DCZA 5TSSA 4UDUC 3URYA 1IBKL 4BA1I 1YNNC 1LTLA 1DS3I 5CYUA 2F0PA 4RAUC 4A3FB 3GTMB 3C3LA 2NU3I 2NTSA 1L1OC 1EFID 3NTHA 2FMMA 4JBJA 1SMXA 4NMZA 5JJZA 2NUCA 3T1HQ 2Q2TA 1BBWA 2VUMG 3AU7A 1LTID 2X6GA 1PDQA 3K7AH 4IQZA 1E2VA 1LTRD 1HR0Q 4LF7L 5HI7A 3QWNA 3W2DA 4L6TB 1W2BA 2PPBC 1HJAI 3PUVA 2L15A 1LM0A 1S5DD 4B3TL 4HGUA 4B3RQ 1MGSA 3BYTB 1IXRA 4HCEA 3NE5B 1Q1EA 2BL7A 4GN5A 4Y52H 4XDXA 4R4IA 4U673 4P71A 3CCSA 1TIID 2VQEQ 4DAVA 5I6WA 5FO7B 3DWAA 3L0OA 4RA8A 3P7JA 3QIAA 2ELIA 1FNUA 1NAPA 1HFNA 2LY7A 2XSCA 4IUQA 2JA6B 3TN2A 2SGEI 4U68A 5DM63 1VQPA 1XPOA 1V1IA 3VE5A 1KBFA 1PH8A 4ZK9B 1P8LA 4AMLA 1F9RA 1EYDA 1S72A 3K0YA 5M3FB 1HNZQ 3D4WA 1H9JA 2P22B 2EOTA 2JK8A 3E5SA 1PTRA 1CT0I 3C1EA 5IYBG 3ULJA 4RHSA 2WFWA 3PIPA 3I8ZA 4A3EH 1LT5D 2K4KA 4C3IG 2J4XA 2B63B 2QGQA 2IW3A 3UEYA 4GI3C 4DR4Q 1X55A 2AQ1B 1OVOA 1EOVA 3IFTA 4DR2L 1G291 1R9TB 4A3EG 2E8GA 1PYWD 4F7XA 2ZRRA 1IY5A 3C2PA 1CZWA 4DPGA 3TOAA 1L0WA 1NNXA 5FLXL 4UXIA 4FF2A 2PW5A 2FXQA 1CHOI 4N8FA 5C4HA 4BY7G 3DLLA 2AWOA 4OIJA 1AW7A 1J5EQ 2UU9Q 4J15A 2K5NA 1B3AA 4PZ8A 5H1SE 3FNBA 4C3HB 1EY8A 5JVH3 3PDNA 4MZ9A 1CT4I 2H5XA 2HUGA 2ASBA 4J8QA 1PCEA 1WCMG 1KNEA 2KKMA 5IP7G 3CCVA 1QE6A 1Y8NB 5C4ZA 1SE4A 4DV4Q 2BH8A 2X69A 1G6ZA 3SK4A 1CI3M 1CE3A 2PCFB 1TWAH 1K7TA 1TBRR 3BZCA 4GKKQ 3J7AF 1LUZA 4U6RA 5EPKA 1SYDA 2RVLA 3OTOQ 2SEBD 3MXUA 3PV0A 3RLNA 3MAQA 1PRTC 1Y8PB 2IP6A 1RD9D 3MXGA 3EBEA 1YBYA 1PFNA 3PIOA 2R7ZB 2CWGA 1YJWA 4DUZL 4DR6Q 4HEDA 4DAYB 5FLXc 4RGTA 1UUPA 1Y1VB 3PUWA 1KL9A 4LMQD 1MD2D 4ZLTF 1MIUA 5E3QA 3NXWA 1DGSA 2NVYB 4NXNL 4R4CA 1TKWB 2RC4A 1RODA 1K7UA 3IAM1 4JV5Q 4JI3Q 4DV1L 2XRCA 5FKAC 2K5WA 3TO6A 1A6XA 1UE7A 4E1PA 1BVSA 4R4TA 3M3YH 4YCVA 4A3JB 4X64Q 1BBUA 2Q8RE 4IJHA 2KHJA 4JC0A 2ZXPA 2HHHL 1XPUA 1RTNA 4B9XA 5HGTA 1EY6A 5IWAL 5IYDH 4DR5Q 2NN6H 3JSBA 3X3MA 2JA8H 1VQCA 3GTLB 2JN4A 1FR3A 1WGTA 3MXNB 4QQBX 2VW9A 2JAEA 1LV9A 3MC0B 1TS3A 3HOZH 3D4DA 4JI4Q 3R5DA 1S5BD 2JA9A 2JXDA 4A3MH 4OELB 5IYDG 1VQFA 5KIXA 2BA0A 3A8KE 4DNCA 2LMCB 2NN6I 3SGIA 1ULKA 2JA8G 3SK6A 1WTXA 4IJLA 2HT1A 2F1MA 1A15A 1ESRA 3K5NA 2VL6A 4XQQA 3HOZG 2ALYB 1ICFB 4QB4A 2WB1E 5EJWA 1GD7A 3KBGA 1SE8A 1LO5D 3N52A 1BCPC 1JB3A 2RF4A 3D3RA 3SR1A 4CHTB 4UXHA 1HPTA 3M4OB 2B8GA 5D3DA 2CHBD 2F0VA 3U9OA 1QVFA 2QQCA 5C3EH 3OOCA 4QCLA 5HGQA 4UHVA 2UVOA 3E59A 3KLRA 2WACA 2Y0SE 3PQIA 3S1QB 1QB5D 4JVZA 2WCYA 2SGQI 1IBMQ 4CKCA 1FAQA 1F9PA 1JWSD 3TP8A 2UUAQ 3K5OA 1U5KA 4KD4A 4NV2A 5T1IA 2JYYA 5C3EG 3TO9A 3ITPA 1B7YB 3HS0C 2J87A 2IL8A 2QILA 3S1MB 2I0QA 3AJFA 2IJ0A 5FUYA 1G2SA 1II3A 5E1FA 2HIXA 3R3OA 1QVCA 4QL5A 1YNND 2C35B 3STBC 1K3RA 3M9BA 2MJFB 3F2DA 3C1FA 2CWFA 3DWQA 4C1NI 1HHVA 5JHWC 1SJ8A 2BUSA 4XQNA 2DN8A 4DN4M 2EQSA 2F0OA 5J8FA 3MFGA 2VQEL 2FINB 1N8RC 2AUKA 5C0XJ 3B55A 2L4NA 3KOJA 1CKNA 1EYAA 2F0NA 1JE5A 3ULLA 4DXFA 3N6RA 1X9NA 1STNA 4JI2Q 1AFPA 2A73B 1SYEA 1L2FA 1ILPA 2SOBA 3LJ2A 3HOWG 5A35A 3VA5A 1UE1A 3O13A 4QIWE 1STEA 5LMNW 3K58A 2QF7A 3KUPA 2G9HD 1SRUA 4QJFA 3VYTA 1C9OA 1F9SA 2ZTEA 5DM73 4X3UA 5CGKA 2KQ3A 4KN7C 2EY1A 2HIVA 3FSXA 1SGDI 3GP7A 1BCPF 4OHJA 3PO3B 1WGCA 3NUCA 1PRTB 2WB1G 1PZJD 3RLOA 3PIP3 3ERQA 3Q23A 2KHIA 3NP8A 3GTOB 3BDOA 1YU6C 5DAEA 4IFDH 3P1HA 3ND9A 3CW2C 4CDCC 4IUPA 2IX0A 1O7ZA 1TWFH 2UU9L 1VS0A 2B2VA 1B1ZA 2CAZB 1SROA 4JOIA 4J6HA 2WAQB 1YIJA 1TWCH 2LSSA 4FKDA 2F0EA 1XJVA 4OO1I 4HSPA 4I7AA 4GNXA 1O80A 1S5ED 3FSYA 1JICA 4K8JA 2K5VA 4IFDG 1V43A 1WTVA 2F0LA 2B2YA 1G6PA 4AS3A 1M8BA 2LKVA 2A6HC 4LFBQ 1HQMC 1E2ZA 1WTRA 5K36H 1Q8IA 3OW7A 4A3GH 4WORA 4ZCKA 3TDQA 4CJ0B 2VZAA 4GKKL 3A8IE 2KVMA 1PH2A 2K75A 5GAEC 2KHSA 3QO2A 5FUWA 3UGDA 4DR6L 4HN7A 4A3GG 4YZDA 4DK1A 2DIPA 2GVBA 3UDXA 3CCMA 4K14A 2LB7A 1PTOH 1GHJA 2XTQA 3SEBA 1IYJB 3Q8DA 3J80c 4B3TQ 3PO2H 1HA5A 2E5LL 3U9SA 3AMUA 4IPHA 2PW7A 1OXSC 5AJ3Q 1N32Q 1X3GA 3MVVA 1PRTD 1YHQA 4C3JH 4JV5L 1PH3A 3UITA 5IYCH 4DA2A 1SGRI 4DV5L 1PTQA 1UNSA 5KGUA 2SDFA 5KNBA 1YEZA 5ISRA 2R3ZA 4OAVB 1D8LA 4X64L 2B0UC 2PQ8A 1RCVD 2XIWA 1BCPB 1Y1WB 4GLAC 3PO2G 3U4VA 2YTVA 3H6MA 3UOEA 3KDFB 1TGSI 2EY6A 2JEBI 3F8TA 2HQEA 1MSGA 4MTKA 2EY5A 4KKUA 1SJHD 4DR5L 1Y1BA 1OXUA 4RKBA 3I2ZA 4ZAIA 2B39A 1BMOA 5FLXE 3E9HA 4PL3A 3HZXA 2EJGC 4LNQA 1JE4A 1RFHA 2KCMA 2BDOA 3HP3A 3M7NA 1KDBA 3SDZA 1KTKA 2E76C 2D9UA 2UUBQ 4H0LC 3DEPA 3K7AB 2K9HA 4DUYL 1FARA 3R2TA 1WTHA 4DR2Q 5L37A 3I91A 2F3CI 1HNWL 3CU7A 2WKDA 4KY6A 1DOKA 3X3NA 1TDPA 2F0FA 2PQAA 2KCXA 2OZUA 5M3MH 4FNFA 1VF7A 1TS5A 5C4JH 2IX1A 3K5LA 3S16H 1EUJA 2ZJRA 2A20A 3ZJYC 5GAGC 4BY1H 3HOVB 3K7UC 1A3VA 4TSSA 4A75A 4LF8L 3DHQA 4YIJA 5IGFA 5IY0A 3KLSX 2KUMA 3L7ZC 1OMTA 4KD3A 4EGVA 4KHVA 3PMFA 2BA1A 4TVAB 5M3MG 5GAHC 2Z9HA 1PMRA 3LWUA 2OTJA 1Q9BA 1EIFA 2MHVA 2A68D 4JW0A 2I07B 5C4XH 1HEVA 2EYOA 1SSOA 1HH2P 2BL8A 1BCPD 3CC7A 5IGCA 2PNHA 2DNEA 4GS3A 1CGJI 1B44D 3CC4A 1SXTA 3ER0A 4KJOA 3MEHA 5ELBA 3OWFA 1XX6A 2R7FA 4LWCA 2FU2A 3EROA 2N1AB 5CCLA 3V96A 3HH2C 2Z6KA 5C44H 2I5HA 5KEEA 4R4OA 1I94L 2RLDA 2PMZE 2B3GA 3NTKA 4DR3L 1VQDA 2O4XA 1MI2A 4DUZQ 1C0AA 4DV7L 1EY9A 4B9WA 2L12A 1LT3D 1ULMA 5IIFA 3BG3A 3WOFA 1W3SA 3F1ZA 4NXNQ 2EYJA 4HCSA 3K0XA 5C44G 3ERSX 5FLMG 3G48A 2CWAA 1TIHA 1JJ2A 3CC2A 1K8OA 2WGCA 4GXTA 1WI5A 2R93H 2CQAA 4DV1Q 4TQUS 2MUYA 4IOCA 1VQ6A 4JI2L 5NUCA 1U4LA 3DMUA 1X56A 5LL6S 1MKHA 1KABA 1OXVA 3CCEA 2HHHQ 3I70A 1DXMA 5G3LF 1IYVA 1O78A 5IWAQ 4OAUC 4QF4A 1SNDA 1TWAB 1LTAD 3HRZC 1B53A 1TY2A 5EGTA 4JBMA 2P6AC 2ID0A 2N78A 4X62L 1VQOA 1R4QB 2NU4I 3KYHC 1V1PA 4XXEA 1GJXA 3AEVA 3I4MH 2AWNA 4LFAL 4JK1C 4O0AA 3IAS1 4N9TA 3CCJA 1EEFD 1F9QA 1GM5A 4KK7A 5ELDA 5GQOA 3GO5A 3ZYYX 3LNNA 4C56C 1R79A 3Q0AA 3I4MG 2FFKB 2ARPF 4OL7A 1JC7A 1KAWA 3BZDB 3M3YB 1HTPA 1STBA 4XQJA 4BBSH 4P73A 1WD1A 2L7XA 1TOTA 2A6EC 1Y69U 2R61A 4QUCA 3S2HH 3FKIH 2VUMH 1F2LA 5C0XH 3CPWA 1Q90A 1B50A 2JB2A 2QKIC 1JR0D 2RCFA 1PJUA 2JA8B 1VMPA 1R4PB 4CDEC 2EDGA 1VQGA 4JI6L 2QQDA 2YFAA 1J9OA 1LACA 1OTCA 1G8ZD 4BBSG 1YVCA 2OEOA 1N33L 1J8IA 3J80i 3HOZB 2CQOA 3FKIG 5C0XG 1X3QA 2A6HD 2F0KA 1F2MA 4A3MB 4Z7HA 1ICWA 3GD7A 4UP7A 3ULPA 4I1TA 2A69C 1PTOC 1BR9A 1I6VC 1Z47A 2DB6A 5ELFA 2B2VC 1M1KC 4IUUA 2X3TA 3E2IA 3OXLA 4O1PA 3VA9A 4I7ZC 5IOCA 4JOIC 5AJ3L 1N32L 4HJ7A 5HY6A 3OYYA 1NMGA 4KLKA 2PQEA 4GOPA 2A74C 5IE8A 4GNXC 3A5ZB 3DA3A 1PFSA 1WTPA 3RN2A 1TS4A 2K1BA 2K7VA 4AYBB 1Z9FA 3LWEA 2GSCA 4OONA 5IYBH 3K57A 4LF9L 5IGDA 4C3IH 1QNUA 2PNRC 5C3EB 2Z0SA 3OW2A 4L8JA 2F0GA 3HOYH 1XWEA 1PV4A 2CFMA 3OXGA 3R5CA 3KLWA 4ZKBB 1OYVI 2ERWA 1S5CD 1T5XD 3A7LA 2F3WA 1TY0A 1D7QA 2LS01 2IWHA 3W1BA 1PH5A 4CBVA 4JCVE 1B4OA 2K28A 3MTSA 2KEEA 2J0TD 4DV3L 4DR1Q 1H9SA 1TXYA 3J80E 1PA6A 2VB2X 2RHSB 4S3SA 3KFUA 1PH9A 2UUBL 4KJNA 1N9WA 1JJCB 4JI8Q 4MHEA 3HOYG 4DFAA 4BY7H 3DWPA 2E5RA 3RZDH 1J6QA 3I72A 1C48A 3DEOA 3H91A 2EYFA 1V1QA 2OXPA 4IN3A 4RGMA 3CXLA 3A0JA 1CTMA 2O5IC 2YTYA 2N17A 1RL2A 3I90A 4N9PA 3CPFA 4OWTB 2YYZA 1WCMH 1M4VA 5IGGA 2F0SA 3GTGH 1UVFA 5IP7H 2F52A 2JQOA 3KF6A 3CXCA 2NVTH 3BS1A 1GUGA 4GKJQ 2QCPX 5IGEA 1K8AC 3WDNA 3OIQA 1LTTD 1X74A 3D6WA 5G3LD 1UEBA 4RFBA 1Q82C 1PTOF 1N36Q 3GV6A 2E2HH 4RHRA 3EFXD 5ELOA 1A63A 3HOXH 4DGZA 4BBRH 1K0RA 4EVOA 1D5MC 3KJOA 1WVLA 4A93H 4JI1L 1SLJA 1D1IA 3FP9A 3S17H 1K9MC 3M4QA 4RCNA 1H9KA 4NXML 3J81j 2HDLA 5CBAE 1W6KA 1A0IA 1VQAA 3HOXG 4BBRG 4A3IG 3KK7A 1UHAA 3TZUA 2WIIB 5IGBA 4A93G 3GTQH 4L5TA 2NB0A 1WYDA 3T13A 1H9RA 2L55A 3U58A 5GROA 5FUXA 4DV0L 1GVPA 1TWFB 2NWGA 4HR7B 2E5LQ 2PZUA 4JYAL 4YZCA 4FXGC 4EQOA 4DWLA 1JORA 1CKNB 3LX0A 2KCNA 4XYQA 1WOCA 2JXMB 2CJSC 2RIJA 1TWCB 1HNXQ 1CT2I 1GHKA 2DKVA 4L5SA 2HGKA 3CRLC 4DV5Q 3S24A 2UXDL 1VDZA 2BDNA 3CCRA 1PHJA 4FF1A 1JOOA 3G4SA 1XX8A 4X3KA 1XBTA 2UUCQ 2V1CA 1KMAA 1PPFI 5EPJA 2RKSA 2O5JC 2SNMA 2XWBB 1SNQA 4NDXA 3BJUA 3VDPA 5EBDA 3S1NH 4A3GB 3M85A 3TMEA 1YHAA 5BN5A 1NUBA 3GDEA 4EQ5A 1XMQL 4KHZA 3SHLA 3EQLC 2K19A 2Z6KC 1ONLA 2AQ2B 1I5FA 4A3BB 3QOLA 1SGYI 1UE5A 4OX9Q 1HPCA 4OWWB 1KAAA 1MBYA 1FNWA 4LK1C 4QIWB 4X65Q 4UY8C 3H94A 2AQ3B 1SNOA 1O7IA 4X3SA 4XT1B 4YZ9A 3R8BA 2Z6BA 4IZ8A 1U4MA 2N71A 2VQFL 2P5ZX 4DUYQ 2JA7G 3UFFA 3MZ5A 1PTOB 2QEJC 2EZVA 4GN4B 2K5DA 3ICEA 3PO2B 1HNWQ 1JQYD 1NY4A 3VR6A 2KMQA 1VCIA 1SYFA 2QA4A 2XTRA 4C3JB 2O2LD 2Z8LA 1HXYD 1YJNA 1WD0A 1HUNA 2ORWA 2GVIA 2ZM6Q 1FL0A 3B6YA 2FEFA 4GNXB 2A68C 4BS9A 1OMUA 3NHHA 3TBIB 1CK1A 2HQLA 5FOBB 2OF1A 1S3OA 1CSQA 1E1OA 1E2WA 1IW7C 2RA4A 1AZQA 4LF8Q 3NBIA 4CKBA 2ZXOA 4V190 1LT6D 2NVQH 3S2DB 4FDBA 2R92H 1ZKOA 5FO9B 3NQIA 4LF6L 4YCUA 4A3KH 3RZOH 1TVXA 3M7GA 3SE0A 1RHPA 2FNFX 3UEJA 2DGYA 5CC4A 4DAPA 3TP6A 1A3TA 2MPMA 1LR8A 4R4QA 4F8MA 3NK9A 3HFZB 2ZW3A 2A6ED 2R92G 3HKZB 1LTBD 1V1HA 1S5FD 1QWYA 3OSOA 4DXGA 4A3KG 4XYOA 3F2BA 1XNQL 5EPLA 1I94Q 3EA6A 1VQEA 1ENCA 5M9OA 2XVSA 4DR3Q 2GKRI 5M5WH 2JBWA 4DV7Q 4KKTA 1ENFA 4YWMA 2AUJD 1QUQA 3NTIA 4AH6A 2F0HA 3HOWH 2B63H 2C9OA 5KRUA 2F4VQ 2MO1A 5M3MB 1EY4A 5C4JB 4IO9A 3UE1A 3S16B 4K5VA 3D6CA 2A69D 5M3FG 1MHWC 4BY1B 1F77A 1PTOD 2YU9H 4PL4A 1YO7A 1X3PA 3IAYA 1XA6A 4X66Q 2CWPA 3K6OA 1PYBA 1HUMA 1EZ8A 2E73A 4OWXB 2AHOB 2B63G 5J8CA 3ND8A 1Y8OB 4AQYQ 3MWYW 1SGNI 1EWCA 2GKVA 3QAHA 4UAIA 1T9HA 2JE6I 4DNTB 4GN3B 4IUTA 3BU2A 3M4PA 1V9PA 