1W3SA

The crystal structure of reco from deinococcus radiodurans.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
236
structure length
230
Chain Sequence
b'RSRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN DR0819
publication title Crystal Structure and DNA-Binding Analysis of Reco from Deinococcus Radiodurans
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna repair
total genus 53
structure length 230
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 1w3sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1w3sA01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 1w3sA03
4LFCQ 1WFQA 4JC0A 2ATWA 2RHQB 2FXQA 2YYZA 2V1CC 1QVCA 3L7ZC 2VQEL 1U0LA 3I56A 1Q81C 2IX1A 4K0KL 4AQYL 4HJAA 1JJGA 1FGUA 2R7DA 1YJ9A 1E1OA 1PYBA 3PO3H 2MQHA 1YZ6A 4LF6L 2IHFA 3S1QH 5IWAL 1QUQB 2DGYA 3UDFA 2VQFL 1JJCB 4DV6L 1PHJA 3KYHC 3GTKH 3GD7A 5C4XH 1PH8A 2B63H 3H15A 4GNXC 3MXNB 2Z0SA 2L15A 2ZJQA 4GNXB 3AFQA 5GAHC 1N36Q 3HKZG 4LF7Q 1Q1BA 2K52A 2JA5H 2K4KA 2QGQA 2JA7G 3JAMi 1V1QA 1VCIA 1CKMA 4DR5L 4JI7L 1Q12A 1GKHA 4Y7NH 1HJPA 4IJLA 2UXDL 1KAWA 3ZJYC 4JCVE 2JEAI 4LUZA 2R92H 4LUVA 3HOVG 2EXDA 1ASZA 2BA1A 1KRTA 1YJNA 2GVAA 5M3FG 1K0RA 1WJJA 4A3GG 3GTMH 1VQLA 4KHPQ 4OO1I 3HOUG 1TWAH 4BXXG 1PV4A 4DR7L 4XIGS 4GKKQ 1KL9A 4QIWE 1HZCA 1RIPA 4LF9L 2NVQH 3RLFA 4X66L 4JI1Q 2I0QA 3CPFA 4OO1G 2OTJA 5IE8A 2HHHQ 5AJ3L 2R93G 1WCMH 3A5UA 4DV4Q 3W5OA 1P8LA 4YWMA 1BKBA 2ID0A 1N34L 1VQEA 4DR2Q 3M3YH 4LFBQ 2Q2TA 1XMQQ 1KXLA 4JI6L 3J7ZC 1CKNB 1IBMQ 2K5VA 4RMFA 1VQCA 1YNXA 1Y1VH 1PYSB 1XJVA 4DR4Q 2N78A 4POGA 3TRZA 2D62A 2OQKA 3CMEA 1R9TH 3CXCA 4HJ8A 2VL6A 1H95A 2BH8A 3F1ZA 2UUAQ 2A1AA 2D0PA 1GD7A 1I5FA 3F8TA 1VQAA 3L0OA 4OX9Q 3S1MH 4MTNA 4DAMA 5M5XH 1I6HH 4O2DA 1Z47A 1P16A 2HIVA 3CW2C 4YCUA 5IP7G 1VQPA 1N32L 4GS3A 4OWXB 1JB7A 4X6AH 4JI0Q 4P72A 3I4NG 4IPGA 4EX5A 2JA9A 5C4JH 4JG2A 1TWHH 2UUBL 3Q8DA 4P75A 3PO3G 5IY0A 4GN4B 3J81c 1Q7YC 4JI8Q 3UDIA 1IBKL 4BY7H 5C4XG 3KDFA 1E7ZA 1S3OA 2B63G 2WB1E 4BY1G 2N49A 2JA5G 5BR8Q 1HNWL 3W1GA 1PH5A 1K9MC 1I94L 2EQSA 2LSSA 5LMNQ 4GN5A 3JC66 5GQOA 4R4CA 4QGUA 3S1NH 4WJ4A 4MZ9A 1CSPA 4DV0Q 2R92G 2K75A 3EN2A 3NEMA 5E7NA 4LFAL 4JI3L 1UE6A 4HIMA 3L2PA 1W2BA 1IYJB 1UE7A 1VQ8A 4HIDA 2UU9Q 5M3FH 1X3GA 2IHEA 4WJ3M 2KCTA 2I5LX 3UE0A 2NVTH 4A3MH 3JAMc 4JI2Q 3H3VI 1NTGA 2PMZE 5IP9G 2R7ZH 4DAYB 3S15H 3UE1A 1XNRL 1Y1WH 2CCZA 5C44H 4A76A 2WFWA 1J5EL 1KIXA 3NBHB 2JE6I 1VQFA 3U4ZA 4YHHQ 3CQZH 4P74A 3HKZE 1M90C 1ASYA 5JJLA 4YCWA 2HIXA 4DV5Q 1VQKA 3PUVA 5M5YH 4DV7Q 2R93H 1WCMG 4C3HH 4A3JH 4LF5L 3RLOA 4JI4Q 3NELA 1MJEA 3GTLH 3I2ZA 4PZ7A 3I4MH 2AMCB 3GTOH 3M4PA 5M3MH 4A3CH 1PVOA 1X3FA 1CSQA 2LXJA 1EOVA 2UUCQ 1A62A 1EUJA 4DV1Q 3ULPA 3M85A 5IYDG 4JBMA 2VS1A 4IPDA 2Z6KA 1V9PA 4NXNQ 3J81i 1JJ2A 4R1JA 1VQ7A 1KRSA 1IBLL 1S72A 4Y52H 4A3DG 3CC2A 1AH9A 4A93H 3U50C 5IP7H 4DUZL 1HR0Q 1KQSA 3TS2A 3BZKA 3T1YL 2YU9H 4LFCL 2RF4A 1CUKA 3FHWA 1SROA 4YY3Q 3I4NH 4JV5Q 2K50A 1S40A 2RHSB 1E3PA 3HOXH 3CCQA 2HQLA 3CCSA 3T1HL 2OTLA 1KHIA 4X62L 2KCMA 3J7A5 3HOYH 2ES2A 4BY7G 4LF8Q 4AYBG 4L5RC 1PFSA 4L5QA 4OONA 4GOPC 1UEBA 1QVFA 4GOPB 3KFUA 4X65L 4BY1H 4DR6Q 3OYYA 1N36L 4LF7L 3K8AA 3RN2A 2OQ0A 2PQAA 4BBRH 2VNUD 2VQEQ 4DUYQ 5H1SE 3CCVA 1PH2A 1XMOQ 2BH2A 1B8AA 1C9OA 4JI5L 4JBJA 2AWNA 3DM3A 4AQYQ 1Q82C 3U4VA 1BVSA 4B3RQ 4C2MH 3PGZA 2CFMA 5IWAQ 1HNZL 5GAGC 2F52A 5K36G 4DKAC 4A3MG 2Y0SG 2ZJPA 5IP9H 2ZM6Q 2ALYB 2R7ZG 3RZOH 3PSIA 4L5TA 2UXCQ 2NZHA 1PA6A 4KHPL 2CQOA 2YTYA 1Y1WG 1XPOA 5C44G 3KLWA 4NXML 3ULJA 2HT1A 3CD6A 4DR5Q 4P71A 4GKKL 3CAMA 3KF8B 5GADC 2D0OA 4DV2Q 4TVAB 3RZDH 3M4QA 4LF4Q 5HY6A 1NMFA 3H3VH 1UE5A 3FP9A 3HFZB 4IPCA 3E9IA 1Y14B 1YHBA 1NBWA 1UE1A 3AFPA 1EQRA 5JEAG 4A3JG 2MO1A 4DV4L 3STBC 4EQ5A 3I4MG 1VQ4A 5GROA 4A3EG 1AE3A 1VQ9A 5M3MG 1XMQL 4A3CG 1IBML 2CKZB 2JQOA 3D31A 3PUXA 4H02A 5JEAJ 3TREA 3KJPA 3CC7A 1VQMA 2A8VA 4KHZA 2YTVA 4A3IH 1QZHA 1YIJA 1K73C 5IYDH 1XPRA 2JK8A 1X9NA 3OTOQ 4LF9Q 4X66Q 1TWFH 2Q2HA 3GO5A 2Q2UA 4B3SL 2MNAA 2UUAL 3J80i 4HJ7A 1YI2A 5AJ3Q 1EIFA 1L1OA 1N34Q 1VQBA 3G6EA 4OX9L 5LMUQ 4A3DH 4A93G 