4H7BA 5C4XB 3PCOB 1ASZA 4Q9VA 1JOQA 4DR1L 1FYCA 3OWEB 3TS2A 5CV6A 3AFPA 3L9AX 1LR7A 4IUNA 4JI8L 3VR4A 1SDFA 3A54A 2XTIA 1EIHA 2HDMA 3H3VH 3RUZA 1Z7TA 4X62Q 2D0PA 4UXJA 4YY3L 2EXDA 1FYBA 4JI0Q 3OMCA 1EEID 4ULLA 4C3HG 1FY7A 4HAEA 4BA2I 2PQAB 4K2LA 1FGUA 4DV2L 4GOPC 1H9MA 4LFAQ 1E7ZA 5LL6X 1ZXTA 4APVA 3R5BA 1LYLA 2Y0SG 4GKJL 2QDLA 1KRTA 1UE6A 3CQZH 1RF2D 4ME5A 1ASYA 3J80L 3GTKH 1L1OA 1HTLD 4RG1A 2R93B 4LW1A 1K73C 4C2MH 3K80C 4Y7NB 5IT9c 1VQ7A 2A2CA 2JA5H 4K6LA 1N36L 4IFDI 3L2PA 1K0SA 4JPBW 2PI2E 1B2TA 2ETDA 3T1YQ 3A56A 1D2BA 4HIKA 1I50H 3S15H 2R7ZG 4WJWA 3T4AC 3TP5A 1QG7A 1VQ5A 2JA5G 2MGSA 4N8X1 5ELNA 4JI6Q 1TUSA 2RBMA 1YZ6A 2K6AA 4B3ML 1N33Q 4CDDC 2E2JH 1EY5A 5E3FA 1Q1BA 2FHTA 1Q86C 4FO2A 4DV6Q 1PVOA 3SGBI 2PYKA 4WJ3M 3I4MB 3VYSA 4RMFA 4OVOA 1S40A 2F0MA 4J1MA 2CW0C 5J39A 1SJED 3MEFA 5EKIA 2C5CA 2PZTA 1ET9A 2K04A 3PIO3 4E1RA 1D1KA 3I4OA 2A1AA 1DJRD 5CR3A 2PMZB 4UP8A 5CBEE 2K03A 1KD1C 1HNXL 2KCCA 3FRPB 1AZPA 2F4IA 1VQHA 2Q2IA 4YWLA 3W5OA 3OPOA 4ZQ3A 2UUCL 2B2TA 4IOAA 4ODGA 4LF9Q 4BBSB 2N52A 4AS2A 1SE3A 3H0GH 3ONAB 1HZ9A 3DM1A 3S2HB 3FKIB 1B3QA 1CQVA 2VUMB 2RCNA 2EJMA 4KI0A 1BBXC 2MP1A 1NXUA 2IHEA 3MHBA 2R7DA 2FUG1 3A7AB 1G91A 1UAPA 3V2TA 5C3WA 4FP5D 1MJEA 1N13A 3JAMc 2E2DC 2QGMA 4HJAA 4OX9L 1XYIA 4X65L 1FJGL 4DV3Q 1C8CA 3H0GG 3CP0A 3DXJC 3Q24A 2HCIA 1V1PB 3LJ1A 1E22A 2FMCA 2TSSA 2K01A 3FPPA 4HMIA 2KMOA 4K5XA 1PZID 1CQFA 4DR7Q 3NSWA 2RHQB 2B2WA 1HZCA 3D31A 1Z7KB 3SK8A 1GUWA 1GOZA 5BR8Q 1Y1CA 4Z9CB 1BOSA 4G4KA 2ZM6L 3HOUH 4ZUIA 2YTXA 4SGBI 3UDGA 5C5LA 1ESFA 5T1GA 3MFYA 2V1CC 5JVG3 2L0CA 1LR9A 2B8TA 2WAQE 1X65A 2YFBA 1HFGA 3EVQA 1BDOA 4C3IB 2NVXH 2OQ0A 3HOUG 2EIFA 3RNUA 3HOYB 1TWGH 4JI5Q 3B4VC 3QOJA 3S14H 1LABA 3OIPA 1HJPA 2DY8A 2VRWB 4A3EB 1XXGA 2J9RA 1IW7D 1CGII 1PZKD 5I9PA 5KYIA 5JOBA 2A8VA 1TT2A 1U9RA 4JI1Q 5E3RA 4ILWA 4LFCL 1MSHA 3AB9A 1YJ9A 2IT1A 3BVZA 5FLMH 4BY7B 4KY5A 4NXMQ 4K0KL 2KEDA 4NKLA 3RZDB 3QJYA 1EIYB 1VQ8A 4LAAA 1E0BA 4PQXA 1SEBD 2AMCB 3NELA 1SFOH 2UZ3A 5DAUA 3KP9A 2QZGA 3A55A 1DYQA 1DOMA 4EQNA 1WCMB 3I7FA 4BWGB 4GOPB 3I56A 3CKIB 2F4VL 3GTGB 4DU9A 3QG1A 2HCCA 2NVTB 4DV0Q 3E6ZX 1EZ6A 1TBNA 2RDHA 2OTLA 4JYAQ 2JZMA 2YQPA 4LF4L 1VDDA 4X66L 4DK6C 5BN4A 2UXDQ 2KMRA 2ES2A 1VQNA 1A2TA 2FJ2A 4LUOA 2DY7A 4AQYL 1BF4A 2EYPA 4DNRB 1O7LA 1KRSA 3PGZA 3Q6SA 1GUTA 2E2HB 1RJTA 4G7ZC 3PF5A 2V6EA 3GV3A 3PO3G 4IPGA 1I6HH 4KY7A 2CWHA 3R2IA 1Z2IA 3HOXB 4BBRB 1H9SB 2A5HA 1ET6A 3SK5A 4POFA 1Q81C 4XT3B 4A93B 1PH6A 1XMQQ 2XNAC 1KDCA 1QZHA 4YHHL 1BO0A 2HD3A 3S17B 1K83H 1MJBA 2QQ0A 1Q8KA 4WJ4A 1WFQA 1XTCD 2XRQD 3NWSA 4V0BA 3I4NH 1A2UA 4JI0L 1G51A 1R0RI 5EBCA 1JWUD 1DZ1A 2WAQG 2V4DA 2QSBA 4IPDA 1S4ZA 5IP9G 4XIGS 4AIMA 2H4OA 2VQFQ 2J7ZA 1KQSA 1CA5A 3GTQB 4PG3A 5DEHA 4RCOA 3KF6B 3GTPH 3T53B 2QPOA 3MA2B 2E2IH 1E24A 3SEKC 1PXUA 5EKKA 5FJ8H 3I4NG 5EX3A 2N55A 3GOXA 3FPUB 1S20A 1LTSD 2CKZB 2YUUA 3HGBA 1H0ZA 3UGLA 3U50C 2EPBA 3I73A 4ZYSA 3TZDA 2JJQA 4HIMA 1Q3LA 1LT4D 5JPNC 4PMBA 3T1YL 1CHQD 5M5YH 1K3BC 2X6LA 3P75A 5FJ8G 1CFMA 4WRDA 4CJ1B 1YNJC 2M00A 1GKHA 4LF6Q 5FO8B 1V1OA 3S1NB 2F0QA 3UDIA 1UVGA 2ODDA 2RADA 5EAYA 4A3LH 5ELEA 2N88A 1WTQA 1DOLA 4Z7GA 2GKTI 1OXTA 4PMWA 1H95A 3HEJA 4LJZC 5D3IB 4ID6A 4EX5A 1DM0B 3CCLA 2W0TA 3J7AV 4DV6L 1STAA 1ENAA 3RMHA 2SNSA 5C0XI 4DK0A 2OVOA 2JEAI 2I5MX 1XNQQ 2F66B 4A3LG 3PUYA 1VQLA 5IT9E 4NP5A 1KNAA 1EQTA 2I5LX 1I3QH 5CV7A 5E4XA 1Y1WG 2OD1A 3OHXC 5JPMC 3NEMA 4ALPA 4IFDJ 1XMOQ 1YHBA 3PSIA 1TWHH 3KY9A 1WTOA 5E4WC 1CUKA 2KJXA 3JC66 2ZJPA 1SNCA 1SNPA 4G76A 1O7YA 2B2YC 5A2QE 4ZUJA 5J22A 2ICEC 3TS0A 1QILA 2CW0D 2MQHA 1FD7D 5CV9A 3JAMi 2NVQB 2CCZA 2R92B 2I46A 1D5ZC 5KYLA 1YI2A 4A3KB 3RZOB 3TO7A 3OMGA 2K5QA 1ML0D 3A74A 3GTJH 1QCBD 1CSPA 2QEXA 1A62A 3S1RH 2BE5C 1XPRA 2K5HA 5FK9C 3J81c
chains in the Genus database with same CATH topology
3HOVH 2OQKA 2ENNA 4HIDA 4NV5A 1X54A 2NZOA 2D0OA 2UXBQ 1Y14B 2D62A 3K8AA 4DR7L 4YY3Q 3HOVG 3HKSA 4P75A 1HDLA 2VY3A 5BR8L 4DV2Q 1W4RA 1KIXA 4L5RC 4DNIA 2N8NA 4X6AH 1TURA 4DKAC 5HQ8A 3E9IA 3PUZA 5JJIA 1AE3A 1HZAA 5LMNL 2SGDI 2LUYA 1IZ6A 4IPCA 1WJJA 5JJKA 4JI5L 4JI7L 1XNRL 2R6GA 1EWIA 1IBLQ 1KBEA 4A3IH 1CKMA 4B3SQ 3FHWA 1SGPI 3NENA 1KC8C 4B3MQ 1X4SA 4POGA 5M5XH 1C7YA 1AN1I 4A76A 2KCTA 2XMXA 1KXLA 1SGEI 3IRBA 1QUQB 3G71A 1PYSB 1VQMA 1JMCA 2ZTDA 3TREA 5DLQE 3VDYA 4LUVA 1PH4A 3U4ZA 3TEHB 1VQIA 5LMUL 4HJ8A 4LF5Q 4G75A 2K50A 4AYBE 2DUDA 1IL2A 3QTLD 4PL5A 3A5UA 2JB1A 2JW6A 2B29A 3RU0A 2JA7H 2ATWA 1B8AA 3G6EA 2ENZA 4MTNA 1Q12A 1SN8A 1VQKA 5CCMA 1FJGQ 3TQYA 2ORVA 4A3DH 3CD6A 1VQJA 1VQBA 5LNK1 2UXCL 4A3FH 3GTMH 4ME3A 1VQ9A 4H02A 1L1OB 4HJ5A 4A3DG 3CMEA 4JBWA 1YITA 1NJIC 2NN6G 2M5XA 4A3FG 2GN5A 2WP8J 1FVIA 1BKBA 4GLVB 4MNOA 3LGJA 4A3MG 1OXXK 2GVAA 1AE2A 4O1OA 4L9MA 2JA6H 2L8EA 4P74A 4LFCQ 3F2CA 2QQEA 3I9V1 4K0KQ 3CMAA 5M3FH 4AYBG 2F6MB 5GADC 4JBKA 5JEAJ 2JA6G 2XGTA 3T1HL 3FC3A 1XMOL 1NMFA 4PZ7A 4KHPQ 1N34Q 2KENA 1HR0L 2YV5A 1R9TH 3OXFA 4LF4Q 1P16A 2BH2A 4A24A 4B3RL 3UDFA 3J81i 4NPSA 1IY6A 2Q2HA 2VNUD 3J7A5 3QWPA 4C3HH 1AH9A 2JA1A 4YHHQ 3F4MA 3EIVA 1HNZL 2UXBL 3PF4A 1BUSA 4UP9A 4PZ6A 2MNAA 4DR4L 3BJIA 3H3VI 1E3PA 3SGQI 2R7ZH 3DA4A 2SGFI 1Y1VH 2IY5B 2NVYH 4DAMA 3D00A 2F3IA 4UPAA 1J5EL 1IBLL 2LXJA 1HZBA 4OO1G 1Y1VG 4B3SL 1JJGA 1MJCA 1SR3A 4A3JH 4LUZA 1K8GA 4DV4L 2OCEA 1YTPA 2PI2A 3HKZE 1EQRA 3I55A 4R1JA 1UWVA 2ZTCA 1IBKQ 5EX0A 1M8CA 3GTLH 3UGIA 1NE3A 4A3CH 4A3JG 1NBWA 3OTOL 2RIOA 4A3BH 1EQQA 3RR5A 2MO0A 1X3FA 4LF5L 1RIPA 5K36G 1A8VA 1YNXA 4HIOA 1JT8A 3TJQA 4LF7Q 4HJ9A 4A3CG 1X3EA 4B6DA 4A3BG 3D0FA 1CSOI 1TBOA 5HGIA 4JI3L 1Q7YC 2N3SA 4A4IA 1EYGA 3CCQA 2ROWA 3M4OH 3TRZA 3S2DH 2KBNA 3AYHB 1CKOA 5IYCG 3W1GA 4HEA1 3S1QH 2ZJQA 3PUXA 3MEKA 2V53A 4QY7A 2IHFA 5J3BA 4JI4L 2NU0I 3DO9A 3S1MH 2NU2I 1B70B 1Q46A 3CAMA 5LMNQ 3CCUA 2K52A 4JG2A 5E7NA 2MFIA 3HKZG 2L1LB 4JI7Q 1PH1A 1XNRQ 2JB3A 3FBVA 2AKWB 4NB3A 4YCWA 1JB7A 3RLFA 3AQQA 1IW4A 1SGQI 1M90C 4HFVA 1HR0W 2K14A 3DM3A 1IBML 4BY1G 2UUAL 1EFWA 4DK3C 1QVGA 1QZGA 4OXPA 4KHPL 1N34L 1MT1A 3OVOA 3VDUA 3PO3H 3P23A 1DS2I 5LMUQ 5C4XG 4P72A 3J7ZC 3GTOH 2OWOA 2WVJA 3UE0A 2NZHA 3OL0A 2A19A 1U0LA 3WWVA 3SDJA 3AFQA 5IP9H 4Y7NH 3STBD 3H15A 3E0EA 1NTGA 1GO3E 4BXXH 2SGPI 3LJ0A 3BZKA 2NU1I 3KDFA 1TBQR 2R93G 3NBHB 2KMPA 2LEOA 2UXCQ 5FUVA 4BXXG 1VQ4A 3KJPA 2Q2UA 1X6OA 4GLXA 3EN2A 5JJLA 3L0IA 2LXKA 3KF8B 3K81C 3RN5A 4O2DA 4L5QA 1PH7A 1Y8FA 2VS1A 1UUCA 1E1TA 1KHIA 4QGUA 5JEAG 2A2DA 1XTDA 4XTCS 2N49A 1Y1WH 4YWKA 3CF5A 4LFBL 1IBKL 4BA1I 1LTLA 1DS3I 2NU3I 1L1OC 4JBJA 1SMXA 3T1HQ 2Q2TA 1BBWA 2VUMG 3K7AH 1HR0Q 4LF7L 5HI7A 1W2BA 1HJAI 3PUVA 2L15A 1LM0A 4B3TL 4HGUA 4B3RQ 1IXRA 1Q1EA 4GN5A 4Y52H 4R4IA 4P71A 3CCSA 2VQEQ 3L0OA 2ELIA 2SGEI 1VQPA 3VE5A 1XPOA 1V1IA 1KBFA 1PH8A 1P8LA 1S72A 1HNZQ 2P22B 1PTRA 2JK8A 1CT0I 5IYBG 3ULJA 3PIPA 2WFWA 4A3EH 2K4KA 2QGQA 3UEYA 4GI3C 4DR4Q 1X55A 1OVOA 1EOVA 4DR2L 1G291 4A3EG 2E8GA 1IY5A 2ZRRA 4DPGA 1L0WA 4UXIA 2FXQA 1CHOI 4BY7G 3DLLA 2AWOA 1J5EQ 2UU9Q 4J15A 2K5NA 4PZ8A 5H1SE 3PDNA 4MZ9A 1CT4I 2H5XA 2ASBA 1PCEA 1WCMG 2KKMA 5IP7G 3CCVA 4DV4Q 2BH8A 1CE3A 1TWAH 1TBRR 3BZCA 4GKKQ 1LUZA 4U6RA 3OTOQ 3PV0A 3RLNA 2IP6A 3EBEA 1YBYA 3PIOA 1YJWA 4DUZL 4DR6Q 4DAYB 5FLXc 3PUWA 1KL9A 1MIUA 1DGSA 4NXNL 4R4CA 3IAM1 4JV5Q 4JI3Q 4DV1L 2XRCA 1UE7A 4E1PA 1BVSA 4R4TA 3M3YH 4YCVA 4X64Q 1BBUA 4IJHA 2KHJA 4JC0A 2HHHL 1XPUA 5IWAL 5IYDH 4DR5Q 3JSBA 2JA8H 1VQCA 3MXNB 4QQBX 2VW9A 2JAEA 3HOZH 4JI4Q 2JA9A 2JXDA 4A3MH 5IYDG 1VQFA 2BA0A 3SGIA 2NN6I 2JA8G 4IJLA 2HT1A 2VL6A 3HOZG 2ALYB 2WB1E 1GD7A 1SE8A 2RF4A 4UXHA 1HPTA 1QVFA 2QQCA 5C3EH 5HGQA 3E59A 2Y0SE 2WCYA 2SGQI 1IBMQ 1FAQA 2UUAQ 1U5KA 4NV2A 2JYYA 5C3EG 1B7YB 2J87A 2I0QA 3AJFA 5FUYA 2HIXA 4QL5A 1QVCA 2C35B 3STBC 1K3RA 3M9BA 2MJFB 3F2DA 5JHWC 1SJ8A 2BUSA 2EQSA 2VQEL 1N8RC 5C0XJ 3KOJA 1CKNA 3ULLA 1JE5A 1X9NA 4JI2Q 1L2FA 3LJ2A 3HOWG 1UE1A 4QIWE 5LMNW 1SRUA 4QJFA 1C9OA 2ZTEA 2HIVA 1SGDI 2WB1G 3RLOA 2KHIA 1YU6C 5DAEA 3CW2C 2IX0A 1TWFH 2UU9L 1VS0A 2CAZB 1SROA 4JOIA 1YIJA 1TWCH 2LSSA 4FKDA 4OO1I 1XJVA 4GNXA 4IFDG 2K5VA 1V43A 1G6PA 4AS3A 1M8BA 4LFBQ 4A3GH 2VZAA 4GKKL 1PH2A 2K75A 5GAEC 5FUWA 3UGDA 4DR6L 4A3GG 4YZDA 2DIPA 2GVBA 3UDXA 3CCMA 2XTQA 1IYJB 3Q8DA 3J80c 4B3TQ 3PO2H 2E5LL 4IPHA 1OXSC 5AJ3Q 1N32Q 1X3GA 1YHQA 4C3JH 4JV5L 1PH3A 3UITA 5IYCH 1SGRI 4DV5L 1PTQA 1YEZA 4OAVB 1D8LA 4X64L 2B0UC 4GLAC 3PO2G 3U4VA 2YTVA 3KDFB 1TGSI 2JEBI 3F8TA 4DR5L 1Y1BA 1OXUA 3I2ZA 1BMOA 3E9HA 4PL3A 4LNQA 1RFHA 2KCMA 3M7NA 2UUBQ 2K9HA 4DUYL 1FARA 4DR2Q 2F3CI 1HNWL 2PQAA 2KCXA 5M3MH 5C4JH 2IX1A 3S16H 1EUJA 2ZJRA 2A20A 3ZJYC 5GAGC 4BY1H 3K7UC 4A75A 4LF8L 5IY0A 3L7ZC 1OMTA 2BA1A 4TVAB 5M3MG 5GAHC 2OTJA 1EIFA 5C4XH 1HH2P 3CC7A 2PNHA 4GS3A 1CGJI 3CC4A 3ER0A 1XX6A 2R7FA 4LWCA 5CCLA 2N1AB 3HH2C 2Z6KA 5C44H 2I5HA 4R4OA 1I94L 2PMZE 2B3GA 4DR3L 1VQDA 4DUZQ 1C0AA 4DV7L 1W3SA 3F1ZA 4NXNQ 3K0XA 5C44G 3ERSX 5FLMG 3G48A 2CWAA 1TIHA 1JJ2A 3CC2A 4GXTA 1WI5A 2R93H 4DV1Q 4TQUS 4IOCA 1VQ6A 4JI2L 1X56A 1MKHA 1OXVA 3CCEA 2HHHQ 5IWAQ 4OAUC 4JBMA 2P6AC 2ID0A 2N78A 4X62L 1VQOA 2NU4I 3KYHC 3AEVA 3I4MH 2AWNA 4LFAL 4O0AA 3IAS1 3CCJA 1GM5A 5GQOA 3GO5A 1R79A 3I4MG 2ARPF 1KAWA 4BBSH 4P73A 2L7XA 1TOTA 3S2HH 3FKIH 2VUMH 3CPWA 2JB2A 1PJUA 1VQGA 4JI6L 2QQDA 2YFAA 1OTCA 4BBSG 1YVCA 1N33L 3J80i 2CQOA 3FKIG 5C0XG 4Z7HA 3GD7A 4UP7A 3ULPA 4I1TA 1Z47A 2DB6A 1M1KC 3E2IA 3OXLA 4O1PA 3VA9A 5AJ3L 4JOIC 1N32L 4HJ7A 5HY6A 3OYYA 1NMGA 4KLKA 4GOPA 5IE8A 4GNXC 3A5ZB 3DA3A 1PFSA 3RN2A 1Z9FA 4OONA 5IYBH 4LF9L 4C3IH 2Z0SA 3OW2A 3HOYH 1PV4A 2CFMA 3OXGA 3KLWA 1OYVI 2ERWA 1D7QA 3W1BA 1PH5A 4JCVE 4DV3L 4DR1Q 1TXYA 1PA6A 2RHSB 3KFUA 1PH9A 2UUBL 1N9WA 1JJCB 4JI8Q 3HOYG 4BY7H 2E5RA 3RZDH 1J6QA 1V1QA 3CXLA 3A0JA 2YTYA 2N17A 1RL2A 3CPFA 4OWTB 2YYZA 1WCMH 3GTGH 1UVFA 5IP7H 2JQOA 2F52A 3KF6A 3CXCA 2NVTH 4GKJQ 1K8AC 1X74A 1UEBA 1Q82C 1N36Q 2E2HH 5ELOA 1A63A 3HOXH 4BBRH 1K0RA 3KJOA 4A93H 4JI1L 1SLJA 3FP9A 3S17H 1K9MC 3M4QA 4NXML 3J81j 1A0IA 1VQAA 3HOXG 4BBRG 4A3IG 4A93G 3GTQH 4L5TA 1WYDA 5FUXA 3U58A 5GROA 4DV0L 1GVPA 2E5LQ 4JYAL 4YZCA 4DWLA 1CKNB 1WOCA 2CJSC 1HNXQ 1CT2I 4L5SA 4DV5Q 3S24A 2UXDL 3CCRA 1PHJA 3G4SA 1XBTA 2UUCQ 2V1CA 1KMAA 1PPFI 3BJUA 3VDPA 3S1NH 3M85A 1YHAA 1NUBA 3GDEA 4EQ5A 1XMQL 4KHZA 2K19A 2Z6KC 1I5FA 1SGYI 1UE5A 4OX9Q 4OWWB 4X65Q 4UY8C 1O7IA 4YZ9A 2N71A 2VQFL 4DUYQ 2JA7G 3UFFA 4GN4B 3ICEA 1HNWQ 1NY4A 2KMQA 1VCIA 2QA4A 2ORWA 2XTRA 1YJNA 2GVIA 2ZM6Q 1FL0A 3B6YA 4GNXB 1OMUA 2HQLA 1S3OA 1CSQA 1E1OA 4LF8Q 2NVQH 4FDBA 2R92H 4LF6L 4YCUA 4A3KH 3RZOH 2FNFX 3UEJA 2DGYA 1LR8A 4R4QA 3HFZB 2R92G 1V1HA 4A3KG 3F2BA 1XNQL 1I94Q 1VQEA 4DR3Q 2GKRI 5M5WH 4DV7Q 4YWMA 1QUQA 4AH6A 3HOWH 2B63H 2F4VQ 2MO1A 4IO9A 3UE1A 5M3FG 2YU9H 4PL4A 1YO7A 1XA6A 4X66Q 2CWPA 1PYBA 2E73A 4OWXB 2AHOB 2B63G 4AQYQ 1SGNI 2GKVA 1T9HA 2JE6I 4GN3B 3BU2A 3M4PA 1V9PA 3PCOB 1ASZA 4Q9VA 4DR1L 3TS2A 3AFPA 1LR7A 4JI8L 2XTIA 3H3VH 4X62Q 2D0PA 4UXJA 4YY3L 2EXDA 1FYBA 4JI0Q 4BA2I 2PQAB 1FGUA 4DV2L 4GOPC 4LFAQ 1E7ZA 4APVA 1LYLA 2Y0SG 4GKJL 1KRTA 1UE6A 3CQZH 1ASYA 3GTKH 1L1OA 4RG1A 4LW1A 1K73C 4C2MH 3K80C 5IT9c 1VQ7A 2A2CA 2JA5H 1N36L 4IFDI 3L2PA 2PI2E 3T1YQ 4HIKA 1I50H 3S15H 2R7ZG 1VQ5A 2JA5G 4JI6Q 5ELNA 1TUSA 1YZ6A 4B3ML 1N33Q 2E2JH 1Q1BA 1Q86C 1PVOA 4DV6Q 3SGBI 4WJ3M 4RMFA 4OVOA 1S40A 3MEFA 4E1RA 3I4OA 2A1AA 1HNXL 1KD1C 4UP8A 1VQHA 2Q2IA 4YWLA 3W5OA 4IOAA 2UUCL 2N52A 4LF9Q 4AS2A 3H0GH 1HZ9A 2RCNA 4KI0A 2IHEA 2R7DA 2FUG1 1MJEA 1N13A 3JAMc 4HJAA 4OX9L 4X65L 1FJGL 4DV3Q 3H0GG 3CP0A 3LJ1A 1E22A 2KMOA 4DR7Q 2RHQB 1HZCA 3D31A 1Z7KB 5BR8Q 1Y1CA 2ZM6L 3HOUH 2YTXA 4SGBI 3UDGA 2V1CC 1LR9A 2B8TA 2WAQE 1X65A 2YFBA 2NVXH 2OQ0A 3HOUG 2EIFA 3RNUA 1TWGH 4JI5Q 3B4VC 3S14H 2VRWB 1HJPA 2J9RA 1CGII 2A8VA 4JI1Q 4LFCL 1YJ9A 2IT1A 5FLMH 4NXMQ 4K0KL 1EIYB 1VQ8A 2AMCB 3NELA 1SFOH 2UZ3A 3KP9A 3I7FA 4GOPB 3I56A 2F4VL 4DV0Q 1TBNA 2OTLA 4JYAQ 2JZMA 2YQPA 4LF4L 1VDDA 4X66L 4DK6C 2UXDQ 2KMRA 2ES2A 1VQNA 4LUOA 4AQYL 1KRSA 3PGZA 3PF5A 2V6EA 3PO3G 4IPGA 1I6HH 4POFA 1Q81C 1PH6A 1XMQQ 1QZHA 4YHHL 2QQ0A 1K83H 1Q8KA 4WJ4A 1WFQA 3I4NH 4JI0L 1G51A 1R0RI 2WAQG 4IPDA 5IP9G 1KQSA 2VQFQ 4XIGS 4AIMA 4PG3A 3GTPH 3KF6B 2QPOA 2E2IH 1E24A 3SEKC 5FJ8H 3I4NG 5EX3A 3GOXA 2CKZB 2YUUA 1H0ZA 3UGLA 3U50C 2JJQA 4HIMA 3T1YL 5M5YH 5FJ8G 1GKHA 4LF6Q 3UDIA 1UVGA 2ODDA 5EAYA 4A3LH 4Z7GA 2GKTI 1OXTA 4PMWA 1H95A 2W0TA 4EX5A 3CCLA 4DV6L 5C0XI 2OVOA 2JEAI 2I5MX 1XNQQ 2F66B 4A3LG 3PUYA 1VQLA 2I5LX 1Y1WG 1I3QH 2OD1A 3NEMA 4ALPA 4IFDJ 1XMOQ 1YHBA 3PSIA 1TWHH 3KY9A 1CUKA 3JC66 2ZJPA 4G76A 3TS0A 2MQHA 3JAMi 2CCZA 1YI2A 3A74A 3GTJH 1CSPA 2QEXA 1A62A 3S1RH 1XPRA 2K5HA 3J81c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW Q;  3HOV H;  1NY4 A;  5LMU Q;  2OQK A;  4LFB Q;  1VCI A;  5C4X G;  4P72 A;  2QA4 A;  3J7Z C;  4A3G H;  1YJN A;  2ZM6 Q;  3GTO H;  1FL0 A;  3B6Y A;  2VZA A;  2OWO A;  4HID A;  4GKK L;  4GNX B;  1X54 A;  2HQL A;  2NZO A;  2D0O A;  1PH2 A;  1S3O A;  1CSQ A;  1Y14 B;  2UXB Q;  1E1O A;  2D62 A;  2K75 A;  3K8A A;  5GAE C;  4DR7 L;  4YY3 Q;  3UE0 A;  4LF8 Q;  2NZH A;  3HOV G;  3HKS A;  2A19 A;  4P75 A;  2VY3 A;  2NVQ H;  1U0L A;  4FDB A;  3WWV A;  2R92 H;  3AFQ A;  4DR6 L;  5IP9 H;  5BR8 L;  4LF6 L;  4A3G G;  4YCU A;  4DV2 Q;  4A3K H;  2GVB A;  4Y7N H;  3STB D;  4DNI A;  3UDX A;  1KIX A;  3CCM A;  3H15 A;  3E0E A;  4L5R C;  1NTG A;  1GO3 E;  2N8N A;  2DGY A;  4BXX H;  4X6A H;  1IYJ B;  4DKA C;  3Q8D A;  3E9I A;  3PUZ A;  3J80 c;  4B3T Q;  3PO2 H;  5JJI A;  3BZK A;  2E5L L;  3CD6 A;  4R4Q A;  1AE3 A;  1HZA A;  4IPH A;  1OXS C;  3KDF A;  5AJ3 Q;  5LMN L;  1N32 Q;  1X3G A;  3HFZ B;  1YHQ A;  4C3J H;  2R92 G;  4JV5 L;  2R93 G;  1PH3 A;  1IZ6 A;  4IPC A;  3NBH B;  5IYC H;  1WJJ A;  4A3K G;  4DV5 L;  3F2B A;  5JJK A;  1XNQ L;  2UXC Q;  1YEZ A;  4BXX G;  1D8L A;  4JI5 L;  4X64 L;  1I94 Q;  1VQE A;  4JI7 L;  1VQ4 A;  1XNR L;  2R6G A;  4DR3 Q;  4GLA C;  3KJP A;  3PO2 G;  1EWI A;  3U4V A;  5M5W H;  2Q2U A;  1IBL Q;  1X6O A;  4DV7 Q;  2YTV A;  4GLX A;  3EN2 A;  4A3I H;  3KDF B;  5JJL A;  4YWM A;  2JEB I;  3F8T A;  2LXK A;  1QUQ A;  3KF8 B;  4AH6 A;  3HOW H;  1CKM A;  3K81 C;  4DR5 L;  2B63 H;  1OXU A;  4B3S Q;  2MO1 A;  2F4V Q;  3I2Z A;  3FHW A;  4IO9 A;  3NEN A;  3E9H A;  3UE1 A;  3RN5 A;  4O2D A;  1KC8 C;  5M5X H;  4B3M Q;  4POG A;  5M3F G;  1C7Y A;  4A76 A;  2KCT A;  4LNQ A;  2YU9 H;  2KCM A;  3M7N A;  4L5Q A;  1KXL A;  1PH7 A;  4X66 Q;  2CWP A;  3IRB A;  1PYB A;  1QUQ B;  2VS1 A;  3G71 A;  2UUB Q;  1PYS B;  1E1T A;  1KHI A;  2AHO B;  4OWX B;  1VQM A;  1JMC A;  4QGU A;  2B63 G;  2ZTD A;  3TRE A;  5JEA G;  4DUY L;  1XTD A;  4AQY Q;  4XTC S;  5DLQ E;  3VDY A;  2N49 A;  4LUV A;  1Y1W H;  1T9H A;  1PH4 A;  2JE6 I;  4DR2 Q;  4GN3 B;  3BU2 A;  3M4P A;  3U4Z A;  1V9P A;  3PCO B;  3TEH B;  1HNW L;  4YWK A;  1VQI A;  1ASZ A;  3CF5 A;  5LMU L;  4HJ8 A;  4LFB L;  4DR1 L;  3TS2 A;  2PQA A;  4LF5 Q;  3AFP A;  2K50 A;  4AYB E;  1IBK L;  5M3M H;  4JI8 L;  4BA1 I;  5C4J H;  2IX1 A;  2DUD A;  1LTL A;  2XTI A;  1IL2 A;  3S16 H;  1EUJ A;  2ZJR A;  3H3V H;  3ZJY C;  5GAG C;  3A5U A;  4X62 Q;  4BY1 H;  3K7U C;  1L1O C;  2D0P A;  4YY3 L;  2EXD A;  4A75 A;  4JBJ A;  1SMX A;  4JI0 Q;  4LF8 L;  3T1H Q;  2B29 A;  2Q2T A;  4BA2 I;  5IY0 A;  2PQA B;  3L7Z C;  1BBW A;  1FGU A;  2JA7 H;  2VUM G;  2ATW A;  4DV2 L;  4GOP C;  1B8A A;  4LFA Q;  1E7Z A;  2BA1 A;  3K7A H;  4TVA B;  5M3M G;  5GAH C;  3G6E A;  1HR0 Q;  2OTJ A;  4LF7 L;  4MTN A;  4APV A;  1Q12 A;  1SN8 A;  1LYL A;  2Y0S G;  1VQK A;  4GKJ L;  1EIF A;  1W2B A;  1KRT A;  3PUV A;  1UE6 A;  2L15 A;  1LM0 A;  3CQZ H;  3TQY A;  5C4X H;  1ASY A;  4B3T L;  1FJG Q;  1L1O A;  3GTK H;  1HH2 P;  4B3R Q;  4RG1 A;  3CC7 A;  4A3D H;  2PNH A;  1IXR A;  1VQJ A;  4GS3 A;  4LW1 A;  1VQB A;  4C2M H;  1K73 C;  3K80 C;  3ER0 A;  3CC4 A;  5IT9 c;  1VQ7 A;  1Q1E A;  4GN5 A;  4Y52 H;  2R7F A;  4LWC A;  4R4I A;  2JA5 H;  4P71 A;  3CCS A;  1N36 L;  2VQE Q;  4IFD I;  2Z6K A;  5C44 H;  3L2P A;  2I5H A;  2UXC L;  4A3F H;  2PI2 E;  4R4O A;  1I94 L;  3GTM H;  3L0O A;  3T1Y Q;  2PMZ E;  2B3G A;  4ME3 A;  4DR3 L;  4H02 A;  1VQ9 A;  1VQD A;  4HIK A;  1I50 H;  1L1O B;  4DUZ Q;  3S15 H;  1C0A A;  4DV7 L;  4HJ5 A;  4A3D G;  2R7Z G;  1VQP A;  3CME A;  1XPO A;  1PH8 A;  1VQ5 A;  1P8L A;  4JBW A;  1YIT A;  1NJI C;  1W3S A;  2NN6 G;  3F1Z A;  5ELN A;  1S72 A;  2JA5 G;  4JI6 Q;  4NXN Q;  1HNZ Q;  3K0X A;  5C44 G;  3ERS X;  5FLM G;  1YZ6 A;  2JK8 A;  3G48 A;  2CWA A;  4A3F G;  4B3M L;  1N33 Q;  1JJ2 A;  3CC2 A;  5IYB G;  3ULJ A;  3PIP A;  2WFW A;  2E2J H;  1Q1B A;  1WI5 A;  4A3E H;  2R93 H;  2GN5 A;  1Q86 C;  1PVO A;  4DV1 Q;  4TQU S;  4DV6 Q;  2WP8 J;  2K4K A;  4IOC A;  1FVI A;  1VQ6 A;  1BKB A;  4JI2 L;  4GLV B;  4MNO A;  2QGQ A;  4WJ3 M;  3LGJ A;  1X56 A;  4A3M G;  4DR4 Q;  1MKH A;  1OXV A;  4RMF A;  1X55 A;  1S40 A;  1OXX K;  2GVA A;  3CCE A;  1AE2 A;  1EOV A;  2HHH Q;  3MEF A;  4DR2 L;  1G29 1;  4IOA A;  4A3E G;  2E8G A;  2A1A A;  3I4O A;  2JA6 H;  5IWA Q;  1HNX L;  1KD1 C;  4UP8 A;  4P74 A;  4DPG A;  4LFC Q;  3F2C A;  1L0W A;  1VQH A;  2Q2I A;  4YWL A;  4K0K Q;  3W5O A;  3CMA A;  5M3F H;  2FXQ A;  4JBM A;  4BY7 G;  3DLL A;  2AWO A;  4AYB G;  1J5E Q;  2UUC L;  2ID0 A;  2UU9 Q;  4J15 A;  2K5N A;  5GAD C;  2N78 A;  4X62 L;  1VQO A;  4LF9 Q;  4PZ8 A;  5H1S E;  4JBK A;  4MZ9 A;  3H0G H;  1HZ9 A;  5JEA J;  2H5X A;  2JA6 G;  2ASB A;  2XGT A;  3T1H L;  2RCN A;  3KYH C;  1XMO L;  4KI0 A;  1NMF A;  3AEV A;  2AWN A;  1WCM G;  4PZ7 A;  3I4M H;  4KHP Q;  2IHE A;  1N34 Q;  2KEN A;  2R7D A;  4LFA L;  5IP7 G;  4O0A A;  3CCV A;  1HR0 L;  1MJE A;  4DV4 Q;  3JAM c;  2BH8 A;  4HJA A;  2YV5 A;  4OX9 L;  3CCJ A;  4X65 L;  1R9T H;  1GM5 A;  1FJG L;  4LF4 Q;  4DV3 Q;  1P16 A;  2BH2 A;  3H0G G;  3CP0 A;  5GQO A;  3UDF A;  4B3R L;  3J81 i;  3GO5 A;  4NPS A;  2Q2H A;  1TWA H;  1E22 A;  3I4M G;  3BZC A;  4GKK Q;  1LUZ A;  3RZO H;  2VNU D;  1KAW A;  3OTO Q;  3PV0 A;  3J7A 5;  4BBS H;  4P73 A;  3RLN A;  4DR7 Q;  4C3H H;  2RHQ B;  1HZC A;  1YBY A;  3D31 A;  3EBE A;  3PIO A;  1AH9 A;  1YJW A;  3S2H H;  4DUZ L;  4DR6 Q;  3FKI H;  5BR8 Q;  2VUM H;  4DAY B;  5FLX c;  3CPW A;  2ZM6 L;  3PUW A;  3HOU H;  