4C3IH 3TS0A 1T9HA 1NJIC 2UXBL 1HH2P 1SN8A 1AE2A 2ZTEA 3K81C 5C0XI 2N8NA 3K7AH 3PCOB 3CMAA 2C35B 5DLQE 2E5LL 1C0AA 5JJKA 3HOXG 1RL2A 2K5NA 4R4IA 2VUMG 1SFOH 2KBNA 1K3RA 1N33L 3M4OH 2NN6I 2DUDA 1E1TA 4JI8L 3HOYG 5C0XG 1U5KA 1K83H 1YITA 3K0XA 3GDEA 4TQUS 2JJQA 2LXKA 2MO0A 5EAYA 3AQQA 3KF6A 4MNOA 1YJWA 1L2FA 4GN3B 2F3IA 2NN6G 4BBRG 5BR8L 1N32Q 2KENA 1OXTA 5C0XJ 5LMNL 4LNQA 1B70B 1OXVA 1EQQA 3F2DA 1BBUA 1A0IA 4QJFA 1JMCA 2UUBQ 4R4OA 3U58A 5J3BA 1HNXQ 1YVCA 3M9BA 3A5ZB 3S1RH 3M7NA 1C7YA 4GKJL 2UU9L 2IY5B 1FJGL 1K8GA 4B3ML 5FLMH 3F2CA 4A75A 3HOWH 4AYBE 3UDGA 4YCVA 4GLVB 2F4VQ 4DR3L 1O7IA 5HGQA 1SLJA 4B3TQ 2BA0A 4YHHL 2N3SA 1Q46A 3HOVH 4IOAA 1X56A 3ER0A 4QQBX 4LFAQ 3GTPH 3I4OA 3NENA 1X3EA 2JA6G 3A0JA 3KDFB 1A8VA 1LYLA 1KD1C 4NB3A 4AH6A 4ALPA 4A3EH 1X54A 5M5WH 1FL0A 3PIOA 2OWOA 2NVXH 2RCNA 1J5EQ 2OCEA 2Y0SE 5LMNW 3BZCA 3H0GH 4A3IG 2CWPA 2WP8J 4DV1L 1Q1EA 4DV3L 1XTDA 3ERSX 2VZAA 4IFDI 2A19A 3CP0A 3PUWA 4A3FG 1N8RC 1XNQQ 3A74A 1VQDA 3K80C 4LF5Q 3GTJH 4L5SA 1QUQA 1X55A 2AHOB 4FDBA 4RG1A 3UDXA 4X64L 1SMXA 4DPGA 4DR1L 4YWLA 4A3KH 1VQNA 4JYAQ 4UPAA 1SRUA 2K5HA 4GNXA 4IFDG 2WAQG 1QVGA 4DK3C 2XTIA 4JV5L 4UP9A 4YY3L 3WWVA 3LGJA 3J80c 1FVIA 2VUMH 3EIVA 4P73A 3DLLA 2YV5A 1X6OA 4QL5A 3PIPA 4IFDJ 4JOIA 4HJ9A 2JA8H 4HIOA 1NE3A 1J6QA 4UP7A 4LF8L 2F4VL 2ZTCA 2IX0A 2AWOA 3CPWA 4DR6L 4DUZQ 3HOZG 5ELOA 1E22A 4LUOA 2PI2E 1UWVA 1VQIA 1WYDA 4HIKA 3T1YQ 2Z6KC 3CCJA 1PH3A 2E2HH 4K0KQ 1LUZA 4JBWA 4DUYL 2GVBA 1XMOL 3T1HQ 1NY4A 1GM5A 1X65A 1G291 4X62Q 4LF6Q 4A3BG 3S2HH 3FKIH 1SR3A 5FJ8H 2VQFQ 2E2IH 4B3RL 4DV6Q 2JEBI 3K7UC 2CWAA 3I7FA 1LM0A 3EBEA 4X65Q 3J81j 5FLMG 3IRBA 2ZM6L 5IYBG 1HR0W 1PH1A 3CC4A 4JI7Q 3HOWG 2UXCL 1CKNA 5JJIA 1K8AC 4YWKA 4OWTB 2UXDQ 2ZJRA 1OXUA 4DV2L 4PG3A 5GAEC 2GN5A 4JI5Q 4GLAC 4JOIC 4JI1L 4LF4L 2JA6H 3AEVA 3S14H 2AKWB 2HHHL 3D0FA 3HKSA 1HNZQ 2ZTDA 4DR2L 4A3LH 4LFBL 1MJCA 2B3GA 3VDYA 1HZ9A 3ICEA 3S17H 4PMWA 1YHAA 2NZOA 1VQGA 4POFA 5IT9c 1PH4A 4BBSH 2R7FA 2PQAB 1GO3E 2KHJA 4DR4L 3B6YA 4DR7Q 4PZ6A 4DNIA 4LW1A 4NXMQ 5IYCH 3H0GG 4IPHA 1CKOA 3S24A 2IT1A 2KHIA 1W3SA 1VQJA 3OTOL 4A3FH 3PO2H 1VQ5A 4PZ8A 3KOJA 1EYGA 4KLKA 1TWCH 3F2BA 1MIUA 5LMUL 4JI6Q 4A3KG 5C3EH 3SGIA 1N9WA 3CCRA 4IJHA 1KC8C 4UY8C 1DGSA 4JI0L 1GVPA 4JBKA 4QY7A 1SE8A 2I5MX 1VQOA 4GLXA 3PUZA 4B3SQ 4BA2I 2JA8G 4AIMA 1OXXK 1PH9A 3S2DH 3RR5A 3W1BA 1JT8A 3HOZH 4J15A 3G4SA 1EIYB 4R4QA 2UXBQ 2XGTA 3G48A 2QA4A 2E5LQ 3RLNA 1OTCA 1I3QH 4DV0L 3MEFA 1Z9FA 4UP8A 2K14A 4A3BH 1L1OC 3FKIG 2WAQE 1LTLA 1L1OB 5FJ8G 4APVA 1IBKQ 4OXPA 3E9HA 3CCUA 1HNXL 1N33Q 3OW2A 1Q8KA 1G51A 1EWIA 3RN5A 3BJUA 4JI2L 4BA1I 1YHQA 5IYBH 1A63A 2QEXA 1HNWQ 4IOCA 1I94Q 1PH6A 2JA7H 3STBD 2PI2A 1JE5A 1I50H 1TXYA 3E0EA 4B3TL 4JI3Q 4HJ5A 4DV5L 4DV7L 5ELNA 3CCMA 5FLXc 3GTQH 4C3JH 1WI5A 4R4TA 2E2JH 1D8LA 1QZGA 4JI4L 1NMGA 4A3LG 4GKJQ 3PF4A 1FJGQ 4B3MQ 4A3GH 3KF6B 1EFWA 4BBSG 2R6GA 2B29A 2I5HA 1VQ6A 1XNRQ 3TQYA 1IL2A 2ASBA 3HOUH 4IO9A 2UUCL 3AYHB 1VS0A 2Q2IA 3ULLA 4BXXH 5IYCG 4DR3Q 1PH7A 1IZ6A 4OWWB 1BBWA 1MKHA 2VW9A 1B7YB 4NXNL 4XTCS 3PO2G 2E8GA 2YTXA 1XNQL 1Q86C 1XPUA 3I55A 1E24A 3PV0A 5C3EG 1M1KC 3PUYA 1HR0L 4GOPA 1L0WA 4DK6C 1YEZA 1IXRA 2MFIA 1WOCA 3G71A 3CCLA 4JYAL 4NPSA 3S16H 4ME3A 1G6PA 1Y1VG 1HZBA 4LWCA 2NVYH 3GTGH 1D7QA 3TEHB 2VY3A 3CCEA 1V43A 1TWGH 3CF5A 4DV3Q 3RNUA 2H5XA 4KI0A 1HZAA 2WB1G 1OXSC 1VQHA 4O0AA 4A4IA 1IBLQ 1YBYA 2EIFA 4X64Q 3KJOA 3PF5A 2PNHA 4DR1Q 3BU2A
chains in the Genus database with same CATH superfamily
2ATWA 1ILQA 3L7ZC 3U9SA 3IL8A 1U0LA 5D3IB 3UGIA 2R7DA 3PIO3 1E1OA 1TGSI 3PO3H 1KBFA 2IHFA 4PV1C 3IFDA 4JK1C 1YNJD 1QILA 1H0ZA 3DWAA 2QKIC 4EQNA 3KYHC 1B9NA 1PH8A 2D9UA 4PMBA 4EQOA 3SEKC 3AFQA 1DOMA 5GAHC 4ZKBB 2K52A 2JA5H 2JA7G 3SVMA 5G3LF 1V1QA 1VCIA 2WKCA 1WGTA 1LR7A 3TOBA 1KAWA 1G2SA 1H9SB 2KEEA 2RSNA 2ZT9C 3G7LA 3OWFA 1JQOA 1WJJA 5HGIA 4A3GG 3GTMH 2UZ3A 1EEFD 5CR3A 4ZCKA 2NU3I 1IKLA 2WKDA 3NE5B 5JVH3 1KL9A 1S5ED 1HZCA 3BYTB 4HMJA 1Z2IA 2F3VA 4LF9L 3L0IA 1YO7A 2I0QA 3CPFA 4OO1G 2OTJA 5C6AA 2R93G 1Y1CA 4YWMA 1VQEA 1KXLA 3J7ZC 1IBMQ 4DR4Q 4IUNA 2D62A 3GOXA 2KA7A 3S9WA 1H95A 2QEJC 2NU2I 3F1ZA 2UUAQ 4PL4A 2GKRI 1Z7KB 1NAPA 3I91A 1I6VC 1MSHA 1BMOA 1OYVI 1KABA 4KD4A 1RHPA 4RAUC 3LJ0A 4V190 3OPOA 3Q6SA 1JB7A 1C48A 3VR2A 4JI0Q 3I4NG 1GUOA 1SE3A 4EX5A 5C4JH 2NU1I 4P75A 3T51B 3PO3G 4JI8Q 5EGTA 1IBKL 2ZXOA 4BWGB 3KDFA 1S3OA 4O1NA 3LJ2A 2WB1E 4HSVA 2Z9HA 1AZQA 2JA5G 2RCFA 5BR8Q 1LLRD 2NBFA 5JJZA 2BE5C 4WJ4A 3JC66 1BCPD 3S1NH 4MZ9A 1JWSD 3EN2A 5E7NA 2W0TA 4HGUA 2XTRA 1FGBD 1X3GA 1WTXA 2KCTA 4WJ3M 5K36H 2PO4A 3ERQA 3OXLA 4A3MH 3JAMc 4JI2Q 1NTGA 4EQPA 4FXDA 4H7BA 4DAYB 3EJIA 2CCZA 2Z4HA 4A76A 3NBHB 4P74A 2E2DC 4U6RA 2Q8TA 5JJLA 2BUSA 4DV5Q 3PUVA 5M5YH 4C3HH 4H13C 3HEJA 5I9OA 4PZ7A 2AMCB 4MN3A 3GTOH 2QW7A 4A3CH 1M4VA 1CSQA 2F3WA 5ELCA 2K05A 4A3KB 1EUJA 4DV1Q 3ULPA 4ZK9B 1YU6C 5IOCA 4JBMA 1JCKB 2SGPI 5DEHA 3GP7A 1NUCA 4KN7C 1JJ2A 2L5TA 3MC0B 1SNQA 2VUMB 3CXLA 3U9OA 2AUKA 4G7ZC 4Y52H 1AH9A 2JA8B 3BDLA 4LJZC 2NTTA 1KQSA 3GQBA 4LFCL 2RF4A 3FHWA 5KGUA 4WRDA 3CCSA 1LT4D 1RCVD 4GI3C 4L5RC 1PFSA 4L5QA 4OONA 3IFTA 3KK7A 5I6WA 4DR6Q 4Q0FA 2E2IB 2SEBD 3OYYA 1N36L 4LF7L 1IW7D 2JW6A 1TVXA 1LT5D 2BH2A 1C9OA 3DM3A 2F66B 4RFBA 1LTBD 3U4VA 5DAEA 1BVSA 4C2MH 3PGZA 5IWAQ 1JWUD 5GAGC 3J7AF 5K36G 4K8JA 4C56C 4DKAC 4A3MG 5IP9H 3PIP3 2ZM6Q 1A3UA 2UXCQ 1PA6A 1JWMD 1SBBB 4NXML 3ULJA 5KYIA 5JAVA 2SGFI 4GKKL 3CAMA 3KF8B 4DV2Q 3RZDH 1RFHA 3FP9A 4IPCA 4C3HG 1EY6A 1UE1A 3AFPA 1EQRA 4DAPA 1HHVA 5FUWA 3NTKA 4DV4L 4A3FB 4A3CG 1ULNA 1ZXTA 3MAQA 1W6JA 2JQOA 1TWCB 1VQMA 1SEBD 3VA7A 3V96A 4DU9A 2NTSA 1K73C 5IYDH 3W3AA 2TSSA 3SE0A 4X66Q 1TWFH 3GO5A 5C4HA 2MNAA 1ET9A 2Z6BA 4RGMA 2PZUA 3G6EA 3N52A 2B8GA 4C3IH 2SGQI 2RVLA 2UXBL 1K83B 2ZTEA 3K81C 2QGMA 4IFDH 3K7AH 3PCOB 2C35B 1RL2A 1YTPA 2N52A 2VUMG 1SFOH 3DEPA 1N33L 3M4OH 3BS1A 2F0HA 4CKCA 4A3BB 3SHLA 1K83H 1X74A 1YITA 2FHTA 3FSYA 1RJTA 3GDEA 4TQUS 1V1IA 3AQQA 1TUSA 1QNKA 3H94A 3J80E 1L2FA 4GN3B 2F3IA 1AFPA 1OXVA 1BBUA 2UUBQ 1YVCA 3M9BA 3A5ZB 1S5CD 1WD0A 2MJFB 2HQEA 2E2JB 2KECA 3HOWH 7WGAA 3J81L 5E4XA 4HFVA 2FNFX 3PMFA 1SLJA 4G57A 2BA0A 3HOVH 3GTPH 2B2YA 3I4OA 5FO9B 1LYLA 5JPNC 3IAS1 2SGDI 1LTAD 4ALPA 1F9SA 1HA5A 2KQ3A 2SGEI 2K7VA 3MXGA 3OSOA 1MJBA 2EE1A 5LMNW 1V1PB 2CWPA 1Q1EA 3ERSX 1PJUA 1HQMC 4IUVA 2A19A 3GV3A 1PPFI 3CP0A 4A3FG 2BL7A 1TWGB 5E3FA 3OIQA 4X64L 1WKXA 4C3IG 2F0NA 2ENBA 4KJOA 4ABNA 3MXNA 4UPAA 1SRUA 2B39A 4IFDG 2XVSA 3WWVA 1SGYI 3DUZA 1VMPA 4G4KA 1NE3A 4LF8L 2Z8LA 2ZTCA 3K5OA 2IX0A 1BR9A 2AWOA 2VRWB 4DUZQ 1K7VA 1UEAB 5ELOA 5CGKA 1VQIA 1WYDA 4QB4A 3T1YQ 2B63B 2Z6KC 1EYDA 2ORWA 1VMCA 1XMOL 1X65A 1EIHA 4A3BG 3EROA 1NR4A 2CW0D 3WDNA 5J1ZA 1F77A 2ENNA 3IRBA 1YNNC 3HOWG 1PH1A 4JI7Q 2G5DA 1PFMA 2FMMA 3HOVG 4LF4L 5GAEC 4RA8A 1VF5C 1HNZQ 3OL0A 4A3LH 2Z1CA 1MJCA 1LTTD 1HZ9A 4KY5A 4PMWA 1BCPB 4G76A 4POFA 2HCCA 2AQ3B 5JPMC 1QG7A 2XNAC 3B6YA 4Z9CB 4DNIA 4LW1A 2VB3X 4J8QA 5COYA 1CKOA 3S24A 2IT1A 4H0LC 1Y1VB 4CKBA 3QAHA 2A5HA 2EY6A 2IP6A 3FPUB 4PZ8A 4KLKA 5I6YA 3KLSA 1TQOA 1IKMA 4JI6Q 3SK5A 4IJHA 2DB6A 1BUSA 3S1MB 2X6LA 3E59A 5EPKA 1JOOA 4JBKA 2I5MX 2SOBA 1EY5A 1VQOA 4B3SQ 4EVOA 4DN4M 2QF7A 2ORVA 1CHQD 2NZ1D 3W1BA 4FP5D 4LK1C 1JT8A 2N55A 5DAUA 3K5NA 2A2DA 4PNYA 1IY6A 2XGTA 2E5LQ 3RLNA 2MPMA 1LTSD 2F1MA 4HR7B 1LTLA 4DNCA 3IAYA 2FINB 1EWIA 4M1UB 1QNUA 5IYBH 3KP9A 1A63A 2EYHA 1HNWQ 1G2TA 2PI2A 1SGEI 1DYQA 4G7HC 3E0EA 1TIHA 4B3TL 2PYKA 1BDOA 5C44B 1AEXA 2F4IA 4PQXA 2A68C 5FLXc 3GTQH 4C3JH 2R61A 4A3LG 3BJIA 4GKJQ 4B3MQ 3KF6B 1PXUA 5LL6S 1RKNA 2I5HA 3A7AB 1XNRQ 3QOJA 3HOUH 4IO9A 2UUCL 3AYHB 1L0XB 2VW9A 1PRTC 4CKEA 4NXNL 4FO2A 3G6JB 1ONLA 1W4RA 2A69C 3EVQA 3MXUA 2RKSA 1L0WA 2WACA 1SJHD 1YEZA 4HCEA 1WOCA 3CCLA 2NUCA 4JYAL 1Y1VG 2F0FA 2F0TA 3GTGH 2KUMA 2G9HD 1CQFA 3CCEA 1R0RI 2D5DA 3OXGA 3RNUA 2H5XA 3NP8A 1HZAA 4NKLA 3DXJC 2WB1G 1OXSC 2F0KA 1IY5A 2F0JA 1IBLQ 2XSCA 1WTQA 2M5XA 1JOQA 5JOBA 1CA6A 1ZYRD 2XMXA 1PYWD 2FFKB 3HOYB 2PNHA 1A6XA 2K01A 1K8MA 4JC0A 2RHQB 2V1CC 2KVMA 2VQEL 4BY1B 3I56A 3P75A 5L37A 4AQYL 1U9RA 1YJ9A 1PYBA 1YZ6A 3S1QH 4E6IA 1QUQB 2DGYA 2VQFL 3UGLA 1BOSA 4UXIA 2RQXA 1JJCB 3GTKH 1S5FD 1SNDA 5C4XH 4K2KA 2ZXRA 2B2VC 2L15A 