1KL9 A;  1MIU A;  4YHH Q;  2YTX A;  1DGS A;  3UDG A;  4NXN L;  1VQG A;  3EIV A;  4R4C A;  4JI6 L;  1OTC A;  1HNZ L;  2UXB L;  2V1C C;  4BBS G;  1YVC A;  1N33 L;  3PF4 A;  2WAQ E;  1X65 A;  3J80 i;  2NVX H;  2CQO A;  4JV5 Q;  4JI3 Q;  3FKI G;  4DV1 L;  4UP9 A;  4PZ6 A;  2MNA A;  5C0X G;  2OQ0 A;  3GD7 A;  3HOU G;  4UP7 A;  3ULP A;  2EIF A;  1UE7 A;  3RNU A;  1BVS A;  4R4T A;  3M3Y H;  4DR4 L;  1TWG H;  4YCV A;  4JI5 Q;  4X64 Q;  1BBU A;  3H3V I;  1E3P A;  2KHJ A;  1Z47 A;  4IJH A;  3S14 H;  4JC0 A;  1HJP A;  1M1K C;  2HHH L;  1XPU A;  2R7Z H;  5AJ3 L;  4JOI C;  1N32 L;  4HJ7 A;  5HY6 A;  3OYY A;  1NMG A;  4KLK A;  2A8V A;  5IWA L;  5IYD H;  1Y1V H;  4DR5 Q;  4JI1 Q;  4GOP A;  4LFC L;  5IE8 A;  4GNX C;  1YJ9 A;  1VQC A;  3A5Z B;  2NVY H;  1PFS A;  2IT1 A;  5FLM H;  3RN2 A;  2JA8 H;  4DAM A;  4NXM Q;  4K0K L;  1Z9F A;  3MXN B;  4OON A;  2VW9 A;  4QQB X;  5IYB H;  2F3I A;  4UPA A;  1EIY B;  1VQ8 A;  1J5E L;  4LF9 L;  1IBL L;  2AMC B;  3NEL A;  1SFO H;  4C3I H;  3HOZ H;  4JI4 Q;  2LXJ A;  2Z0S A;  3OW2 A;  2JA9 A;  1HZB A;  4A3M H;  4OO1 G;  3I7F A;  5IYD G;  1VQF A;  1Y1V G;  4GOP B;  2BA0 A;  3I56 A;  4B3S L;  2F4V L;  1MJC A;  3SGI A;  2NN6 I;  3HOY H;  1JJG A;  1SR3 A;  2JA8 G;  4A3J H;  4LUZ A;  2CFM A;  4DV0 Q;  1PV4 A;  3KLW A;  1K8G A;  2OTL A;  4JYA Q;  4IJL A;  2OCE A;  4DV4 L;  1D7Q A;  3W1B A;  2HT1 A;  2PI2 A;  3HKZ E;  1PH5 A;  4JCV E;  2VL6 A;  4LF4 L;  1EQR A;  3I55 A;  4DV3 L;  4DR1 Q;  3HOZ G;  1TXY A;  4X66 L;  1PA6 A;  4R1J A;  2RHS B;  1UWV A;  2ALY B;  4DK6 C;  2ZTC A;  1PH9 A;  2UUB L;  3KFU A;  2UXD Q;  1IBK Q;  1N9W A;  1JJC B;  4JI8 Q;  2ES2 A;  1VQN A;  3GTL H;  2WB1 E;  3HOY G;  1GD7 A;  4LUO A;  4BY7 H;  1SE8 A;  1NE3 A;  4AQY L;  4A3C H;  4A3J G;  1NBW A;  1KRS A;  3PGZ A;  3OTO L;  3RZD H;  2RF4 A;  1J6Q A;  3PF5 A;  4A3B H;  3PO3 G;  4IPG A;  1EQQ A;  1I6H H;  1V1Q A;  3RR5 A;  3A0J A;  1QVF A;  2YTY A;  5C3E H;  1RL2 A;  2MO0 A;  3CPF A;  2YYZ A;  1WCM H;  1X3F A;  4OWT B;  5HGQ A;  4LF5 L;  1RIP A;  4POF A;  1A8V A;  1Q81 C;  5K36 G;  1YNX A;  1XMQ Q;  1PH6 A;  3GTG H;  2Y0S E;  4HIO A;  5IP7 H;  1JT8 A;  1QZH A;  4YHH L;  2JQO A;  2F52 A;  3KF6 A;  3CXC A;  4LF7 Q;  2NVT H;  1K83 H;  4HJ9 A;  1IBM Q;  4A3C G;  1X3E A;  4GKJ Q;  1Q8K A;  4WJ4 A;  1WFQ A;  2UUA Q;  3I4N H;  3D0F A;  4A3B G;  1U5K A;  4JI0 L;  1G51 A;  1K8A C;  5C3E G;  1B7Y B;  2WAQ G;  4JI3 L;  4IPD A;  5IP9 G;  1UEB A;  2N3S A;  2VQF Q;  4XIG S;  4AIM A;  1Q7Y C;  1Q82 C;  1KQS A;  2I0Q A;  4A4I A;  1EYG A;  1N36 Q;  4PG3 A;  3CCQ A;  3GTP H;  3KF6 B;  2E2H H;  2HIX A;  2E2I H;  4QL5 A;  1QVC A;  1E24 A;  2C35 B;  5FJ8 H;  5ELO A;  3I4N G;  3STB C;  3M4O H;  3TRZ A;  1K3R A;  1A63 A;  3M9B A;  3HOX H;  3F2D A;  4BBR H;  1K0R A;  3S2D H;  2CKZ B;  2KBN A;  3KJO A;  4A93 H;  3AYH B;  1CKO A;  3U50 C;  5IYC G;  4JI1 L;  2EQS A;  3W1G A;  3S1Q H;  1SLJ A;  2ZJQ A;  2VQE L;  2JJQ A;  3FP9 A;  3S17 H;  4HIM A;  1K9M C;  3M4Q A;  1N8R C;  4NXM L;  3PUX A;  3J81 j;  3T1Y L;  5C0X J;  5M5Y H;  5FJ8 G;  4QY7 A;  1A0I A;  2IHF A;  3KOJ A;  1CKN A;  1GKH A;  1VQA A;  5J3B A;  3HOX G;  3ULL A;  1JE5 A;  1X9N A;  4BBR G;  4LF6 Q;  4A3I G;  4JI4 L;  4JI2 Q;  4A93 G;  1L2F A;  3UDI A;  3GTQ H;  5EAY A;  3S1M H;  3HOW G;  4A3L H;  4L5T A;  1WYD A;  1UE1 A;  4QIW E;  3U58 A;  5GRO A;  1B70 B;  1OXT A;  5LMN W;  4DV0 L;  4PMW A;  1H95 A;  1GVP A;  2E5L Q;  1Q46 A;  4JYA L;  3CAM A;  5LMN Q;  1SRU A;  4QJF A;  3CCU A;  1C9O A;  4EX5 A;  2K52 A;  3CCL A;  1CKN B;  4JG2 A;  1WOC A;  2ZTE A;  4DV6 L;  2IY5 B;  1HNX Q;  5C0X I;  5E7N A;  4L5S A;  4DV5 Q;  2MFI A;  3HKZ G;  2JEA I;  2I5M X;  3S24 A;  1XNQ Q;  2UXD L;  2HIV A;  3CCR A;  1PHJ A;  4A3L G;  4JI7 Q;  1PH1 A;  3PUY A;  3G4S A;  1VQL A;  1XNR Q;  2AKW B;  4NB3 A;  2UUC Q;  4YCW A;  2WB1 G;  2I5L X;  1Y1W G;  1I3Q H;  3RLO A;  1JB7 A;  3RLF A;  3AQQ A;  2KHI A;  3BJU A;  3NEM A;  3S1N H;  3M85 A;  4ALP A;  1YHA A;  4IFD J;  1M90 C;  1XMO Q;  1YHB A;  3GDE A;  1TWH H;  3PSI A;  4EQ5 A;  1HR0 W;  1XMQ L;  1CUK A;  4KHZ A;  3JC6 6;  2ZJP A;  2K14 A;  3CW2 C;  2Z6K C;  3DM3 A;  2IX0 A;  1I5F A;  1TWF H;  1IBM L;  2UU9 L;  1VS0 A;  1UE5 A;  4OX9 Q;  4OWW B;  4X65 Q;  3TS0 A;  4BY1 G;  2UUA L;  1SRO A;  2MQH A;  4JOI A;  3JAM i;  1EFW A;  4UY8 C;  2CCZ A;  1YIJ A;  1O7I A;  1TWC H;  4DK3 C;  2LSS A;  4OO1 I;  1XJV A;  1QVG A;  1QZG A;  1YI2 A;  4OXP A;  4KHP L;  4GNX A;  2VQF L;  4DUY Q;  1N34 L;  2JA7 G;  3A74 A;  3GTJ H;  1CSP A;  4IFD G;  2K5V A;  2QEX A;  1A62 A;  1V43 A;  3S1R H;  4GN4 B;  3PO3 H;  1XPR A;  3ICE A;  2K5H A;  1G6P A;  3J81 c; 
#chains in the Genus database with same CATH topology
 1DON A;  3HOV H;  2OQK A;  2ENN A;  2LFN A;  4K2K A;  5HUR A;  1I4P A;  4FXK C;  1WTJ A;  2BOS A;  4HID A;  2L11 A;  4NV5 A;  1X54 A;  2F0D A;  2NZO A;  2D0O A;  2ZT9 C;  2UXB Q;  2Y0M A;  1Y14 B;  2D62 A;  3UI2 A;  2IPK D;  3K8A A;  4DR7 L;  4YY3 Q;  5M5W B;  3HOV G;  3HKS A;  4P75 A;  1HDL A;  2VY3 A;  2F0U A;  5BR8 L;  4GZY C;  4K6D A;  4KV6 A;  4DV2 Q;  1W4R A;  3NBH A;  1KIX A;  3HOW B;  4L5R C;  4DNI A;  4RH6 A;  2D5D A;  1JWM D;  2N8N A;  4X6A H;  1TUR A;  4DKA C;  2CVR A;  3DUZ A;  2OT2 A;  3E9I A;  3PUZ A;  2B2T C;  3TP7 A;  5HQ8 A;  2DJF C;  5JJI A;  2YU9 B;  1AE3 A;  1JCK B;  1HZA A;  5LMN L;  1T5E A;  1IKL A;  3JAM E;  2SGD I;  3KF8 A;  2LUY A;  3SVM A;  1IZ6 A;  3I3C A;  4IPC A;  4ABN A;  1WJJ A;  1GUS A;  2PO4 A;  1I4Q A;  5JJK A;  5KND A;  4WP4 A;  1TR5 A;  4JI5 L;  3IL8 A;  4JI7 L;  3FMC A;  2WB1 B;  1XNR L;  2R6G A;  5EKL A;  1EWI A;  1IBL Q;  1KBE A;  3KLS A;  4A3I H;  3D4R A;  4I65 A;  1BQQ T;  4PMC A;  4RKL A;  1CKM A;  4B3S Q;  1CT1 D;  3FHW A;  2K32 A;  1SGP I;  3NEN A;  1KC8 C;  4B3M Q;  1X4S A;  4POG A;  5M5X H;  2Y0S B;  3QR8 A;  2JSO A;  1IL8 A;  1C7Y A;  1AN1 I;  4A76 A;  2KEC A;  2KCT A;  2XMX A;  4TKO B;  1ZEQ X;  3NPP A;  1BXT A;  1LTG D;  2B2W C;  3D8G A;  3V05 A;  1KXL A;  1SGE I;  3IRB A;  2CH4 A;  1QUQ B;  3G71 A;  5I4D A;  1PYS B;  1VQM A;  1JMC A;  2ZTD A;  3TRE A;  5D14 A;  5DLQ E;  4PV1 C;  1U4R A;  4LUV A;  3VDY A;  2ICI A;  1PH4 A;  1STG A;  3CQZ B;  3U4Z A;  3GTK B;  3BVG A;  1MJA A;  3TEH B;  1FNV A;  1VQI A;  4CGY B;  5LMU L;  1TU2 B;  4HJ8 A;  2H1E A;  1SNM A;  2PZW A;  4C2M B;  4LF5 Q;  4G75 A;  3J7Y W;  2K50 A;  4AYB E;  1Z6H A;  2F0I A;  1STY A;  2JA5 B;  3QB3 A;  2DUD A;  1I4H A;  1IL2 A;  3QTL D;  4PL5 A;  4ZKC B;  3A5U A;  3IFD A;  2JB1 A;  4R8N A;  1I50 B;  3S15 B;  3VYR A;  2JW6 A;  2EYM A;  4FF4 A;  2B29 A;  1F2Z A;  4H13 C;  1JQO A;  3RU0 A;  2JA7 H;  2ATW A;  1B8A A;  4O1N A;  3G6E A;  2ENZ A;  4MTN A;  3EJI A;  4KMU C;  1Q12 A;  1SN8 A;  3VYU A;  2L9H A;  1HA6 A;  1VQK A;  1EY7 A;  5CCM A;  1FJG Q;  3TQY A;  2E2J B;  2ORV A;  3BYY B;  4A3D H;  4WFN 3;  3CD6 A;  1VQJ A;  1SMY C;  1VQB A;  5BN3 A;  5LNK 1;  3R5A A;  3C46 A;  3NQT A;  3BVM A;  1TS2 A;  1VMC A;  2KOL A;  1CHP D;  3CHB D;  1SYB A;  2UXC L;  4A3F H;  3GTM H;  4R8I A;  1M8A A;  4ME3 A;  2EY2 A;  4H02 A;  2RSO A;  4G57 A;  1VQ9 A;  2RDF A;  1L1O B;  2Z4I A;  2EXZ A;  1RKN A;  4HJ5 A;  4A3D G;  3CME A;  2WKC A;  4F87 A;  4JBW A;  1YIT A;  3HG9 A;  1NJI C;  2NN6 G;  2M5X A;  2B8F A;  4A3F G;  4FF3 A;  3BDL A;  1CM9 A;  1QJO A;  1ZYR C;  2K05 A;  2L5T A;  2EJF C;  2GN5 A;  3H0G B;  2WP8 J;  1FVI A;  1BKB A;  1RTO A;  4GLV B;  4MNO A;  3LGJ A;  4A3M G;  4IAL A;  1LLR D;  1OXX K;  2GVA A;  2K33 A;  2RDG A;  1FGB D;  1AE2 A;  5J1Z A;  1PRT F;  4O1O A;  3SXH A;  4L9M A;  7WGA A;  2JA6 H;  2L8E A;  4P74 A;  1YNJ D;  4LFC Q;  3F2C A;  1I4X A;  2QQE A;  2VXW A;  1L0Y B;  3I9V 1;  3MXP A;  4K0K Q;  3CMA A;  5M3F H;  1SBB B;  1EU4 A;  4AYB G;  3VR5 A;  3S9W A;  2F6M B;  5JAV A;  5GAD C;  4JBK A;  2B2U A;  2F0J A;  5JEA J;  1ULN A;  2JA6 G;  2XGT A;  1EL0 A;  3T1H L;  3FC3 A;  1XMO L;  4ZRZ A;  1NMF A;  3HOU B;  4PZ7 A;  4KHP Q;  1GXD C;  1VF5 C;  3G6J B;  1N34 Q;  2KEN A;  1RDP D;  1HR0 L;  1IHZ A;  2YV5 A;  4E6I A;  1R9T H;  3OXF A;  5EQ0 A;  4LF4 Q;  1P16 A;  2BH2 A;  5DNF A;  4A24 A;  1EIG A;  2NVX B;  4B3R L;  3UDF A;  3J81 i;  4NPS A;  4DAY A;  1IY6 A;  1AP0 A;  2Q2H A;  5IT9 L;  4NW2 A;  4O42 A;  5C5M A;  2VNU D;  1TWG B;  4RGN A;  3J7A 5;  3FDT A;  3S14 B;  3QWP A;  4C3H H;  3GQB A;  1AH9 A;  1WKX A;  3E0J A;  2JA1 A;  4G7O C;  4K5W A;  4YHH Q;  5A2Q L;  3F4M A;  5C44 B;  3EIV A;  1C4Q A;  2NYZ D;  1HNZ L;  2BCO A;  5CV8 A;  5KNC A;  2UXB L;  3PF4 A;  1BUS A;  1HQR D;  2BE5 D;  1ILQ A;  1SFO B;  3FVQ A;  4UP9 A;  1I4G A;  4PZ6 A;  2MNA A;  2E74 C;  2KA7 A;  3I4L A;  3CRK C;  1D5X C;  2Q8T A;  4DR4 L;  3MXN A;  2XN9 C;  3BJI A;  3H3V I;  3T51 B;  1E3P A;  2WIN B;  1UEA B;  3RD4 A;  3SGQ I;  2R7Z H;  3DA4 A;  3E3X A;  4CKE A;  2SGF I;  4OO1 H;  3J81 E;  1Y1V H;  4FVM A;  2ZXR A;  3A8J E;  2IY5 B;  4IUV A;  2NVY H;  4DAM A;  3G7L A;  3D00 A;  