2LKVA 3J80L 2DKVA 3FMCA 5CV4A 1CKMA 4DXFA 4Y7NH 1UAPA 2K1BA 3ZJYC 2R92H 4WP4A 1SGDI 2EXDA 2CHBD 3SDZA 4C3JG 1KRTA 5EKIA 3M4YA 4KHPQ 3FBVA 3H09A 4OO1I 3HOUG 1TWAH 1HDLA 2GSCA 2EYLA 4DR7L 1OVOA 4QIWE 1RIPA 3QJYA 4F8MA 2HD3A 4JI1Q 5KEEA 1ZKOA 3JAME 5AJ3L 4A3IB 1WCMH 3A5UA 3W5OA 5J8CA 2ID0A 3M3YH 2F0QA 4LFBQ 4CHTB 2KMQA 1CKNB 1QCBD 1SYGA 3BDCA 1XJVA 2K32A 1BUVT 2OQKA 3CMEA 1R9TH 2VL6A 3BG3A 2SNSA 4CGYB 2QCPX 1SAPA 1I5FA 1VQAA 4OX9Q 1X3QA 4XQJA 1SMYD 1ICFB 4L6TB 1P16A 3OMCA 1EY4A 1VQPA 5EX3A 1IHZA 1FNUA 1HA6A 2KMPA 1PLFA 2JN4A 2JA9A 1TWHH 5G3LD 4GN4B 1KLUD 5M9OA 1SYBA 1STNA 3UDIA 1K28A 2XWJB 3D4DA 2EJGC 1K8OA 5C4XG 1E7ZA 2F0SA 2YFBA 3AJFA 1H9MA 4BY1G 1O7YA 2N49A 1PH5A 1I94L 2F4VL 2LSSA 3OWEB 5LMNQ 4GN5A 4QGUA 1KDAA 2XTQA 1GUWA 2KCNA 2R92G 4Q9VA 3D8GA 2K75A 3I73A 5A35A 1EIGA 1IYJB 2ODDA 1VQ8A 3KLRA 5IIFA 2UU9Q 1STHA 3FEWX 2I5LX 2NVTH 2Q8RE 2J4XA 2PMZE 3K59A 3T53B 3UE1A 1RTOA 1Y1WH 4A3EB 2PPBC 2WFWA 1MBYA 3R2TA 5KNDA 4QUFA 2NVXB 2VXWA 3ND8A 3TP6A 3K5LA 4G7OC 1PRTB 2KHSA 3AB9A 2R93H 2V4DA 3H0GB 1KTKA 1WCMG 4A3JH 3RLOA 3GTLH 1HQRD 1ET6A 4HAEA 1B3QA 1PVOA 2A74C 1LTID 3GTJB 1EOVA 3NTHA 2A20A 1WVLA 4OGQC 4IPDA 4YZCA 5LL6X 2Z6KA 4MIUA 1F2MA 5EBDA 3URYA 1IYVA 1VQ7A 1KRSA 4FVMA 3CC2A 1FAQA 5EKKA 5FK9C 1H9KA 1EFID 2YU9H 3I4NH 4JV5Q 4YY3Q 1SROA 2K50A 1S40A 1EYAA 1E3PA 4HEDA 3CCQA 1HFGA 1D2BA 3T1HL 2E2HB 3R5AA 1PTOC 2KCMA 3TO6A 2ES2A 3CU7A 1UEBA 4GOPB 3FKIB 4X65L 1O7LA 1GHJA 3J81E 3C3LA 2K5QA 2FU2A 3RN2A 2PQAA 5H1SE 4JI5L 3K0YA 4JBJA 5LNK1 1IW4A 1ENAA 4C1NI 2CFMA 3NQTA 4DF7A 2F52A 5IGGA 1Y8NB 3S14B 3FDTA 2ALYB 3LJ1A 4L5TA 4CDFC 2YTYA 4RHRA 3DMUA 1Y1WG 3CD6A 5KIXA 3S17B 4P71A 4ULLA 1JQYD 5GADC 3M4QA 3D4RA 1NMFA 2DN8A 1UE5A 3E9IA 3I70A 1NBWA 4A3JG 2MO1A 1LR9A 3STBC 4EQ5A 1VQ4A 4A3EG 2LB7A 1AE3A 3PO2B 1SNCA 1IBML 2CKZB 3TREA 4TKOB 4KHZA 4KMUC 2YTVA 5K5PA 4UDUC 1X9NA 1CE3A 4YZ9A 1GOZA 4LF9Q 2UUAL 2A6EC 3J80i 2VB2X 3E5SA 1EIFA 3F2UA 1VQBA 2QQCA 4FNFA 3Q0AA 5C4ZA 3TS0A 1NJIC 1SN8A 3S2DB 1MJAA 1AE2A 1DS3I 3CMAA 1J8IA 1KNEA 2K5NA 3WOEA 3A55A 2KBNA 1HJAI 4JI8L 1T5XD 1XX6A 1F2LA 4K6LA 2IJ0A 3BDOA 2BDOA 2J87A 1GUSA 5C3WA 1YJWA 5CBAE 5BR8L 2LFNA 3VA5A 2KENA 4UAIA 1EEID 2TMPA 3D6CA 1BXTA 1A0IA 3HKZB 1JMCA 2GVIA 1TOTA 4ZYSA 1HNXQ 2OF1A 2IX3A 2JZMA 1F9QA 3UGDA 2IY5B 1FJGL 1K8GA 1CM9A 2A6HC 4Z7HA 1STBA 3F2CA 3K5MA 2WCYA 4YCVA 3J7YW 2P6AC 1YNJC 2HDMA 3LWEA 1Q9BA 2PCFB 4ZQ3A 2ROWA 3VA9A 2N3SA 2Y0MA 1X56A 1Z6HA 3ER0A 1S20A 4O1OA 1X3EA 1EWHA 2KCXA 3VR6A 4AH6A 4HN7A 1FL0A 5ELEA 4G75A 4O42A 1AN1I 4UXJA 2WP8J 4DV1L 2V1CA 2H1EA 3ZYYX 4B9XA 1CZWA 4B9WA 4DK0A 2FJ2A 3JAML 4IFDI 2DY8A 2ETDA 1VQDA 3K80C 3C1EA 2RSOA 1X55A 3UDXA 4K8IA 4RG1A 1LACA 5F2DA 3HS0C 4A3KH 4DR1L 1VQNA 1K7UA 4BS9A 3TP5A 1ULKA 2OXPA 4CDEC 4GXTA 4UP9A 3I72A 3AMUA 2VUMH 3EIVA 3F4MA 1PTOB 1X6OA 3PIPA 4IFDJ 3TO9A 4HJ9A 2JA8H 1H9SA 2EPBA 4DR6L 4HMIA 1D1KA 4QIWB 5CYUA 4HIKA 1PH3A 4K0KQ 1PTOH 3LX0A 4FXKC 4LF6Q 1Y8PB 2E2IH 4DV6Q 2LY7A 3K7UC 1CGJI 2KMOA 2PW7A 1EWCA 4M8AA 2ZM6L 4F87A 3CC4A 1SXTA 2UXCL 3PQIA 5DNFA 1Z7TA 2EYOA 3JSBA 1RF2D 4OWTB 2UXDQ 2ZJRA 4DV2L 3AEVA 2GN5A 4JOIC 2NYZD 1G91A 3TJQA 2HHHL 2EJMA 3A56A 2BL8A 2ZTDA 1TY2A 4DR2L 2F0WA 2NVQB 1ULMA 2C9OA 1BCPC 1FNVA 2SNMA 1V1OA 4L8JA 5IT9c 1P9GA 5E1FA 4DGZA 1GO3E 1KAAA 3KY9A 4NXMQ 1CT0I 1UVGA 4IPHA 2XWBB 4DNRB 3TN2A 1I4GA 2F0VA 2F0OA 4RGNA 5CBEE 4K14A 4A3FH 3EA6A 3KOJA 3TDQA 2V6EA 1TWCH 1ICWA 3F2BA 3TO7A 3UITA 4A3KG 1N9WA 3TZDA 2QQDA 1KC8C 4ZUJA 5I9PA 1WTOA 5M5XB 4UY8C 1DJRD 1X3PA 1I6HB 1GVPA 1F9RA 4QY7A 1SE8A 2CVRA 2K9HA 3MEHA 3RU0A 4NDXA 3VR3A 2JA8G 1OXXK 1PH9A 2JBWA 1CT1D 4NV5A 2PMZB 3NWTA 1D5ZC 4BY7B 2UXBQ 4AYBB 3G48A 4DAYA 3QWPA 3FVVA 4RHSA 4WFN3 1SYDA 4K5VA 3NBHA 4UP8A 4DV0L 4A3BH 1C4QA 2WAQE 3SK6A 1L1OB 1N33Q 5D3DA 3N6RA 4APVA 3E9HA 3CCUA 1K3BC 1TT2A 3IAM1 5EKLA 3RN5A 4BA1I 3I9V1 3D4WA 1SNOA 2MUYA 5IGEA 5M3FB 2DJFC 1SE4A 2JYOA 1JE5A 2Y0SB 1TXYA 3S15B 2YFAA 3SGBI 4JI3Q 2NWGA 4HJ5A 4DV7L 3KUPA 1LV9A 3CQZB 2E2JH 1QZGA 1IW7C 4R8NA 4JI4L 4OIJA 2KMRA 2B29A 1ENFA 4BXXH 2Q2IA 3ULLA 2IPKD 1PH7A 1IZ6A 5M3MB 1BBWA 5FO8B 2RIOA 1B7YB 2JSOA 4XTCS 2E8GA 2I46A 4KKSA 4DA2A 2YQPA 1XPUA 3I55A 1E24A 2OEOA 2ELIA 1HEVA 1HR0L 2QPOA 1SNPA 1IXRA 3MEKA 2KJXA 4NPSA 4C1NK 1G6PA 4AS2A 3TEHB 3NPPA 3P1HA 1V43A 1TWGH 3CF5A 9WGAA 2DY7A 3OVOA 1R79A 1L0YB 2FMCA 4O0AA 2XN9C 1YBYA 2K6AA 3ND9A 3HH2C 2IL8A 4X64Q 3KJOA 3DO9A 2O5JC 3BU2A 1HPTA 5D65A 4ZUIA 2YYZA 1KDCA 2IX1A 3I3CA 3QR8A 4HJAA 1JJGA 3KF8A 2MQHA 3I90A 2A73B 2X6GA 1KDBA 3UDFA 1H9JA 2B63H 5NUCA 3H15A 3OOCA 2Z0SA 4GNXB 1Q1BA 2QGQA 3JAMi 4DR5L 3DM1A 4JI7L 4L9MA 1GKHA 4U68A 2CH4A 1HJPA 4IJLA 1TBRR 4JCVE 2JEAI 3CHBD 2HDLA 1AN8A 4LUVA 4FF4A 1ASZA 3HRZC 3H3VC 1YJNA 2GVAA 5M3FG 1K0RA 3EQLC 1MSGA 1NSNS 1B53A 4KD3A 4BXXG 1HTLD 3TSSA 2E73A 2A69D 2ICEC 4RGOS 2AUJD 3SK8A 3MZ5A 3RD4A 2F0DA 1MD2D 1N34L 1UUCA 5I2XA 2Q2TA 1XMQQ 1X4SA 1D5MC 4JI6L 2MJ8A 3ITPA 2K5VA 1VQCA 1Y1VH 4A3DB 4Z7GA 1OMTA 2N78A 3TRZA 3MA2B 4YZDA 2OVOA 1A2TA 4HJ8A 1SYEA 4CJ2C 4J6HA 4AS3A 1RD9D 4HSPA 2A1AA 3T4AC 1GD7A 3L0OA 4ID6A 3S1MH 4MTNA 5ELBA 4DAMA 2L12A 4O2DA 2UVOA 2GIVA 5FO7B 2QQ0A 4YCUA 5IP7G 1N32L 4GS3A 1DOKA 4OWXB 1F2YA 1RTNA 1E2WA 1WTRA 2L8EA 1E0BA 4P72A 3D6WA 4MPIA 2JP1A 3Q8DA 1F2ZA 1Q8IA 1PTQA 5E4WC 2PNRC 3HP3A 4NMZA 2B63G 3S1RB 1HNWL 3W1GA 2EQSA 5BN4A 4R4CA 3A8IE 4KTAA 4LFAL 1V1PA 4DWLA 1EY8A 1UE6A 2O2LD 4X3KA 3L2PA 5C3XA 1W2BA 2DIPA 4HIDA 2IHEA 1KBEA 4IALA 1A3VA 2QDBA 3H3VI 4XYOA 4LAAA 1XNRL 5C44H 1J5EL 5M5WB 1B9MA 1PFBA 4YHHQ 3ONAB 2CW0C 3HKZE 1II3A 4YCWA 2HIXA 1PRTF 1IYUA 1S4ZA 1JORA 4E1PA 4LF5L 5JEAH 2RBMA 5HURA 3I2ZA 2EZVA 3PDNA 1B4OA 1PZJD 2CJSC 4IURA 2UUCQ 1DXMA 2AQ1B 2GKTI 4ODGA 3UFFA 3VR4A 3M85A 2VS1A 1JC7A 4OL7A 3HOXB 2HUGA 4NXNQ 3J81i 2OZUA 4R1JA 1IL8A 1IBLL 4A3DG 3NQIA 3U50C 2K5WA 1LT3D 2ERWA 1TBOA 1RDPD 3HOXH 2HQLA 1WTWA 4BBRB 4X62L 2OTLA 1DONA 1AZPA 3HOYH 1SGPI 1SYCA 1QVFA 4GOPC 3KFUA 4J1MA 3NHHA 5C0XH 3S2HB 2EXZA 4BY1H 1M8BA 5DM73 1EY7A 3VYSA 1TBQR 5FUVA 1XX8A 4PL3A 4BBRH 2VNUD 5E3QA 2VQEQ 4DUYQ 3FPPA 4ZRZA 4AQYQ 1A3TA 5CV9A 1Q82C 1EL0A 3TMEA 2OD1A 1NR2A 2N71A 4B3RQ 5EQ0A 1CGII 4NP5A 1FD7D 4EGVA 2ZJPA 2JA6B 1B1ZA 2PZWA 3QIAA 2NZHA 4KHPL 1XPOA 5C44G 3KLWA 4XYQA 3BZDB 3D3RA 4X3TA 5HY6A 3H3VH 3X3NA 4R8IA 5J39A 1Y14B 5CV6A 5JEAG 3A7LA 4HEA1 2ZW3A 5EPLA 4H02A 3D31A 1RODA 2QDLA 2CH4W 5C3EB 5D14A 1D6EC 1BNZA 4A3IH 3D00A 1YIJA 3QB3A 2JK8A 2WAQB 3OTOQ 2Q2HA 3QG1A 1KMAA 1EZ6A 2HCIA 4CJ1B 3E0JA 4HJ7A 5AJ3Q 5ELDA 5FUXA 4IUUA 4KY6A 5LMUQ 1SNMA 4OX9L 1NUBA 3HZXA 5KRUA 5KYLA 1T9HA 3NK9A 4QMGA 4RCOA 2CWHA 2N8NA 5JJKA 1C0AA 5DLQE 1WTPA 3HOZB 3HOXG 4KKTA 4ME5A 2EVBA 1K3RA 2DUDA 1E1TA 3HOYG 1EU4A 1XTCD 1Q90A 4CBVA 5C0XG 3HG9A 4K5WA 1U5KA 3K0XA 5EAYA 2JJQA 3UI2A 4I7ZC 3T56B 3KF6A 4N8FA 2NN6G 4BBRG 1Q3LA 5LMNL 3DWQA 2QILA 2X69A 2SDFA 2EYPA 2JA7B 1ZYRC 3QO2A 3U58A 4TRDA 5CCLA 5J3BA 1I50B 4Q5VA 2UU9L 2B0UC 1LO5D 2KCCA 1XYIA 2K03A 4XXEA 4AYBE 3UDGA 2F4VQ 2B2TC 5FKAC 3O13A 1O7IA 5HGQA 4DR3L 1BF4A 4A3GB 4TSSA 1Q46A 1STEA 2E74C 3VR5A 3E2IA 2K5DA 2JA6G 3KDFB 1A8VA 4JW0A 5HQ8A 4A3EH 1X54A 1B44D 3PIOA 2OWOA 2NVXH 3C46A 2RCNA 2L7XA 1AW7A 2Y0SE 2F0GA 3H0GH 4A3IG 3FNBA 1XA6A 4DV3L 4I1TA 1XTDA 3S16B 3J7AV 2VZAA 5T1IA 2NVYB 2JA1A 5E3RA 1XNQQ 2B2UC 3A74A 5CMDA 5IT9E 3TOAA 3GTJH 2RDFA 1QUQA 4FDBA 5JVG3 1SMXA 4DPGA 4B6DA 2P22B 1S5DD 2KEDA 2WAQG 3K58A 4N9TA 4DK3C 1QVGA 2XTIA 4JV5L 4YY3L 3LGJA 2K19A 3W2DA 1SE2A 1FVIA 1U4MA 1FYCA 3R8BA 1GUGA 4SGBI 2YV5A 2BE5D 4QL5A 1X32A 2GKVA 1PTOF 5IGDA 3PO3B 2L9HA 4V0BA 3HOZG 1Y69U 1E22A 2AQ2B 1DM0B 4LUOA 4DNTB 2PI2E 1UWVA 2CQAA 4KY7A 3T13A 1CTMA 3CCJA 2E2HH 1JOKA 1TIID 2A6HD 2GVBA 3C1FA 1SMYC 2JA5B 3T1HQ 2YUUA 1Y8FA 2L1LB 5I2YA 3OW7A 1V1HA 3FKIH 1SR3A 1STGA 2XRCA 4IUQA 2RDGA 2JEBI 3T16A 4RGTA 4CDCC 1LM0A 3VDPA 4X65Q 3VYTA 3GV6A 1HR0W 1SGQI 1VDZA 1CKNA 1M8AA 3MWYW 4BBSB 4YWKA 1CI3M 3GTMB 4FKDA 1SJ8A 1OXUA 4JI5Q 3MVVA 3B4VC 4GLAC 3S14H 3I4LA 3H91A 3D0FA 5EJWA 2L0CA 3HKSA 5KNBA 5JHWC 3S17H 1YHAA 4BBSH 2KHJA 4DR4L 2O5IC 3DA3A 5IYCH 3H0GG 3NWSA 1PZKD 1S5BD 5KNCA 1W3SA 1VQJA 3PO2H 1VQ5A 2MHVA 4QUCA 2I07B 1EYGA 2NU4I 3NUCA 4K5XA 3TP7A 1MIUA 1NCVA 3BVZA 3CCRA 1R4QB 4JI0L 4IZ8A 