5CV5 A;  2F3I A;  4TRD A;  4UPA A;  1J5E L;  1IBL L;  1I6H B;  2Z4H A;  2IX3 A;  2LXJ A;  3M4Y A;  1HZB A;  4OO1 G;  4QMG A;  1Y1V G;  1NCV A;  4B3S L;  1JJG A;  1MJC A;  2EVB A;  1SR3 A;  1NUC A;  4A3J H;  4LUZ A;  1SE2 A;  1NR4 A;  1K83 B;  1K8G A;  2NZ1 D;  4L63 B;  1PFM A;  4DV4 L;  2OCE A;  1YTP A;  3I4N B;  5I2Y A;  1BNZ A;  2PI2 A;  3HKZ E;  3JAM L;  4MPI A;  1EQR A;  3I55 A;  1CZG A;  4R1J A;  1EOT A;  1UWV A;  2ZTC A;  2E75 C;  1IBK Q;  5EX0 A;  1M8C A;  3GTL H;  1MJ9 A;  3VA7 A;  3UGI A;  1NE3 A;  3GTP B;  4A3C H;  4A3J G;  4MIU A;  1NBW A;  3OTO L;  2RIO A;  2E2I B;  4A3B H;  1EQQ A;  3RR5 A;  1GUN A;  2MO0 A;  1X3F A;  4LF5 L;  1RIP A;  5K36 G;  1A8V A;  3NWT A;  1YNX A;  2G5D A;  4HIO A;  1JT8 A;  3TJQ A;  4LF7 Q;  5AFW A;  4HJ9 A;  4A3C G;  1D6E C;  1X3E A;  4B6D A;  1QNK A;  2DNC A;  4A3B G;  3D0F A;  5M5Y B;  1CSO I;  4H44 C;  1TBO A;  1SAP A;  4CJ2 C;  5HGI A;  1QOH A;  3F2U A;  3VR2 A;  4JI3 L;  1Q7Y C;  2N3S A;  3L3O C;  4A4I A;  1EYG A;  3CCQ A;  1HRJ A;  1EYC A;  2ROW A;  2WV6 D;  1EU3 A;  3M4O H;  3TRZ A;  4B08 A;  3S2D H;  1K7V A;  2KBN A;  3AYH B;  1CKO A;  2F0T A;  4C3J G;  1STH A;  5C6A A;  5I6Y A;  5IYC G;  3W1G A;  4HEA 1;  3S1Q H;  2ZJQ A;  2QDB A;  4RWS C;  4Q5V A;  3PUX A;  1SYG A;  2EE1 A;  3MEK A;  1I3Q B;  5COY A;  2V53 A;  4QY7 A;  2IHF A;  2EYL A;  4FYD A;  5J3B A;  3W3A A;  4KTA A;  1K8M A;  4JI4 L;  2VB3 X;  4HTH A;  2NU0 I;  1TWH B;  3Q22 A;  3DO9 A;  3S1M H;  1SMY D;  4RGO S;  3T16 A;  1U4P A;  2NU2 I;  1B70 B;  2GA4 B;  1Q46 A;  2F03 A;  3CAM A;  1L0X B;  1OO9 B;  2XRS D;  1TQO A;  5LMN Q;  3CCU A;  1AEX A;  2K52 A;  3K5M A;  4JG2 A;  5E7N A;  1EWH A;  2MFI A;  3HKZ G;  1PLF A;  2TMP A;  3GTJ B;  2L1L B;  4JI7 Q;  1PH1 A;  4IUR A;  4CDF C;  1XNR Q;  1SYC A;  2JB3 A;  3S1R B;  4C1N K;  3FBV A;  2AKW B;  2G9D A;  2L1B A;  4K8I A;  4NB3 A;  2OU2 A;  4YCW A;  2M9V A;  1JB7 A;  2MJ8 A;  3RLF A;  1GUO A;  5LHY 1;  3AQQ A;  3WOE A;  1IW4 A;  1ZYR D;  1P9Z A;  1SGQ I;  4OGQ C;  1M90 C;  5IOD A;  4HFV A;  1HR0 W;  3FEW X;  1HCZ A;  1I4R A;  2K14 A;  4HMJ A;  3DM3 A;  5F2D A;  1V8Q A;  1IBM L;  2QW7 A;  4BY1 G;  2UUA L;  2ENB A;  1EFW A;  4DK3 C;  4M8A A;  1QVG A;  1QZG A;  5E3P A;  1G2T A;  4OXP A;  4KHP L;  1N34 L;  4OEM B;  2Z1C A;  1MT1 A;  1F2Y A;  3OVO A;  3VDU A;  3PO3 H;  3BDC A;  2JP1 A;  3P23 A;  1EQV A;  4KN4 C;  4R9W A;  1DS2 I;  2X52 A;  5LMU Q;  2DJG C;  2GIV A;  5C4X G;  1KLU D;  4P72 A;  3J7Z C;  2Q8I B;  1PFB A;  3GTO H;  2OWO A;  1NSN S;  3TSS A;  1KDA A;  1IKM A;  5CMD A;  5ELC A;  4EQP A;  4G7H C;  2WVJ A;  4P2C B;  3UE0 A;  2NZH A;  3OL0 A;  3KBX A;  2A19 A;  9WGA A;  4A3I B;  1U0L A;  3WWV A;  3SDJ A;  3AFQ A;  5IP9 H;  3FVV A;  3VR3 A;  2NTT A;  3STB D;  4Y7N H;  2M2L A;  1NR2 A;  4OIK A;  2F3V A;  3E0E A;  1NTG A;  2RQX A;  3IKJ A;  1GO3 E;  3H15 A;  1P9G A;  1IYU A;  4BXX H;  3P20 A;  3H3V C;  2SGP I;  4X3T A;  1CA6 A;  1KLG D;  5M5X B;  3LJ0 A;  1AN8 A;  4DF7 A;  1EY0 A;  3BZK A;  2NU1 I;  2EYH A;  2B2U C;  3KDF A;  1TBQ R;  2JYO A;  1X32 A;  2D2C C;  5I2X A;  2R93 G;  4HSV A;  3NBH B;  4F88 A;  4FXD A;  2KMP A;  2LEO A;  5C3X A;  3H09 A;  1W6J A;  3R93 A;  5K5P A;  2UXC Q;  4PNY A;  5FUV A;  4BXX G;  1VQ4 A;  1B9N A;  1A3U A;  3TOB A;  1DD2 A;  2RSN A;  3KJP A;  2Q2U A;  1X6O A;  4GLX A;  1B9M A;  1BUV T;  1K28 A;  3EN2 A;  5JJL A;  3L0I A;  2LXK A;  3KF8 B;  3K81 C;  5JEA H;  4QUF A;  3RN5 A;  4O2D A;  3T56 B;  5CV4 A;  5I9O A;  2XWJ B;  4L5Q A;  1WTW A;  1PH7 A;  5D65 A;  1Y8F A;  2VS1 A;  3K59 A;  1UUC A;  2JA7 B;  1E1T A;  1KHI A;  2CH4 W;  4QGU A;  1JOK A;  5JEA G;  2A2D A;  1XTD A;  4Q0F A;  4XTC S;  2F0W A;  4KKS A;  2N49 A;  1Y1W H;  4M1U B;  2NBF A;  4MN3 A;  4YWK A;  3J81 L;  5COR A;  3CF5 A;  4A3D B;  4LFB L;  1DCZ A;  5TSS A;  4UDU C;  3URY A;  1IBK L;  4BA1 I;  1YNN C;  1LTL A;  1DS3 I;  5CYU A;  2F0P A;  4RAU C;  4A3F B;  3GTM B;  3C3L A;  2NU3 I;  2NTS A;  1L1O C;  1EFI D;  3NTH A;  2FMM A;  4JBJ A;  1SMX A;  4NMZ A;  5JJZ A;  2NUC A;  3T1H Q;  2Q2T A;  1BBW A;  2VUM G;  3AU7 A;  1LTI D;  2X6G A;  1PDQ A;  3K7A H;  4IQZ A;  1E2V A;  1LTR D;  1HR0 Q;  4LF7 L;  5HI7 A;  3QWN A;  3W2D A;  4L6T B;  1W2B A;  2PPB C;  1HJA I;  3PUV A;  2L15 A;  1LM0 A;  1S5D D;  4B3T L;  4HGU A;  4B3R Q;  1MGS A;  3BYT B;  1IXR A;  4HCE A;  3NE5 B;  1Q1E A;  2BL7 A;  4GN5 A;  4Y52 H;  4XDX A;  4R4I A;  4U67 3;  4P71 A;  3CCS A;  1TII D;  2VQE Q;  4DAV A;  5I6W A;  5FO7 B;  3DWA A;  3L0O A;  4RA8 A;  3P7J A;  3QIA A;  2ELI A;  1FNU A;  1NAP A;  1HFN A;  2LY7 A;  2XSC A;  4IUQ A;  2JA6 B;  3TN2 A;  2SGE I;  4U68 A;  5DM6 3;  1VQP A;  1XPO A;  1V1I A;  3VE5 A;  1KBF A;  1PH8 A;  4ZK9 B;  1P8L A;  4AML A;  1F9R A;  1EYD A;  1S72 A;  3K0Y A;  5M3F B;  1HNZ Q;  3D4W A;  1H9J A;  2P22 B;  2EOT A;  2JK8 A;  3E5S A;  1PTR A;  1CT0 I;  3C1E A;  5IYB G;  3ULJ A;  4RHS A;  2WFW A;  3PIP A;  3I8Z A;  4A3E H;  1LT5 D;  2K4K A;  4C3I G;  2J4X A;  2B63 B;  2QGQ A;  2IW3 A;  3UEY A;  4GI3 C;  4DR4 Q;  1X55 A;  2AQ1 B;  1OVO A;  1EOV A;  3IFT A;  4DR2 L;  1G29 1;  1R9T B;  4A3E G;  2E8G A;  1PYW D;  4F7X A;  2ZRR A;  1IY5 A;  3C2P A;  1CZW A;  4DPG A;  3TOA A;  1L0W A;  1NNX A;  5FLX L;  4UXI A;  4FF2 A;  2PW5 A;  2FXQ A;  1CHO I;  4N8F A;  5C4H A;  4BY7 G;  3DLL A;  2AWO A;  4OIJ A;  1AW7 A;  1J5E Q;  2UU9 Q;  4J15 A;  2K5N A;  1B3A A;  4PZ8 A;  5H1S E;  3FNB A;  4C3H B;  1EY8 A;  5JVH 3;  3PDN A;  4MZ9 A;  1CT4 I;  2H5X A;  2HUG A;  2ASB A;  4J8Q A;  1PCE A;  1WCM G;  1KNE A;  2KKM A;  5IP7 G;  3CCV A;  1QE6 A;  1Y8N B;  5C4Z A;  1SE4 A;  4DV4 Q;  2BH8 A;  2X69 A;  1G6Z A;  3SK4 A;  1CI3 M;  1CE3 A;  2PCF B;  1TWA H;  1K7T A;  1TBR R;  3BZC A;  4GKK Q;  3J7A F;  1LUZ A;  4U6R A;  5EPK A;  1SYD A;  2RVL A;  3OTO Q;  2SEB D;  3MXU A;  3PV0 A;  3RLN A;  3MAQ A;  1PRT C;  1Y8P B;  2IP6 A;  1RD9 D;  3MXG A;  3EBE A;  1YBY A;  1PFN A;  3PIO A;  2R7Z B;  2CWG A;  1YJW A;  4DUZ L;  4DR6 Q;  4HED A;  4DAY B;  5FLX c;  4RGT A;  1UUP A;  1Y1V B;  3PUW A;  1KL9 A;  4LMQ D;  1MD2 D;  4ZLT F;  1MIU A;  5E3Q A;  3NXW A;  1DGS A;  2NVY B;  4NXN L;  4R4C A;  1TKW B;  2RC4 A;  1ROD A;  1K7U A;  3IAM 1;  4JV5 Q;  4JI3 Q;  4DV1 L;  2XRC A;  5FKA C;  2K5W A;  3TO6 A;  1A6X A;  1UE7 A;  4E1P A;  1BVS A;  4R4T A;  3M3Y H;  4YCV A;  4A3J B;  4X64 Q;  1BBU A;  2Q8R E;  4IJH A;  2KHJ A;  4JC0 A;  2ZXP A;  2HHH L;  1XPU A;  1RTN A;  4B9X A;  5HGT A;  1EY6 A;  5IWA L;  5IYD H;  4DR5 Q;  2NN6 H;  3JSB A;  3X3M A;  2JA8 H;  1VQC A;  3GTL B;  2JN4 A;  1FR3 A;  1WGT A;  3MXN B;  4QQB X;  2VW9 A;  2JAE A;  1LV9 A;  3MC0 B;  1TS3 A;  3HOZ H;  3D4D A;  4JI4 Q;  3R5D A;  1S5B D;  2JA9 A;  2JXD A;  4A3M H;  4OEL B;  5IYD G;  1VQF A;  5KIX A;  2BA0 A;  3A8K E;  4DNC A;  2LMC B;  2NN6 I;  3SGI A;  1ULK A;  2JA8 G;  3SK6 A;  1WTX A;  4IJL A;  2HT1 A;  2F1M A;  1A15 A;  1ESR A;  3K5N A;  2VL6 A;  4XQQ A;  3HOZ G;  2ALY B;  1ICF B;  4QB4 A;  2WB1 E;  5EJW A;  1GD7 A;  3KBG A;  1SE8 A;  1LO5 D;  3N52 A;  1BCP C;  1JB3 A;  2RF4 A;  3D3R A;  3SR1 A;  4CHT B;  4UXH A;  1HPT A;  3M4O B;  2B8G A;  5D3D A;  2CHB D;  2F0V A;  3U9O A;  1QVF A;  2QQC A;  5C3E H;  3OOC A;  4QCL A;  5HGQ A;  4UHV A;  2UVO A;  3E59 A;  3KLR A;  2WAC A;  2Y0S E;  3PQI A;  3S1Q B;  1QB5 D;  4JVZ A;  2WCY A;  2SGQ I;  1IBM Q;  4CKC A;  1FAQ A;  1F9P A;  1JWS D;  3TP8 A;  2UUA Q;  3K5O A;  1U5K A;  4KD4 A;  4NV2 A;  5T1I A;  2JYY A;  5C3E G;  3TO9 A;  3ITP A;  1B7Y B;  3HS0 C;  2J87 A;  2IL8 A;  2QIL A;  3S1M B;  2I0Q A;  3AJF A;  2IJ0 A;  5FUY A;  1G2S A;  1II3 A;  5E1F A;  2HIX A;  3R3O A;  1QVC A;  4QL5 A;  1YNN D;  2C35 B;  3STB C;  1K3R A;  3M9B A;  2MJF B;  3F2D A;  3C1F A;  2CWF A;  3DWQ A;  4C1N I;  1HHV A;  5JHW C;  1SJ8 A;  2BUS A;  4XQN A;  2DN8 A;  4DN4 M;  2EQS A;  2F0O A;  5J8F A;  3MFG A;  2VQE L;  2FIN B;  1N8R C;  2AUK A;  5C0X J;  3B55 A;  2L4N A;  3KOJ A;  1CKN A;  1EYA A;  2F0N A;  1JE5 A;  3ULL A;  4DXF A;  3N6R A;  1X9N A;  1STN A;  4JI2 Q;  1AFP A;  2A73 B;  1SYE A;  1L2F A;  1ILP A;  2SOB A;  3LJ2 A;  3HOW G;  5A35 A;  3VA5 A;  1UE1 A;  3O13 A;  4QIW E;  1STE A;  5LMN W;  3K58 A;  2QF7 A;  3KUP A;  2G9H D;  1SRU A;  4QJF A;  3VYT A;  1C9O A;  1F9S A;  2ZTE A;  5DM7 3;  4X3U A;  5CGK A;  2KQ3 A;  4KN7 C;  2EY1 A;  2HIV A;  3FSX A;  1SGD I;  3GP7 A;  1BCP F;  4OHJ A;  3PO3 B;  1WGC A;  3NUC A;  1PRT B;  2WB1 G;  1PZJ D;  3RLO A;  3PIP 3;  3ERQ A;  3Q23 A;  2KHI A;  3NP8 A;  3GTO B;  3BDO A;  1YU6 C;  5DAE A;  4IFD H;  3P1H A;  3ND9 A;  3CW2 C;  4CDC C;  4IUP A;  2IX0 A;  1O7Z A;  1TWF H;  2UU9 L;  1VS0 A;  2B2V A;  1B1Z A;  2CAZ B;  1SRO A;  4JOI A;  4J6H A;  2WAQ B;  1YIJ A;  1TWC H;  2LSS A;  4FKD A;  2F0E A;  1XJV A;  4OO1 I;  4HSP A;  4I7A A;  4GNX A;  1O80 A;  1S5E D;  3FSY A;  1JIC A;  4K8J A;  2K5V A;  4IFD G;  1V43 A;  1WTV A;  2F0L A;  2B2Y A;  1G6P A;  4AS3 A;  1M8B A;  2LKV A;  