3HGBA 3SXHA 1CHPD 1CT2I 4GLXA 4OAUC 4AIMA 2MGSA 1JE4A 4RCNA 1WTHA 2IWHA 5C4JB 3S2DH 3VDUA 4IUPA 1OMUA 5C5MA 4J15A 3G4SA 2FUG1 2H4OA 1NNXA 3DEOA 5FOBB 1HTPA 1TS4A 1D5XC 1OTCA 1Z9FA 2K14A 1L1OC 3FKIG 1IBKQ 3S1NB 1HNXL 4OXPA 4XDXA 1Q8KA 1G51A 1E2VA 3BJUA 4JI2L 1YHQA 3QWNA 3A8JE 4KV6A 4N9PA 1B3AA 3NTIA 1PH6A 4RKLA 1LTGD 2DNEA 4A3MB 2RLDA 1FR3A 3L3OC 5J22A 1CSOI 4DV5L 2V53A 1WI5A 1PFNA 4R4TA 1D8LA 4FF1A 1ESRA 1NMGA 4XT1B 1FJGQ 1TBNA 1XBTA 2JB1A 4BBSG 2R6GA 5M5YB 2B8TA 4C3HB 1XWEA 3TQYA 1IL2A 2ASBA 1Y1BA 3AU7A 3QTLD 3A54A 5IYCG 2MP1A 1TU2B 1G8ZD 3GTOB 3SGQI 3P20A 1C8CA 2X52A 1JB3A 4IN3A 4I7AA 2DNCA 5CCMA 4H44C 3PO2G 2JB2A 2YTXA 5J8FA 4GOPA 2XRQD 4DK6C 1FY7A 3G71A 2B2VA 2IW3A 2QZGA 1GHKA 1HZBA 1TY0A 4LWCA 1ILPA 1CT4I 5CV5A 3TBIB 2VY3A 1SJED 2XRSD 4MTKA 4FYDA 4KI0A 2EOTA 2N88A 2XIWA 1HCZA 5T1GA 2BOSA 4A4IA 4DFAA 2EIFA 5I4DA 2WIIB 1XXGA 3PF5A 4DR1Q 3FRPB 1XPRA 4O1PA 1WFQA 4LFCQ 2ENZA 2FXQA 1H9RA 2NU0I 1QVCA 1Q81C 3R5DA 2NB0A 4K0KL 1FGUA 1STAA 4LF6L 5IWAL 3OIPA 2M2LA 3UEYA 2Q8IB 4DV6L 1KLGD 1PHJA 2JXMB 3GD7A 4GNXC 3MXNB 1LTRD 4C2MB 2ZJQA 1N36Q 4LF7Q 1TS5A 2O4XA 3HKZG 2K4KA 4NV2A 2EDGA 1Q12A 4HTHA 2UXDL 4LUZA 1TS3A 1I4PA 1LR8A 1A15A 2Z4IA 2BA1A 1F9PA 2F0PA 4OIKA 3RZDB 1BCPF 1VQLA 4ZLTF 2LMCB 4U673 2P5ZX 1PV4A 4XIGS 5FLXE 4GKKQ 1BO0A 2ICIA 2NVQH 1T5EA 3RLFA 4X66L 3QOLA 3H6MA 5IE8A 2HHHQ 5ISRA 4DV4Q 1P8LA 1BKBA 4DR2Q 4DXGA 1TWFB 4RMFA 1YNXA 1PYSB 4AMLA 4POGA 4C3IB 1MHWC 2RA4A 3CXCA 2BH8A 3P23A 1EQVA 2WINB 2F3CI 3K7AB 1UNSA 2D0PA 2EY1A 5IT9L 1BBXC 3F8TA 4WJWA 1SFOB 5M5XH 3M4OB 1I6HH 5AFWA 1Z47A 2HIVA 1PTRA 3CW2C 1TS2A 2HGKA 3UOEA 2D2CC 4ZAIA 3DHQA 4X6AH 4IPGA 2B2TA 4JG2A 1YNND 1E2ZA 1PDQA 1TR5A 2UUBL 5IY0A 4FF2A 3J81c 1Q7YC 3K57A 1CA5A 4PMCA 4BY7H 1EQTA 1DOLA 3Q22A 1JICA 5IGBA 3TZUA 2EYFA 1K9MC 2R7ZB 5GQOA 3RMHA 3NBIA 1CSPA 4DV0Q 3HOWB 3NEMA 4R9WA 4JI3L 4HIMA 4S3SA 1UE7A 5LHY1 5M3FH 2J9RA 3HOVB 3UE0A 2B2WC 4N8X1 2B2UA 3GTPB 1P9ZA 2R7ZH 3S15H 5IP9G 4UXHA 3I4MB 1PZID 2JAEA 4MHEA 3FC3A 1KIXA 3VYUA 2JE6I 1VQFA 3LNNA 4L63B 3U4ZA 1EY9A 3CQZH 1M90C 1ASYA 2F0UA 1VQKA 1NXUA 1DCZA 4DV7Q 2J7ZA 3NELA 1MJEA 4JI4Q 1M8CA 1EOTA 3I4MH 2E5RA 3OXFA 3M4PA 5M3MH 3Q24A 1X3FA 2LXJA 4A93B 1W6KA 3TP8A 1A62A 2EJFC 2WV6D 3SEBA 5IYDG 4K2LA 1V9PA 4OAVB 3BVMA 2R3ZA 4XQQA 1S72A 1DZ1A 4A93H 5IODA 1SDFA 3I8ZA 5IP7H 4DUZL 1HR0Q 1DD2A 3TS2A 5BN5A 3BZKA 3T1YL 1CUKA 1EU3A 2RHSB 4KKUA 2OU2A 4X3SA 1KHIA 1U4LA 3J7A5 4BY7G 2M00A 4LF8Q 4AYBG 2KKMA 5A2QE 2CWGA 2A68D 1V8QA 5FUYA 1HUMA 3K8AA 3RZOB 2OQ0A 2L11A 3R5CA 3CCVA 1PH2A 3SDJA 1I4RA 1XMOQ 1B8AA 2AWNA 2EY2A 1CK1A 1HNZL 1JR0D 3IKJA 3Q23A 1TURA 4IQZA 2Y0SG 5EPJA 1PRTD 2R7ZG 3RZOH 3PSIA 2CQOA 2HT1A 4DR5Q 2DJGC 1Y8OB 5CV8A 3B55A 2D0OA 1ZEQX 4TVAB 1SYFA 4LF4Q 3RUZA 3HFZB 2JB3A 1YHBA 1O78A 3I4MG 5GROA 1VQ9A 5M3MG 1XMQL 2ZXPA 1PCEA 3CC7A 3PUXA 5JEAJ 3KJPA 1SGNI 4CDDC 3OHXC 5BN3A 2RDHA 3R5BA 2A8VA 1K0SA 1QZHA 4B3SL 2Q2UA 1YI2A 1L1OA 1N34Q 1HPCA 4A3DH 4A93G 2WGCA 2WB1B 2EYMA 2LEOA 3WOFA 1HH2P 2CAZB 1QB5D 1ENCA 5C0XI 2E5LL 1O7ZA 4R4IA 4F88A 2F0IA 2KOLA 2NN6I 3C2PA 4FF3A 2QSBA 4HCSA 1HRJA 1OO9B 2PQ8A 2PW5A 2F6MB 4RH6A 4XT3B 1A2UA 2LXKA 2MO0A 4MNOA 1MI2A 4ILWA 5IGFA 1N32Q 5C0XJ 1OXTA 4LNQA 1B70B 1EQQA 3F2DA 4QJFA 1FYBA 4R4OA 4UHVA 3S1RH 3KLSX 3K6OA 3M7NA 1C7YA 4GKJL 3NSWA 4B3ML 1TDPA 3KBGA 5C5LA 5FLMH 3A8KE 4C3JB 3GTQB 4A75A 4GLVB 1SGRI 3P7JA 4B3TQ 1QE6A 4YHHL 3HOUB 4IOAA 1VDDA 4QQBX 4LFAQ 3NENA 1DS2I 3A0JA 2X3TA 1KD1C 4NB3A 4P2CB 4YIJA 5M5WH 3E6ZX 3OMGA 2PZTA 1ML0D 4E1RA 4OEMB 3MXPA 1KNAA 5FLXL 1J5EQ 2OCEA 3BZCA 2E75C 4A24A 3CRKC 1QWYA 4RKBA 3GTGB 3PUWA 1N8RC 4JVZA 4LF5Q 3CKIB 4L5SA 2AHOB 1MGSA 4YWLA 4JYAQ 1I4HA 3X3MA 3MFYA 2K5HA 4GNXA 4LMQD 1B50A 3J80c 2ZRRA 2F0MA 1UHAA 3M7GA 4P73A 2LUYA 3DLLA 2QQEA 1QOHA 2JYYA 4JOIA 3KBXA 2OT2A 4HIOA 1BQQT 1J6QA 4UP7A 5CC4A 2F0LA 1I4XA 4KJNA 3S1QB 2K33A 3CPWA 5EBCA 2LS01 5TSSA 2NN6H 1HFNA 3GTKB 1N13A 5C4XB 3R3OA 4WORA 1FNWA 1HXYD 1VF7A 1PMRA 4OELB 2N1AB 1LUZA 1EYCA 4JBWA 3SK4A 4DUYL 2L1BA 1NY4A 1O80A 1GM5A 1G291 4X62Q 3S2HH 3LWUA 2ARPF 5FJ8H 2VQFQ 4Y7NB 