2A6H C;  4LFB Q;  1HQM C;  1E2Z A;  1WTR A;  5K36 H;  1Q8I A;  3OW7 A;  4A3G H;  4WOR A;  4ZCK A;  3TDQ A;  4CJ0 B;  2VZA A;  4GKK L;  3A8I E;  2KVM A;  1PH2 A;  2K75 A;  5GAE C;  2KHS A;  3QO2 A;  5FUW A;  3UGD A;  4DR6 L;  4HN7 A;  4A3G G;  4YZD A;  4DK1 A;  2DIP A;  2GVB A;  3UDX A;  3CCM A;  4K14 A;  2LB7 A;  1PTO H;  1GHJ A;  2XTQ A;  3SEB A;  1IYJ B;  3Q8D A;  3J80 c;  4B3T Q;  3PO2 H;  1HA5 A;  2E5L L;  3U9S A;  3AMU A;  4IPH A;  2PW7 A;  1OXS C;  5AJ3 Q;  1N32 Q;  1X3G A;  3MVV A;  1PRT D;  1YHQ A;  4C3J H;  4JV5 L;  1PH3 A;  3UIT A;  5IYC H;  4DA2 A;  1SGR I;  4DV5 L;  1PTQ A;  1UNS A;  5KGU A;  2SDF A;  5KNB A;  1YEZ A;  5ISR A;  2R3Z A;  4OAV B;  1D8L A;  4X64 L;  2B0U C;  2PQ8 A;  1RCV D;  2XIW A;  1BCP B;  1Y1W B;  4GLA C;  3PO2 G;  3U4V A;  2YTV A;  3H6M A;  3UOE A;  3KDF B;  1TGS I;  2EY6 A;  2JEB I;  3F8T A;  2HQE A;  1MSG A;  4MTK A;  2EY5 A;  4KKU A;  1SJH D;  4DR5 L;  1Y1B A;  1OXU A;  4RKB A;  3I2Z A;  4ZAI A;  2B39 A;  1BMO A;  5FLX E;  3E9H A;  4PL3 A;  3HZX A;  2EJG C;  4LNQ A;  1JE4 A;  1RFH A;  2KCM A;  2BDO A;  3HP3 A;  3M7N A;  1KDB A;  3SDZ A;  1KTK A;  2E76 C;  2D9U A;  2UUB Q;  4H0L C;  3DEP A;  3K7A B;  2K9H A;  4DUY L;  1FAR A;  3R2T A;  1WTH A;  4DR2 Q;  5L37 A;  3I91 A;  2F3C I;  1HNW L;  3CU7 A;  2WKD A;  4KY6 A;  1DOK A;  3X3N A;  1TDP A;  2F0F A;  2PQA A;  2KCX A;  2OZU A;  5M3M H;  4FNF A;  1VF7 A;  1TS5 A;  5C4J H;  2IX1 A;  3K5L A;  3S16 H;  1EUJ A;  2ZJR A;  2A20 A;  3ZJY C;  5GAG C;  4BY1 H;  3HOV B;  3K7U C;  1A3V A;  4TSS A;  4A75 A;  4LF8 L;  3DHQ A;  4YIJ A;  5IGF A;  5IY0 A;  3KLS X;  2KUM A;  3L7Z C;  1OMT A;  4KD3 A;  4EGV A;  4KHV A;  3PMF A;  2BA1 A;  4TVA B;  5M3M G;  5GAH C;  2Z9H A;  1PMR A;  3LWU A;  2OTJ A;  1Q9B A;  1EIF A;  2MHV A;  2A68 D;  4JW0 A;  2I07 B;  5C4X H;  1HEV A;  2EYO A;  1SSO A;  1HH2 P;  2BL8 A;  1BCP D;  3CC7 A;  5IGC A;  2PNH A;  2DNE A;  4GS3 A;  1CGJ I;  1B44 D;  3CC4 A;  1SXT A;  3ER0 A;  4KJO A;  3MEH A;  5ELB A;  3OWF A;  1XX6 A;  2R7F A;  4LWC A;  2FU2 A;  3ERO A;  2N1A B;  5CCL A;  3V96 A;  3HH2 C;  2Z6K A;  5C44 H;  2I5H A;  5KEE A;  4R4O A;  1I94 L;  2RLD A;  2PMZ E;  2B3G A;  3NTK A;  4DR3 L;  1VQD A;  2O4X A;  1MI2 A;  4DUZ Q;  1C0A A;  4DV7 L;  1EY9 A;  4B9W A;  2L12 A;  1LT3 D;  1ULM A;  5IIF A;  3BG3 A;  3WOF A;  1W3S A;  3F1Z A;  4NXN Q;  2EYJ A;  4HCS A;  3K0X A;  5C44 G;  3ERS X;  5FLM G;  3G48 A;  2CWA A;  1TIH A;  1JJ2 A;  3CC2 A;  1K8O A;  2WGC A;  4GXT A;  1WI5 A;  2R93 H;  2CQA A;  4DV1 Q;  4TQU S;  2MUY A;  4IOC A;  1VQ6 A;  4JI2 L;  5NUC A;  1U4L A;  3DMU A;  1X56 A;  5LL6 S;  1MKH A;  1KAB A;  1OXV A;  3CCE A;  2HHH Q;  3I70 A;  1DXM A;  5G3L F;  1IYV A;  1O78 A;  5IWA Q;  4OAU C;  4QF4 A;  1SND A;  1TWA B;  1LTA D;  3HRZ C;  1B53 A;  1TY2 A;  5EGT A;  4JBM A;  2P6A C;  2ID0 A;  2N78 A;  4X62 L;  1VQO A;  1R4Q B;  2NU4 I;  3KYH C;  1V1P A;  4XXE A;  1GJX A;  3AEV A;  3I4M H;  2AWN A;  4LFA L;  4JK1 C;  4O0A A;  3IAS 1;  4N9T A;  3CCJ A;  1EEF D;  1F9Q A;  1GM5 A;  4KK7 A;  5ELD A;  5GQO A;  3GO5 A;  3ZYY X;  3LNN A;  4C56 C;  1R79 A;  3Q0A A;  3I4M G;  2FFK B;  2ARP F;  4OL7 A;  1JC7 A;  1KAW A;  3BZD B;  3M3Y B;  1HTP A;  1STB A;  4XQJ A;  4BBS H;  4P73 A;  1WD1 A;  2L7X A;  1TOT A;  2A6E C;  1Y69 U;  2R61 A;  4QUC A;  3S2H H;  3FKI H;  2VUM H;  1F2L A;  5C0X H;  3CPW A;  1Q90 A;  1B50 A;  2JB2 A;  2QKI C;  1JR0 D;  2RCF A;  1PJU A;  2JA8 B;  1VMP A;  1R4P B;  4CDE C;  2EDG A;  1VQG A;  4JI6 L;  2QQD A;  2YFA A;  1J9O A;  1LAC A;  1OTC A;  1G8Z D;  4BBS G;  1YVC A;  2OEO A;  1N33 L;  1J8I A;  3J80 i;  3HOZ B;  2CQO A;  3FKI G;  5C0X G;  1X3Q A;  2A6H D;  2F0K A;  1F2M A;  4A3M B;  4Z7H A;  1ICW A;  3GD7 A;  4UP7 A;  3ULP A;  4I1T A;  2A69 C;  1PTO C;  1BR9 A;  1I6V C;  1Z47 A;  2DB6 A;  5ELF A;  2B2V C;  1M1K C;  4IUU A;  2X3T A;  3E2I A;  3OXL A;  4O1P A;  3VA9 A;  4I7Z C;  5IOC A;  4JOI C;  5AJ3 L;  1N32 L;  4HJ7 A;  5HY6 A;  3OYY A;  1NMG A;  4KLK A;  2PQE A;  4GOP A;  2A74 C;  5IE8 A;  4GNX C;  3A5Z B;  3DA3 A;  1PFS A;  1WTP A;  3RN2 A;  1TS4 A;  2K1B A;  2K7V A;  4AYB B;  1Z9F A;  3LWE A;  2GSC A;  4OON A;  5IYB H;  3K57 A;  4LF9 L;  5IGD A;  4C3I H;  1QNU A;  2PNR C;  5C3E B;  2Z0S A;  3OW2 A;  4L8J A;  2F0G A;  3HOY H;  1XWE A;  1PV4 A;  2CFM A;  3OXG A;  3R5C A;  3KLW A;  4ZKB B;  1OYV I;  2ERW A;  1S5C D;  1T5X D;  3A7L A;  2F3W A;  1TY0 A;  1D7Q A;  2LS0 1;  2IWH A;  3W1B A;  1PH5 A;  4CBV A;  4JCV E;  1B4O A;  2K28 A;  3MTS A;  2KEE A;  2J0T D;  4DV3 L;  4DR1 Q;  1H9S A;  1TXY A;  3J80 E;  1PA6 A;  2VB2 X;  2RHS B;  4S3S A;  3KFU A;  1PH9 A;  2UUB L;  4KJN A;  1N9W A;  1JJC B;  4JI8 Q;  4MHE A;  3HOY G;  4DFA A;  4BY7 H;  3DWP A;  2E5R A;  3RZD H;  1J6Q A;  3I72 A;  1C48 A;  3DEO A;  3H91 A;  2EYF A;  1V1Q A;  2OXP A;  4IN3 A;  4RGM A;  3CXL A;  3A0J A;  1CTM A;  2O5I C;  2YTY A;  2N17 A;  1RL2 A;  3I90 A;  4N9P A;  3CPF A;  4OWT B;  2YYZ A;  1WCM H;  1M4V A;  5IGG A;  2F0S A;  3GTG H;  1UVF A;  5IP7 H;  2F52 A;  2JQO A;  3KF6 A;  3CXC A;  2NVT H;  3BS1 A;  1GUG A;  4GKJ Q;  2QCP X;  5IGE A;  1K8A C;  3WDN A;  3OIQ A;  1LTT D;  1X74 A;  3D6W A;  5G3L D;  1UEB A;  4RFB A;  1Q82 C;  1PTO F;  1N36 Q;  3GV6 A;  2E2H H;  4RHR A;  3EFX D;  5ELO A;  1A63 A;  3HOX H;  4DGZ A;  4BBR H;  1K0R A;  4EVO A;  1D5M C;  3KJO A;  1WVL A;  4A93 H;  4JI1 L;  1SLJ A;  1D1I A;  3FP9 A;  3S17 H;  1K9M C;  3M4Q A;  4RCN A;  1H9K A;  4NXM L;  3J81 j;  2HDL A;  5CBA E;  1W6K A;  1A0I A;  1VQA A;  3HOX G;  4BBR G;  4A3I G;  3KK7 A;  1UHA A;  3TZU A;  2WII B;  5IGB A;  4A93 G;  3GTQ H;  4L5T A;  2NB0 A;  1WYD A;  3T13 A;  1H9R A;  2L55 A;  3U58 A;  5GRO A;  5FUX A;  4DV0 L;  1GVP A;  1TWF B;  2NWG A;  4HR7 B;  2E5L Q;  2PZU A;  4JYA L;  4YZC A;  4FXG C;  4EQO A;  4DWL A;  1JOR A;  1CKN B;  3LX0 A;  2KCN A;  4XYQ A;  1WOC A;  2JXM B;  2CJS C;  2RIJ A;  1TWC B;  1HNX Q;  1CT2 I;  1GHK A;  2DKV A;  4L5S A;  2HGK A;  3CRL C;  4DV5 Q;  3S24 A;  2UXD L;  1VDZ A;  2BDN A;  3CCR A;  1PHJ A;  4FF1 A;  1JOO A;  3G4S A;  1XX8 A;  4X3K A;  1XBT A;  2UUC Q;  2V1C A;  1KMA A;  1PPF I;  5EPJ A;  2RKS A;  2O5J C;  2SNM A;  2XWB B;  1SNQ A;  4NDX A;  3BJU A;  3VDP A;  5EBD A;  3S1N H;  4A3G B;  3M85 A;  3TME A;  1YHA A;  5BN5 A;  1NUB A;  3GDE A;  4EQ5 A;  1XMQ L;  4KHZ A;  3SHL A;  3EQL C;  2K19 A;  2Z6K C;  1ONL A;  2AQ2 B;  1I5F A;  4A3B B;  3QOL A;  1SGY I;  1UE5 A;  4OX9 Q;  1HPC A;  4OWW B;  1KAA A;  1MBY A;  1FNW A;  4LK1 C;  4QIW B;  4X65 Q;  4UY8 C;  3H94 A;  2AQ3 B;  1SNO A;  1O7I A;  4X3S A;  4XT1 B;  4YZ9 A;  3R8B A;  2Z6B A;  4IZ8 A;  1U4M A;  2N71 A;  2VQF L;  2P5Z X;  4DUY Q;  2JA7 G;  3UFF A;  3MZ5 A;  1PTO B;  2QEJ C;  2EZV A;  4GN4 B;  2K5D A;  3ICE A;  3PO2 B;  1HNW Q;  1JQY D;  1NY4 A;  3VR6 A;  2KMQ A;  1VCI A;  1SYF A;  2QA4 A;  2XTR A;  4C3J B;  2O2L D;  2Z8L A;  1HXY D;  1YJN A;  1WD0 A;  1HUN A;  2ORW A;  2GVI A;  2ZM6 Q;  1FL0 A;  3B6Y A;  2FEF A;  4GNX B;  2A68 C;  4BS9 A;  1OMU A;  3NHH A;  3TBI B;  1CK1 A;  2HQL A;  5FOB B;  2OF1 A;  1S3O A;  1CSQ A;  1E1O A;  1E2W A;  1IW7 C;  2RA4 A;  1AZQ A;  4LF8 Q;  3NBI A;  4CKB A;  2ZXO A;  4V19 0;  1LT6 D;  2NVQ H;  3S2D B;  4FDB A;  2R92 H;  1ZKO A;  5FO9 B;  3NQI A;  4LF6 L;  4YCU A;  4A3K H;  3RZO H;  1TVX A;  3M7G A;  3SE0 A;  1RHP A;  2FNF X;  3UEJ A;  2DGY A;  5CC4 A;  4DAP A;  3TP6 A;  1A3T A;  2MPM A;  1LR8 A;  4R4Q A;  4F8M A;  3NK9 A;  3HFZ B;  2ZW3 A;  2A6E D;  2R92 G;  3HKZ B;  1LTB D;  1V1H A;  1S5F D;  1QWY A;  3OSO A;  4DXG A;  4A3K G;  4XYO A;  3F2B A;  1XNQ L;  5EPL A;  1I94 Q;  3EA6 A;  1VQE A;  1ENC A;  5M9O A;  2XVS A;  4DR3 Q;  2GKR I;  5M5W H;  2JBW A;  4DV7 Q;  4KKT A;  1ENF A;  4YWM A;  2AUJ D;  1QUQ A;  3NTI A;  4AH6 A;  2F0H A;  3HOW H;  2B63 H;  2C9O A;  5KRU A;  2F4V Q;  2MO1 A;  5M3M B;  1EY4 A;  5C4J B;  4IO9 A;  3UE1 A;  3S16 B;  4K5V A;  3D6C A;  2A69 D;  5M3F G;  1MHW C;  4BY1 B;  1F77 A;  1PTO D;  2YU9 H;  4PL4 A;  1YO7 A;  1X3P A;  3IAY A;  1XA6 A;  4X66 Q;  2CWP A;  3K6O A;  1PYB A;  1HUM A;  1EZ8 A;  2E73 A;  4OWX B;  2AHO B;  2B63 G;  5J8C A;  3ND8 A;  1Y8O B;  4AQY Q;  3MWY W;  1SGN I;  1EWC A;  2GKV A;  3QAH A;  4UAI A;  1T9H A;  2JE6 I;  4DNT B;  4GN3 B;  4IUT A;  3BU2 A;  3M4P A;  1V9P A;  4H7B A;  5C4X B;  3PCO B;  1ASZ A;  4Q9V A;  1JOQ A;  4DR1 L;  1FYC A;  3OWE B;  3TS2 A;  5CV6 A;  3AFP A;  3L9A X;  1LR7 A;  4IUN A;  4JI8 L;  3VR4 A;  1SDF A;  3A54 A;  2XTI A;  1EIH A;  2HDM A;  3H3V H;  3RUZ A;  1Z7T A;  4X62 Q;  2D0P A;  4UXJ A;  4YY3 L;  2EXD A;  1FYB A;  4JI0 Q;  3OMC A;  1EEI D;  4ULL A;  4C3H G;  1FY7 A;  4HAE A;  4BA2 I;  2PQA B;  4K2L A;  1FGU A;  4DV2 L;  4GOP C;  1H9M A;  4LFA Q;  1E7Z A;  5LL6 X;  1ZXT A;  4APV A;  3R5B A;  1LYL A;  2Y0S G;  4GKJ L;  2QDL A;  1KRT A;  1UE6 A;  3CQZ H;  1RF2 D;  4ME5 A;  1ASY A;  3J80 L;  3GTK H;  1L1O A;  1HTL D;  4RG1 A;  2R93 B;  4LW1 A;  1K73 C;  4C2M H;  3K80 C;  4Y7N B;  5IT9 c;  1VQ7 A;  2A2C A;  2JA5 H;  4K6L A;  1N36 L;  4IFD I;  3L2P A;  1K0S A;  4JPB W;  2PI2 E;  1B2T A;  2ETD A;  3T1Y Q;  3A56 A;  1D2B A;  4HIK A;  1I50 H;  3S15 H;  2R7Z G;  4WJW A;  3T4A C;  3TP5 A;  1QG7 A;  1VQ5 A;  2JA5 G;  2MGS A;  4N8X 1;  5ELN A;  4JI6 Q;  1TUS A;  2RBM A;  1YZ6 A;  2K6A A;  4B3M L;  1N33 Q;  4CDD C;  2E2J H;  1EY5 A;  5E3F A;  1Q1B A;  2FHT A;  1Q86 C;  4FO2 A;  4DV6 Q;  1PVO A;  3SGB I;  2PYK A;  4WJ3 M;  3I4M B;  3VYS A;  4RMF A;  4OVO A;  1S40 A;  2F0M A;  4J1M A;  2CW0 C;  5J39 A;  1SJE D;  3MEF A;  5EKI A;  2C5C A;  2PZT A;  1ET9 A;  2K04 A;  3PIO 3;  4E1R A;  1D1K A;  3I4O A;  2A1A A;  1DJR D;  5CR3 A;  2PMZ B;  4UP8 A;  5CBE E;  2K03 A;  1KD1 C;  1HNX L;  2KCC A;  3FRP B;  1AZP A;  2F4I A;  1VQH A;  2Q2I A;  4YWL A;  3W5O A;  3OPO A;  4ZQ3 A;  2UUC L;  2B2T A;  4IOA A;  4ODG A;  4LF9 Q;  4BBS B;  2N52 A;  4AS2 A;  1SE3 A;  3H0G H;  3ONA B;  1HZ9 A;  3DM1 A;  3S2H B;  3FKI B;  1B3Q A;  1CQV A;  2VUM B;  2RCN A;  2EJM A;  4KI0 A;  1BBX C;  2MP1 A;  1NXU A;  2IHE A;  3MHB A;  2R7D A;  2FUG 1;  3A7A B;  1G91 A;  1UAP A;  3V2T A;  5C3W A;  4FP5 D;  1MJE A;  1N13 A;  3JAM c;  2E2D C;  2QGM A;  4HJA A;  4OX9 L;  1XYI A;  4X65 L;  1FJG L;  4DV3 Q;  1C8C A;  3H0G G;  3CP0 A;  3DXJ C;  3Q24 A;  2HCI A;  1V1P B;  3LJ1 A;  1E22 A;  2FMC A;  2TSS A;  2K01 A;  3FPP A;  4HMI A;  2KMO A;  4K5X A;  1PZI D;  1CQF A;  4DR7 Q;  3NSW A;  2RHQ B;  2B2W A;  1HZC A;  3D31 A;  1Z7K B;  3SK8 A;  1GUW A;  1GOZ A;  5BR8 Q;  1Y1C A;  4Z9C B;  1BOS A;  4G4K A;  2ZM6 L;  3HOU H;  4ZUI A;  2YTX A;  4SGB I;  3UDG A;  5C5L A;  1ESF A;  5T1G A;  3MFY A;  2V1C C;  5JVG 3;  2L0C A;  1LR9 A;  2B8T A;  2WAQ E;  1X65 A;  2YFB A;  1HFG A;  3EVQ A;  1BDO A;  4C3I B;  2NVX H;  2OQ0 A;  3HOU G;  2EIF A;  3RNU A;  3HOY B;  1TWG H;  4JI5 Q;  3B4V C;  3QOJ A;  3S14 H;  1LAB A;  3OIP A;  1HJP A;  2DY8 A;  2VRW B;  4A3E B;  1XXG A;  2J9R A;  1IW7 D;  1CGI I;  1PZK D;  5I9P A;  5KYI A;  5JOB A;  2A8V A;  1TT2 A;  1U9R A;  4JI1 Q;  5E3R A;  4ILW A;  4LFC L;  1MSH A;  3AB9 A;  1YJ9 A;  2IT1 A;  3BVZ A;  5FLM H;  4BY7 B;  4KY5 A;  4NXM Q;  4K0K L;  2KED A;  4NKL A;  3RZD B;  3QJY A;  1EIY B;  1VQ8 A;  4LAA A;  1E0B A;  4PQX A;  1SEB D;  2AMC B;  3NEL A;  1SFO H;  2UZ3 A;  5DAU A;  3KP9 A;  2QZG A;  3A55 A;  1DYQ A;  1DOM A;  4EQN A;  1WCM B;  3I7F A;  4BWG B;  4GOP B;  3I56 A;  3CKI B;  2F4V L;  3GTG B;  4DU9 A;  3QG1 A;  2HCC A;  2NVT B;  4DV0 Q;  3E6Z X;  1EZ6 A;  1TBN A;  2RDH A;  2OTL A;  4JYA Q;  2JZM A;  2YQP A;  4LF4 L;  1VDD A;  4X66 L;  4DK6 C;  5BN4 A;  2UXD Q;  2KMR A;  2ES2 A;  1VQN A;  1A2T A;  2FJ2 A;  4LUO A;  2DY7 A;  4AQY L;  1BF4 A;  2EYP A;  4DNR B;  1O7L A;  1KRS A;  3PGZ A;  3Q6S A;  1GUT A;  2E2H B;  1RJT A;  4G7Z C;  3PF5 A;  2V6E A;  3GV3 A;  3PO3 G;  4IPG A;  1I6H H;  4KY7 A;  2CWH A;  3R2I A;  1Z2I A;  3HOX B;  4BBR B;  1H9S B;  2A5H A;  1ET6 A;  3SK5 A;  4POF A;  1Q81 C;  4XT3 B;  4A93 B;  1PH6 A;  1XMQ Q;  2XNA C;  1KDC A;  1QZH A;  4YHH L;  1BO0 A;  2HD3 A;  3S17 B;  1K83 H;  1MJB A;  2QQ0 A;  1Q8K A;  4WJ4 A;  1WFQ A;  1XTC D;  2XRQ D;  3NWS A;  4V0B A;  3I4N H;  1A2U A;  4JI0 L;  1G51 A;  1R0R I;  5EBC A;  1JWU D;  1DZ1 A;  2WAQ G;  2V4D A;  2QSB A;  4IPD A;  1S4Z A;  5IP9 G;  4XIG S;  4AIM A;  2H4O A;  2VQF Q;  2J7Z A;  1KQS A;  1CA5 A;  3GTQ B;  4PG3 A;  5DEH A;  4RCO A;  3KF6 B;  3GTP H;  3T53 B;  2QPO A;  3MA2 B;  2E2I H;  1E24 A;  3SEK C;  1PXU A;  5EKK A;  5FJ8 H;  3I4N G;  5EX3 A;  2N55 A;  3GOX A;  3FPU B;  1S20 A;  1LTS D;  2CKZ B;  2YUU A;  3HGB A;  1H0Z A;  3UGL A;  3U50 C;  2EPB A;  3I73 A;  4ZYS A;  3TZD A;  2JJQ A;  4HIM A;  1Q3L A;  1LT4 D;  5JPN C;  4PMB A;  3T1Y L;  1CHQ D;  5M5Y H;  1K3B C;  2X6L A;  3P75 A;  5FJ8 G;  1CFM A;  4WRD A;  4CJ1 B;  1YNJ C;  2M00 A;  1GKH A;  4LF6 Q;  5FO8 B;  1V1O A;  3S1N B;  2F0Q A;  3UDI A;  1UVG A;  2ODD A;  2RAD A;  5EAY A;  4A3L H;  5ELE A;  2N88 A;  1WTQ A;  1DOL A;  4Z7G A;  2GKT I;  1OXT A;  4PMW A;  1H95 A;  3HEJ A;  4LJZ C;  5D3I B;  4ID6 A;  4EX5 A;  1DM0 B;  3CCL A;  2W0T A;  3J7A V;  4DV6 L;  1STA A;  1ENA A;  3RMH A;  2SNS A;  5C0X I;  4DK0 A;  2OVO A;  2JEA I;  2I5M X;  1XNQ Q;  2F66 B;  4A3L G;  3PUY A;  1VQL A;  5IT9 E;  4NP5 A;  1KNA A;  1EQT A;  2I5L X;  1I3Q H;  5CV7 A;  5E4X A;  1Y1W G;  2OD1 A;  3OHX C;  5JPM C;  3NEM A;  4ALP A;  4IFD J;  1XMO Q;  1YHB A;  3PSI A;  1TWH H;  3KY9 A;  1WTO A;  5E4W C;  1CUK A;  2KJX A;  3JC6 6;  2ZJP A;  1SNC A;  1SNP A;  4G76 A;  1O7Y A;  2B2Y C;  5A2Q E;  4ZUJ A;  5J22 A;  2ICE C;  3TS0 A;  1QIL A;  2CW0 D;  2MQH A;  1FD7 D;  5CV9 A;  3JAM i;  2NVQ B;  2CCZ A;  2R92 B;  2I46 A;  1D5Z C;  5KYL A;  1YI2 A;  4A3K B;  3RZO B;  3TO7 A;  3OMG A;  2K5Q A;  1ML0 D;  3A74 A;  3GTJ H;  1QCB D;  1CSP A;  2QEX A;  1A62 A;  3S1R H;  2BE5 C;  1XPR A;  2K5H A;  5FK9 C;  3J81 c; 
#chains in the Genus database with same CATH homology
 3HOV H;  2OQK A;  2ENN A;  4HID A;  4NV5 A;  1X54 A;  2NZO A;  2D0O A;  2UXB Q;  1Y14 B;  2D62 A;  3K8A A;  4DR7 L;  4YY3 Q;  3HOV G;  3HKS A;  4P75 A;  1HDL A;  2VY3 A;  5BR8 L;  4DV2 Q;  1W4R A;  1KIX A;  4L5R C;  4DNI A;  2N8N A;  4X6A H;  1TUR A;  4DKA C;  5HQ8 A;  3E9I A;  3PUZ A;  5JJI A;  1AE3 A;  1HZA A;  5LMN L;  2SGD I;  2LUY A;  1IZ6 A;  4IPC A;  1WJJ A;  5JJK A;  4JI5 L;  4JI7 L;  1XNR L;  2R6G A;  1EWI A;  1IBL Q;  1KBE A;  4A3I H;  1CKM A;  4B3S Q;  3FHW A;  1SGP I;  3NEN A;  1KC8 C;  4B3M Q;  1X4S A;  4POG A;  5M5X H;  1C7Y A;  1AN1 I;  4A76 A;  2KCT A;  2XMX A;  1KXL A;  1SGE I;  3IRB A;  1QUQ B;  3G71 A;  1PYS B;  1VQM A;  1JMC A;  2ZTD A;  3TRE A;  5DLQ E;  3VDY A;  4LUV A;  1PH4 A;  3U4Z A;  3TEH B;  1VQI A;  5LMU L;  4HJ8 A;  4LF5 Q;  4G75 A;  2K50 A;  4AYB E;  2DUD A;  1IL2 A;  3QTL D;  4PL5 A;  3A5U A;  2JB1 A;  2JW6 A;  2B29 A;  3RU0 A;  2JA7 H;  2ATW A;  1B8A A;  3G6E A;  2ENZ A;  4MTN A;  1Q12 A;  1SN8 A;  1VQK A;  5CCM A;  1FJG Q;  3TQY A;  2ORV A;  4A3D H;  3CD6 A;  1VQJ A;  1VQB A;  5LNK 1;  2UXC L;  4A3F H;  3GTM H;  4ME3 A;  1VQ9 A;  4H02 A;  1L1O B;  4HJ5 A;  4A3D G;  3CME A;  4JBW A;  1YIT A;  1NJI C;  2NN6 G;  2M5X A;  4A3F G;  2GN5 A;  2WP8 J;  1FVI A;  1BKB A;  4GLV B;  4MNO A;  3LGJ A;  4A3M G;  1OXX K;  2GVA A;  1AE2 A;  4O1O A;  4L9M A;  2JA6 H;  2L8E A;  4P74 A;  4LFC Q;  3F2C A;  2QQE A;  3I9V 1;  4K0K Q;  3CMA A;  5M3F H;  4AYB G;  2F6M B;  5GAD C;  4JBK A;  5JEA J;  2JA6 G;  2XGT A;  3T1H L;  3FC3 A;  1XMO L;  1NMF A;  4PZ7 A;  4KHP Q;  1N34 Q;  2KEN A;  1HR0 L;  2YV5 A;  1R9T H;  3OXF A;  4LF4 Q;  1P16 A;  2BH2 A;  4A24 A;  4B3R L;  3UDF A;  3J81 i;  4NPS A;  1IY6 A;  2Q2H A;  2VNU D;  3J7A 5;  3QWP A;  4C3H H;  1AH9 A;  2JA1 A;  4YHH Q;  3F4M A;  3EIV A;  1HNZ L;  2UXB L;  3PF4 A;  1BUS A;  4UP9 A;  4PZ6 A;  2MNA A;  4DR4 L;  3BJI A;  3H3V I;  1E3P A;  3SGQ I;  2R7Z H;  3DA4 A;  2SGF I;  1Y1V H;  2IY5 B;  2NVY H;  4DAM A;  3D00 A;  2F3I A;  4UPA A;  1J5E L;  1IBL L;  2LXJ A;  1HZB A;  4OO1 G;  1Y1V G;  4B3S L;  1JJG A;  1MJC A;  1SR3 A;  4A3J H;  4LUZ A;  1K8G A;  4DV4 L;  2OCE A;  1YTP A;  2PI2 A;  3HKZ E;  1EQR A;  3I55 A;  4R1J A;  1UWV A;  2ZTC A;  1IBK Q;  5EX0 A;  1M8C A;  3GTL H;  3UGI A;  1NE3 A;  4A3C H;  4A3J G;  1NBW A;  3OTO L;  2RIO A;  4A3B H;  1EQQ A;  3RR5 A;  2MO0 A;  1X3F A;  4LF5 L;  1RIP A;  5K36 G;  1A8V A;  1YNX A;  4HIO A;  1JT8 A;  3TJQ A;  4LF7 Q;  4HJ9 A;  4A3C G;  1X3E A;  4B6D A;  4A3B G;  3D0F A;  1CSO I;  1TBO A;  5HGI A;  4JI3 L;  1Q7Y C;  2N3S A;  4A4I A;  1EYG A;  3CCQ A;  2ROW A;  3M4O H;  3TRZ A;  3S2D H;  2KBN A;  3AYH B;  1CKO A;  5IYC G;  3W1G A;  4HEA 1;  3S1Q H;  2ZJQ A;  3PUX A;  3MEK A;  2V53 A;  4QY7 A;  2IHF A;  5J3B A;  4JI4 L;  2NU0 I;  3DO9 A;  3S1M H;  2NU2 I;  1B70 B;  1Q46 A;  3CAM A;  5LMN Q;  3CCU A;  2K52 A;  4JG2 A;  5E7N A;  2MFI A;  3HKZ G;  2L1L B;  4JI7 Q;  1PH1 A;  1XNR Q;  2JB3 A;  3FBV A;  2AKW B;  4NB3 A;  4YCW A;  1JB7 A;  3RLF A;  3AQQ A;  1IW4 A;  1SGQ I;  1M90 C;  4HFV A;  1HR0 W;  2K14 A;  3DM3 A;  1IBM L;  4BY1 G;  2UUA L;  1EFW A;  4DK3 C;  1QVG A;  1QZG A;  4OXP A;  4KHP L;  1N34 L;  1MT1 A;  3OVO A;  3VDU A;  3PO3 H;  3P23 A;  1DS2 I;  5LMU Q;  5C4X G;  4P72 A;  3J7Z C;  3GTO H;  2OWO A;  2WVJ A;  3UE0 A;  2NZH A;  3OL0 A;  2A19 A;  1U0L A;  3WWV A;  3SDJ A;  3AFQ A;  5IP9 H;  4Y7N H;  3STB D;  3H15 A;  3E0E A;  1NTG A;  1GO3 E;  4BXX H;  2SGP I;  3LJ0 A;  3BZK A;  2NU1 I;  3KDF A;  1TBQ R;  2R93 G;  3NBH B;  2KMP A;  2LEO A;  2UXC Q;  5FUV A;  4BXX G;  1VQ4 A;  3KJP A;  2Q2U A;  1X6O A;  4GLX A;  3EN2 A;  5JJL A;  3L0I A;  2LXK A;  3KF8 B;  3K81 C;  3RN5 A;  4O2D A;  4L5Q A;  1PH7 A;  1Y8F A;  2VS1 A;  1UUC A;  1E1T A;  1KHI A;  4QGU A;  5JEA G;  2A2D A;  1XTD A;  4XTC S;  2N49 A;  1Y1W H;  4YWK A;  3CF5 A;  4LFB L;  1IBK L;  4BA1 I;  1LTL A;  1DS3 I;  2NU3 I;  1L1O C;  4JBJ A;  1SMX A;  3T1H