4B3RL 2K04A 2CWAA 3I7FA 2R92B 2WVJA 3MHBA 3EBEA 3SR1A 3J81j 1J9OA 5FLMG 5IYBG 1STYA 5JJIA 2RC4A 1K8AC 5E3PA 1GUTA 1CQVA 4OHJA 3MFGA 1U4PA 1TWAB 4PG3A 1WTVA 4JI1L 2JA6H 2AKWB 1LABA 4NW2A 5HGTA 4LFBL 2B3GA 3VDYA 3ICEA 2C5CA 2NZOA 1PH4A 1VQGA 4QCLA 2A2CA 1WCMB 3DA4A 2R7FA 4CJ0B 2PQAB 4ZKCB 2N17A 4DR7Q 3M3YB 4PZ6A 2PQEA 2L55A 3R2IA 3BYYB 4B08A 3VE5A 5DM63 2KHIA 3OTOL 4I65A 1CFMA 1R9TB 1U4RA 3CRLC 3EFXD 4GZYC 1MJ9A 5LMUL 3VYRA 1LT6D 5C3EH 1PTOD 3SGIA 1DGSA 3MTSA 1UUPA 4X3UA 5CV7A 1QJOA 3BVGA 2E76C 2RADA 3PUZA 4BA2I 1I3QB 4K6DA 2L4NA 1AP0A 4JPBW 1TWHB 1HUNA 3RR5A 2FEFA 4DAVA 2CWFA 3FVQA 3NXWA 3HOZH 2B2WA 1EIYB 4R4QA 2QA4A 4KHVA 1WGCA 1ESFA 1WD1A 1I3QH 2M9VA 3MEFA 5FJ8G 1I4QA 2EY5A 3OW2A 1B2TA 1K7TA 5A2QL 4QF4A 3L9AX 2QEXA 2BCOA 1TKWB 3V2TA 4IOCA 1I94Q 2RIJA 2NVTB 2JA7H 3STBD 1EZ8A 1I50H 2K28A 4OVOA 1GXDC 1Y1WB 4KN4C 5ELFA 5ELNA 3V05A 3CCMA 3UEJA 2F03A 2GA4B 3PF4A 5IGCA 4A3GH 2R93B 1EFWA 2A6ED 1VQ6A 2JXDA 4A3JB 3E3XA 4IUTA 3GTLB 1VS0A 4DR3Q 1SSOA 4OWWB 1UVFA 1MKHA 1G6ZA 5CORA 4F7XA 1D1IA 4OO1H 1XNQL 1Q86C 1WTJA 4RWSC 1R4PB 3PV0A 1M1KC 5C3EG 3DWPA 3PUYA 4FXGC 1GJXA 2MFIA 3S16H 4XQNA 4ME3A 2NVYH 1D7QA 2B2YC 2BDNA 4DV3Q 4KK7A 2YU9B 1MT1A 3I4NB 5HI7A 2EYJA 2J0TD 1CZGA 4PL5A 1VQHA 1CHOI 3FSXA 4DK1A 2G9DA 2F0EA 2B8FA 3R93A 1EY0A 1FARA 5EX0A 1GUNA
chains in the Genus database with same CATH topology
2ATWA 3L7ZC 1U0LA 3UGIA 2R7DA 1E1OA 1TGSI 3PO3H 1KBFA 2IHFA 1H0ZA 3KYHC 1PH8A 3SEKC 3AFQA 5GAHC 2K52A 2JA5H 2JA7G 1V1QA 1VCIA 1LR7A 1KAWA 1WJJA 5HGIA 4A3GG 3GTMH 2UZ3A 2NU3I 1KL9A 1HZCA 4LF9L 3L0IA 1YO7A 2I0QA 3CPFA 4OO1G 2OTJA 2R93G 1Y1CA 4YWMA 1VQEA 1KXLA 3J7ZC 1IBMQ 4DR4Q 2D62A 3GOXA 1H95A 2NU2I 3F1ZA 2UUAQ 4PL4A 2GKRI 1Z7KB 1BMOA 1OYVI 3LJ0A 1JB7A 4JI0Q 3I4NG 4EX5A 5C4JH 2NU1I 4P75A 3PO3G 4JI8Q 1IBKL 3KDFA 1S3OA 3LJ2A 2WB1E 2JA5G 5BR8Q 4WJ4A 3JC66 3S1NH 4MZ9A 3EN2A 5E7NA 2W0TA 4HGUA 2XTRA 1X3GA 4WJ3M 2KCTA 3OXLA 4A3MH 3JAMc 4JI2Q 1NTGA 4DAYB 2CCZA 4A76A 3NBHB 4P74A 4U6RA 5JJLA 2BUSA 4DV5Q 3PUVA 5M5YH 4C3HH 4PZ7A 2AMCB 3GTOH 4A3CH 1CSQA 1EUJA 4DV1Q 3ULPA 1YU6C 4JBMA 2SGPI 1JJ2A 3CXLA 4Y52H 1AH9A 1KQSA 4LFCL 2RF4A 3FHWA 3CCSA 4GI3C 4L5RC 1PFSA 4L5QA 4OONA 4DR6Q 3OYYA 1N36L 4LF7L 2JW6A 2BH2A 1C9OA 3DM3A 2F66B 3U4VA 5DAEA 1BVSA 4C2MH 3PGZA 5IWAQ 5GAGC 5K36G 4DKAC 4A3MG 5IP9H 2ZM6Q 2UXCQ 1PA6A 4NXML 3ULJA 2SGFI 4GKKL 3CAMA 3KF8B 4DV2Q 3RZDH 1RFHA 3FP9A 4IPCA 1UE1A 3AFPA 1EQRA 5FUWA 4DV4L 4A3CG 2JQOA 1VQMA 1K73C 5IYDH 4X66Q 1TWFH 3GO5A 2MNAA 3G6EA 4C3IH 2SGQI 2UXBL 2ZTEA 3K81C 3K7AH 3PCOB 2C35B 1RL2A 1YTPA 2N52A 2VUMG 1SFOH 1N33L 3M4OH 1K83H 1X74A 1YITA 3GDEA 4TQUS 1V1IA 3AQQA 1TUSA 1L2FA 4GN3B 2F3IA 1OXVA 1BBUA 2UUBQ 1YVCA 3M9BA 3A5ZB 2MJFB 3HOWH 4HFVA 2FNFX 1SLJA 2BA0A 3HOVH 3GTPH 3I4OA 1LYLA 3IAS1 2SGDI 4ALPA 2SGEI 5LMNW 2CWPA 1Q1EA 3ERSX 1PJUA 2A19A 1PPFI 3CP0A 4A3FG 4X64L 4UPAA 1SRUA 4IFDG 3WWVA 1SGYI 1NE3A 4LF8L 2ZTCA 2IX0A 2AWOA 2VRWB 4DUZQ 5ELOA 1VQIA 1WYDA 3T1YQ 2Z6KC 2ORWA 1XMOL 1X65A 4A3BG 2ENNA 3IRBA 3HOWG 1PH1A 4JI7Q 3HOVG 4LF4L 5GAEC 1HNZQ 3OL0A 4A3LH 1MJCA 1HZ9A 4PMWA 4POFA 4G76A 3B6YA 4DNIA 4LW1A 1CKOA 3S24A 2IT1A 2IP6A 4PZ8A 4KLKA 4JI6Q 4IJHA 2DB6A 1BUSA 3E59A 4JBKA 2I5MX 1VQOA 4B3SQ 2ORVA 3W1BA 1JT8A 2A2DA 1IY6A 2XGTA 2E5LQ 3RLNA 1LTLA 1EWIA 5IYBH 3KP9A 1A63A 1HNWQ 2PI2A 1SGEI 3E0EA 1TIHA 4B3TL 5FLXc 3GTQH 4C3JH 4A3LG 3BJIA 4GKJQ 4B3MQ 3KF6B 2I5HA 1XNRQ 3HOUH 4IO9A 2UUCL 3AYHB 2VW9A 4NXNL 1W4RA 1L0WA 1YEZA 4JYAL 1WOCA 3CCLA 1Y1VG 3GTGH 1R0RI 3CCEA 3OXGA 3RNUA 2H5XA 1HZAA 2WB1G 1OXSC 1IY5A 1IBLQ 2M5XA 2XMXA 2PNHA 4JC0A 2RHQB 2V1CC 2VQEL 3I56A 4AQYL 1YJ9A 1PYBA 1YZ6A 3S1QH 1QUQB 2DGYA 2VQFL 3UGLA 4UXIA 1JJCB 3GTKH 5C4XH 2L15A 1CKMA 4Y7NH 3ZJYC 2R92H 1SGDI 2EXDA 1KRTA 4KHPQ 3FBVA 4OO1I 3HOUG 1TWAH 1HDLA 4DR7L 1OVOA 4QIWE 1RIPA 4JI1Q 5AJ3L 1WCMH 3A5UA 3W5OA 2ID0A 3M3YH 4LFBQ 2KMQA 1CKNB 1XJVA 2OQKA 3CMEA 1R9TH 2VL6A 1I5FA 1VQAA 4OX9Q 1P16A 1VQPA 5EX3A 2KMPA 2JA9A 1TWHH 4GN4B 3UDIA 5C4XG 1E7ZA 2YFBA 3AJFA 4BY1G 2N49A 1PH5A 1I94L 2F4VL 2LSSA 5LMNQ 4GN5A 4QGUA 2XTQA 2R92G 4Q9VA 2K75A 