Q;  2Q2T A;  1BBW A;  2VUM G;  3K7A H;  1HR0 Q;  4LF7 L;  5HI7 A;  1W2B A;  1HJA I;  3PUV A;  2L15 A;  1LM0 A;  4B3T L;  4HGU A;  4B3R Q;  1IXR A;  1Q1E A;  4GN5 A;  4Y52 H;  4R4I A;  4P71 A;  3CCS A;  2VQE Q;  3L0O A;  2ELI A;  2SGE I;  1VQP A;  3VE5 A;  1XPO A;  1V1I A;  1KBF A;  1PH8 A;  1P8L A;  1S72 A;  1HNZ Q;  2P22 B;  1PTR A;  2JK8 A;  1CT0 I;  5IYB G;  3ULJ A;  3PIP A;  2WFW A;  4A3E H;  2K4K A;  2QGQ A;  3UEY A;  4GI3 C;  4DR4 Q;  1X55 A;  1OVO A;  1EOV A;  4DR2 L;  1G29 1;  4A3E G;  2E8G A;  1IY5 A;  2ZRR A;  4DPG A;  1L0W A;  4UXI A;  2FXQ A;  1CHO I;  4BY7 G;  3DLL A;  2AWO A;  1J5E Q;  2UU9 Q;  4J15 A;  2K5N A;  4PZ8 A;  5H1S E;  3PDN A;  4MZ9 A;  1CT4 I;  2H5X A;  2ASB A;  1PCE A;  1WCM G;  2KKM A;  5IP7 G;  3CCV A;  4DV4 Q;  2BH8 A;  1CE3 A;  1TWA H;  1TBR R;  3BZC A;  4GKK Q;  1LUZ A;  4U6R A;  3OTO Q;  3PV0 A;  3RLN A;  2IP6 A;  3EBE A;  1YBY A;  3PIO A;  1YJW A;  4DUZ L;  4DR6 Q;  4DAY B;  5FLX c;  3PUW A;  1KL9 A;  1MIU A;  1DGS A;  4NXN L;  4R4C A;  3IAM 1;  4JV5 Q;  4JI3 Q;  4DV1 L;  2XRC A;  1UE7 A;  4E1P A;  1BVS A;  4R4T A;  3M3Y H;  4YCV A;  4X64 Q;  1BBU A;  4IJH A;  2KHJ A;  4JC0 A;  2HHH L;  1XPU A;  5IWA L;  5IYD H;  4DR5 Q;  3JSB A;  2JA8 H;  1VQC A;  3MXN B;  4QQB X;  2VW9 A;  2JAE A;  3HOZ H;  4JI4 Q;  2JA9 A;  2JXD A;  4A3M H;  5IYD G;  1VQF A;  2BA0 A;  3SGI A;  2NN6 I;  2JA8 G;  4IJL A;  2HT1 A;  2VL6 A;  3HOZ G;  2ALY B;  2WB1 E;  1GD7 A;  1SE8 A;  2RF4 A;  4UXH A;  1HPT A;  1QVF A;  2QQC A;  5C3E H;  5HGQ A;  3E59 A;  2Y0S E;  2WCY A;  2SGQ I;  1IBM Q;  1FAQ A;  2UUA Q;  1U5K A;  4NV2 A;  2JYY A;  5C3E G;  1B7Y B;  2J87 A;  2I0Q A;  3AJF A;  5FUY A;  2HIX A;  4QL5 A;  1QVC A;  2C35 B;  3STB C;  1K3R A;  3M9B A;  2MJF B;  3F2D A;  5JHW C;  1SJ8 A;  2BUS A;  2EQS A;  2VQE L;  1N8R C;  5C0X J;  3KOJ A;  1CKN A;  3ULL A;  1JE5 A;  1X9N A;  4JI2 Q;  1L2F A;  3LJ2 A;  3HOW G;  1UE1 A;  4QIW E;  5LMN W;  1SRU A;  4QJF A;  1C9O A;  2ZTE A;  2HIV A;  1SGD I;  2WB1 G;  3RLO A;  2KHI A;  1YU6 C;  5DAE A;  3CW2 C;  2IX0 A;  1TWF H;  2UU9 L;  1VS0 A;  2CAZ B;  1SRO A;  4JOI A;  1YIJ A;  1TWC H;  2LSS A;  4FKD A;  4OO1 I;  1XJV A;  4GNX A;  4IFD G;  2K5V A;  1V43 A;  1G6P A;  4AS3 A;  1M8B A;  4LFB Q;  4A3G H;  2VZA A;  4GKK L;  1PH2 A;  2K75 A;  5GAE C;  5FUW A;  3UGD A;  4DR6 L;  4A3G G;  4YZD A;  2DIP A;  2GVB A;  3UDX A;  3CCM A;  2XTQ A;  1IYJ B;  3Q8D A;  3J80 c;  4B3T Q;  3PO2 H;  2E5L L;  4IPH A;  1OXS C;  5AJ3 Q;  1N32 Q;  1X3G A;  1YHQ A;  4C3J H;  4JV5 L;  1PH3 A;  3UIT A;  5IYC H;  1SGR I;  4DV5 L;  1PTQ A;  1YEZ A;  4OAV B;  1D8L A;  4X64 L;  2B0U C;  4GLA C;  3PO2 G;  3U4V A;  2YTV A;  3KDF B;  1TGS I;  2JEB I;  3F8T A;  4DR5 L;  1Y1B A;  1OXU A;  3I2Z A;  1BMO A;  3E9H A;  4PL3 A;  4LNQ A;  1RFH A;  2KCM A;  3M7N A;  2UUB Q;  2K9H A;  4DUY L;  1FAR A;  4DR2 Q;  2F3C I;  1HNW L;  2PQA A;  2KCX A;  5M3M H;  5C4J H;  2IX1 A;  3S16 H;  1EUJ A;  2ZJR A;  2A20 A;  3ZJY C;  5GAG C;  4BY1 H;  3K7U C;  4A75 A;  4LF8 L;  5IY0 A;  3L7Z C;  1OMT A;  2BA1 A;  4TVA B;  5M3M G;  5GAH C;  2OTJ A;  1EIF A;  5C4X H;  1HH2 P;  3CC7 A;  2PNH A;  4GS3 A;  1CGJ I;  3CC4 A;  3ER0 A;  1XX6 A;  2R7F A;  4LWC A;  5CCL A;  2N1A B;  3HH2 C;  2Z6K A;  5C44 H;  2I5H A;  4R4O A;  1I94 L;  2PMZ E;  2B3G A;  4DR3 L;  1VQD A;  4DUZ Q;  1C0A A;  4DV7 L;  1W3S A;  3F1Z A;  4NXN Q;  3K0X A;  5C44 G;  3ERS X;  5FLM G;  3G48 A;  2CWA A;  1TIH A;  1JJ2 A;  3CC2 A;  4GXT A;  1WI5 A;  2R93 H;  4DV1 Q;  4TQU S;  4IOC A;  1VQ6 A;  4JI2 L;  1X56 A;  1MKH A;  1OXV A;  3CCE A;  2HHH Q;  5IWA Q;  4OAU C;  4JBM A;  2P6A C;  2ID0 A;  2N78 A;  4X62 L;  1VQO A;  2NU4 I;  3KYH C;  3AEV A;  3I4M H;  2AWN A;  4LFA L;  4O0A A;  3IAS 1;  3CCJ A;  1GM5 A;  5GQO A;  3GO5 A;  1R79 A;  3I4M G;  2ARP F;  1KAW A;  4BBS H;  4P73 A;  2L7X A;  1TOT A;  3S2H H;  3FKI H;  2VUM H;  3CPW A;  2JB2 A;  1PJU A;  1VQG A;  4JI6 L;  2QQD A;  2YFA A;  1OTC A;  4BBS G;  1YVC A;  1N33 L;  3J80 i;  2CQO A;  3FKI G;  5C0X G;  4Z7H A;  3GD7 A;  4UP7 A;  3ULP A;  4I1T A;  1Z47 A;  2DB6 A;  1M1K C;  3E2I A;  3OXL A;  4O1P A;  3VA9 A;  5AJ3 L;  4JOI C;  1N32 L;  4HJ7 A;  5HY6 A;  3OYY A;  1NMG A;  4KLK A;  4GOP A;  5IE8 A;  4GNX C;  3A5Z B;  3DA3 A;  1PFS A;  3RN2 A;  1Z9F A;  4OON A;  5IYB H;  4LF9 L;  4C3I H;  2Z0S A;  3OW2 A;  3HOY H;  1PV4 A;  2CFM A;  3OXG A;  3KLW A;  1OYV I;  2ERW A;  1D7Q A;  3W1B A;  1PH5 A;  4JCV E;  4DV3 L;  4DR1 Q;  1TXY A;  1PA6 A;  2RHS B;  3KFU A;  1PH9 A;  2UUB L;  1N9W A;  1JJC B;  4JI8 Q;  3HOY G;  4BY7 H;  2E5R A;  3RZD H;  1J6Q A;  1V1Q A;  3CXL A;  3A0J A;  2YTY A;  2N17 A;  1RL2 A;  3CPF A;  4OWT B;  2YYZ A;  1WCM H;  3GTG H;  1UVF A;  5IP7 H;  2JQO A;  2F52 A;  3KF6 A;  3CXC A;  2NVT H;  4GKJ Q;  1K8A C;  1X74 A;  1UEB A;  1Q82 C;  1N36 Q;  2E2H H;  5ELO A;  1A63 A;  3HOX H;  4BBR H;  1K0R A;  3KJO A;  4A93 H;  4JI1 L;  1SLJ A;  3FP9 A;  3S17 H;  1K9M C;  3M4Q A;  4NXM L;  3J81 j;  1A0I A;  1VQA A;  3HOX G;  4BBR G;  4A3I G;  4A93 G;  3GTQ H;  4L5T A;  1WYD A;  5FUX A;  3U58 A;  5GRO A;  4DV0 L;  1GVP A;  2E5L Q;  4JYA L;  4YZC A;  4DWL A;  1CKN B;  1WOC A;  2CJS C;  1HNX Q;  1CT2 I;  4L5S A;  4DV5 Q;  3S24 A;  2UXD L;  3CCR A;  1PHJ A;  3G4S A;  1XBT A;  2UUC Q;  2V1C A;  1KMA A;  1PPF I;  3BJU A;  3VDP A;  3S1N H;  3M85 A;  1YHA A;  1NUB A;  3GDE A;  4EQ5 A;  1XMQ L;  4KHZ A;  2K19 A;  2Z6K C;  1I5F A;  1SGY I;  1UE5 A;  4OX9 Q;  4OWW B;  4X65 Q;  4UY8 C;  1O7I A;  4YZ9 A;  2N71 A;  2VQF L;  4DUY Q;  2JA7 G;  3UFF A;  4GN4 B;  3ICE A;  1HNW Q;  1NY4 A;  2KMQ A;  1VCI A;  2QA4 A;  2ORW A;  2XTR A;  1YJN A;  2GVI A;  2ZM6 Q;  1FL0 A;  3B6Y A;  4GNX B;  1OMU A;  2HQL A;  1S3O A;  1CSQ A;  1E1O A;  4LF8 Q;  2NVQ H;  4FDB A;  2R92 H;  4LF6 L;  4YCU A;  4A3K H;  3RZO H;  2FNF X;  3UEJ A;  2DGY A;  1LR8 A;  4R4Q A;  3HFZ B;  2R92 G;  1V1H A;  4A3K G;  3F2B A;  1XNQ L;  1I94 Q;  1VQE A;  4DR3 Q;  2GKR I;  5M5W H;  4DV7 Q;  4YWM A;  1QUQ A;  4AH6 A;  3HOW H;  2B63 H;  2F4V Q;  2MO1 A;  4IO9 A;  3UE1 A;  5M3F G;  2YU9 H;  4PL4 A;  1YO7 A;  1XA6 A;  4X66 Q;  2CWP A;  1PYB A;  2E73 A;  4OWX B;  2AHO B;  2B63 G;  4AQY Q;  1SGN I;  2GKV A;  1T9H A;  2JE6 I;  4GN3 B;  3BU2 A;  3M4P A;  1V9P A;  3PCO B;  1ASZ A;  4Q9V A;  4DR1 L;  3TS2 A;  3AFP A;  1LR7 A;  4JI8 L;  2XTI A;  3H3V H;  4X62 Q;  2D0P A;  4UXJ A;  4YY3 L;  2EXD A;  1FYB A;  4JI0 Q;  4BA2 I;  2PQA B;  1FGU A;  4DV2 L;  4GOP C;  4LFA Q;  1E7Z A;  4APV A;  1LYL A;  2Y0S G;  4GKJ L;  1KRT A;  1UE6 A;  3CQZ H;  1ASY A;  3GTK H;  1L1O A;  4RG1 A;  4LW1 A;  1K73 C;  4C2M H;  3K80 C;  5IT9 c;  1VQ7 A;  2A2C A;  2JA5 H;  1N36 L;  4IFD I;  3L2P A;  2PI2 E;  3T1Y Q;  4HIK A;  1I50 H;  3S15 H;  2R7Z G;  1VQ5 A;  2JA5 G;  4JI6 Q;  5ELN A;  1TUS A;  1YZ6 A;  4B3M L;  1N33 Q;  2E2J H;  1Q1B A;  1Q86 C;  1PVO A;  4DV6 Q;  3SGB I;  4WJ3 M;  4RMF A;  4OVO A;  1S40 A;  3MEF A;  4E1R A;  3I4O A;  2A1A A;  1HNX L;  1KD1 C;  4UP8 A;  1VQH A;  2Q2I A;  4YWL A;  3W5O A;  4IOA A;  2UUC L;  2N52 A;  4LF9 Q;  4AS2 A;  3H0G H;  1HZ9 A;  2RCN A;  4KI0 A;  2IHE A;  2R7D A;  2FUG 1;  1MJE A;  1N13 A;  3JAM c;  4HJA A;  4OX9 L;  4X65 L;  1FJG L;  4DV3 Q;  3H0G G;  3CP0 A;  3LJ1 A;  1E22 A;  2KMO A;  4DR7 Q;  2RHQ B;  1HZC A;  3D31 A;  1Z7K B;  5BR8 Q;  1Y1C A;  2ZM6 L;  3HOU H;  2YTX A;  4SGB I;  3UDG A;  2V1C C;  1LR9 A;  2B8T A;  2WAQ E;  1X65 A;  2YFB A;  2NVX H;  2OQ0 A;  3HOU G;  2EIF A;  3RNU A;  1TWG H;  4JI5 Q;  3B4V C;  3S14 H;  2VRW B;  1HJP A;  2J9R A;  1CGI I;  2A8V A;  4JI1 Q;  4LFC L;  1YJ9 A;  2IT1 A;  5FLM H;  4NXM Q;  4K0K L;  1EIY B;  1VQ8 A;  2AMC B;  3NEL A;  1SFO H;  2UZ3 A;  3KP9 A;  3I7F A;  4GOP B;  3I56 A;  2F4V L;  4DV0 Q;  1TBN A;  2OTL A;  4JYA Q;  2JZM A;  2YQP A;  4LF4 L;  1VDD A;  4X66 L;  4DK6 C;  2UXD Q;  2KMR A;  2ES2 A;  1VQN A;  4LUO A;  4AQY L;  1KRS A;  3PGZ A;  3PF5 A;  2V6E A;  3PO3 G;  4IPG A;  1I6H H;  4POF A;  1Q81 C;  1PH6 A;  1XMQ Q;  1QZH A;  4YHH L;  2QQ0 A;  1K83 H;  1Q8K A;  4WJ4 A;  1WFQ A;  3I4N H;  4JI0 L;  1G51 A;  1R0R I;  2WAQ G;  4IPD A;  5IP9 G;  1KQS A;  2VQF Q;  4XIG S;  4AIM A;  4PG3 A;  3GTP H;  3KF6 B;  2QPO A;  2E2I H;  1E24 A;  3SEK C;  5FJ8 H;  3I4N G;  5EX3 A;  3GOX A;  2CKZ B;  2YUU A;  1H0Z A;  3UGL A;  3U50 C;  2JJQ A;  4HIM A;  3T1Y L;  5M5Y H;  5FJ8 G;  1GKH A;  4LF6 Q;  3UDI A;  1UVG A;  2ODD A;  5EAY A;  4A3L H;  4Z7G A;  2GKT I;  1OXT A;  4PMW A;  1H95 A;  2W0T A;  4EX5 A;  3CCL A;  4DV6 L;  5C0X I;  2OVO A;  2JEA I;  2I5M X;  1XNQ Q;  2F66 B;  4A3L G;  3PUY A;  1VQL A;  2I5L X;  1Y1W G;  1I3Q H;  2OD1 A;  3NEM A;  4ALP A;  4IFD J;  1XMO Q;  1YHB A;  3PSI A;  1TWH H;  3KY9 A;  1CUK A;  3JC6 6;  2ZJP A;  4G76 A;  3TS0 A;  2MQH A;  3JAM i;  2CCZ A;  1YI2 A;  3A74 A;  3GTJ H;  1CSP A;  2QEX A;  1A62 A;  3S1R H;  1XPR A;  2K5H A;  3J81 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...