1IYJB 2ODDA 1VQ8A 2UU9Q 2NVTH 2I5LX 2PMZE 3UE1A 1Y1WH 2WFWA 2R93H 1WCMG 4A3JH 3RLOA 3GTLH 1PVOA 1EOVA 2A20A 4IPDA 4YZCA 2Z6KA 1VQ7A 1KRSA 3CC2A 1FAQA 2YU9H 3I4NH 4JV5Q 4YY3Q 1SROA 2K50A 1S40A 1E3PA 3CCQA 3T1HL 2KCMA 2ES2A 1UEBA 4GOPB 4X65L 3RN2A 2PQAA 5H1SE 4JI5L 4JBJA 5LNK1 1IW4A 2CFMA 2F52A 2ALYB 3LJ1A 4L5TA 2YTYA 3CD6A 1Y1WG 4P71A 5GADC 3M4QA 1NMFA 1UE5A 3E9IA 1NBWA 4A3JG 2MO1A 1LR9A 3STBC 4EQ5A 1VQ4A 4A3EG 1AE3A 1IBML 2CKZB 3TREA 4KHZA 2YTVA 1X9NA 1CE3A 4YZ9A 4LF9Q 2UUAL 3J80i 1EIFA 1VQBA 2QQCA 3TS0A 1NJIC 1SN8A 1AE2A 1DS3I 3CMAA 2K5NA 2KBNA 1HJAI 4JI8L 1XX6A 2J87A 1YJWA 5BR8L 2KENA 1A0IA 1JMCA 2GVIA 1TOTA 1HNXQ 2JZMA 3UGDA 2IY5B 1FJGL 1K8GA 4Z7HA 3F2CA 2WCYA 4YCVA 2P6AC 2ROWA 3VA9A 2N3SA 1X56A 3ER0A 4O1OA 1X3EA 2KCXA 4AH6A 1FL0A 4G75A 1AN1I 4UXJA 2WP8J 4DV1L 2V1CA 4IFDI 1VQDA 3K80C 1X55A 3UDXA 4RG1A 4A3KH 4DR1L 1VQNA 4GXTA 4UP9A 2VUMH 3EIVA 3F4MA 1X6OA 3PIPA 4IFDJ 4HJ9A 2JA8H 4DR6L 4HIKA 1PH3A 4K0KQ 4LF6Q 2E2IH 4DV6Q 3K7UC 1CGJI 2KMOA 2ZM6L 3CC4A 2UXCL 3JSBA 4OWTB 2UXDQ 2ZJRA 4DV2L 3AEVA 2GN5A 4JOIC 3TJQA 2HHHL 2ZTDA 4DR2L 5IT9c 1GO3E 3KY9A 4NXMQ 1CT0I 1UVGA 4IPHA 4A3FH 3KOJA 2V6EA 1TWCH 3F2BA 3UITA 4A3KG 1N9WA 2QQDA 1KC8C 4UY8C 1GVPA 4QY7A 1SE8A 2K9HA 3RU0A 2JA8G 1OXXK 1PH9A 4NV5A 2UXBQ 3G48A 3QWPA 4DV0L 4UP8A 4A3BH 2WAQE 1L1OB 1N33Q 4APVA 3E9HA 3CCUA 3IAM1 3RN5A 4BA1I 3I9V1 1JE5A 1TXYA 2YFAA 3SGBI 4JI3Q 4HJ5A 4DV7L 2E2JH 2KMRA 1QZGA 4JI4L 2B29A 4BXXH 2Q2IA 3ULLA 1PH7A 1IZ6A 1BBWA 2RIOA 1B7YB 4XTCS 2E8GA 2YQPA 1XPUA 3I55A 1E24A 2ELIA 1HR0L 2QPOA 1IXRA 3MEKA 4NPSA 1G6PA 4AS2A 3TEHB 1V43A 1TWGH 3CF5A 3OVOA 1R79A 4O0AA 1YBYA 3HH2C 4X64Q 3KJOA 3DO9A 3BU2A 1HPTA 2YYZA 2IX1A 4HJAA 1JJGA 2MQHA 3UDFA 2B63H 3H15A 2Z0SA 4GNXB 1Q1BA 2QGQA 3JAMi 4DR5L 4JI7L 4L9MA 1GKHA 1HJPA 4IJLA 1TBRR 4JCVE 2JEAI 4LUVA 1ASZA 1YJNA 2GVAA 5M3FG 1K0RA 4BXXG 2E73A 1N34L 1UUCA 2Q2TA 1XMQQ 1X4SA 4JI6L 2K5VA 1VQCA 1Y1VH 1OMTA 4Z7GA 2N78A 3TRZA 4YZDA 2OVOA 4HJ8A 4AS3A 2A1AA 1GD7A 3L0OA 3S1MH 4MTNA 4DAMA 4O2DA 2QQ0A 4YCUA 5IP7G 1N32L 4GS3A 4OWXB 2L8EA 4P72A 3Q8DA 1PTQA 2B63G 1HNWL 3W1GA 2EQSA 4R4CA 4LFAL 4DWLA 1UE6A 3L2PA 1W2BA 2DIPA 4HIDA 2IHEA 1KBEA 3H3VI 1XNRL 5C44H 1J5EL 4YHHQ 3HKZE 4YCWA 2HIXA 4E1PA 4LF5L 3I2ZA 3PDNA 2CJSC 2UUCQ 2GKTI 3UFFA 3M85A 2VS1A 4NXNQ 3J81i 4R1JA 1IBLL 4A3DG 3U50C 2ERWA 1TBOA 3HOXH 2HQLA 2OTLA 4X62L 3HOYH 1SGPI 1QVFA 4GOPC 3KFUA 1M8BA 4BY1H 1TBQR 5FUVA 4PL3A 4BBRH 2VNUD 2VQEQ 4DUYQ 4AQYQ 1Q82C 2OD1A 2N71A 4B3RQ 1CGII 2ZJPA 2NZHA 4KHPL 1XPOA 5C44G 3KLWA 5HY6A 3H3VH 1Y14B 5JEAG 4HEA1 4H02A 3D31A 4A3IH 3D00A 1YIJA 2JK8A 3OTOQ 2Q2HA 1KMAA 4HJ7A 5AJ3Q 5FUXA 4OX9L 5LMUQ 1NUBA 1T9HA 2N8NA 5JJKA 1C0AA 5DLQE 3HOXG 1K3RA 2DUDA 1E1TA 3HOYG 5C0XG 1U5KA 3K0XA 5EAYA 2JJQA 3KF6A 2NN6G 4BBRG 5LMNL 3U58A 5CCLA 5J3BA 2UU9L 2B0UC 4AYBE 3UDGA 2F4VQ 4DR3L 1O7IA 5HGQA 1Q46A 3E2IA 2JA6G 3KDFB 1A8VA 5HQ8A 4A3EH 1X54A 3PIOA 2OWOA 2NVXH 2RCNA 2L7XA 2Y0SE 3H0GH 4A3IG 1XA6A 4DV3L 4I1TA 1XTDA 2VZAA 2JA1A 1XNQQ 3A74A 3GTJH 1QUQA 4FDBA 1SMXA 4DPGA 4B6DA 2P22B 2WAQG 1QVGA 4DK3C 2XTIA 4JV5L 4YY3L 3LGJA 2K19A 1FVIA 4SGBI 2YV5A 4QL5A 2GKVA 3HOZG 1E22A 4LUOA 2PI2E 1UWVA 2E2HH 3CCJA 2GVBA 3T1HQ 2YUUA 1Y8FA 2L1LB 1V1HA 3FKIH 1SR3A 2XRCA 2JEBI 1LM0A 3VDPA 4X65Q 1HR0W 1SGQI 1CKNA 4YWKA 4FKDA 1SJ8A 1OXUA 4JI5Q 3B4VC 4GLAC 3S14H 3D0FA 3HKSA 5JHWC 3S17H 1YHAA 4BBSH 2KHJA 4DR4L 3DA3A 5IYCH 3H0GG 1W3SA 1VQJA 3PO2H 1VQ5A 1EYGA 2NU4I 1MIUA 3CCRA 4JI0L 1CT2I 4GLXA 4OAUC 4AIMA 3S2DH 3VDUA 1OMUA 4J15A 3G4SA 2FUG1 1OTCA 1Z9FA 2K14A 1L1OC 3FKIG 1IBKQ 1HNXL 4OXPA 1Q8KA 1G51A 3BJUA 4JI2L 1YHQA 1PH6A 1CSOI 4DV5L 2V53A 1WI5A 4R4TA 1D8LA 1NMGA 1XBTA 1FJGQ 1TBNA 2JB1A 4BBSG 2R6GA 2B8TA 3TQYA 1IL2A 2ASBA 1Y1BA 3QTLD 5IYCG 3SGQI 5CCMA 3PO2G 2JB2A 2YTXA 4GOPA 4DK6C 3G71A 1HZBA 1CT4I 4LWCA 2VY3A 4KI0A 4A4IA 2EIFA 3PF5A 4DR1Q 1XPRA 4O1PA 1WFQA 4LFCQ 2ENZA 2FXQA 2NU0I 1QVCA 1Q81C 4K0KL 1FGUA 4LF6L 5IWAL 3UEYA 4DV6L 1PHJA 3GD7A 4GNXC 3MXNB 2ZJQA 1N36Q 4LF7Q 3HKZG 2K4KA 4NV2A 1Q12A 2UXDL 4LUZA 1LR8A 2BA1A 1VQLA 1PV4A 4XIGS 4GKKQ 2NVQH 3RLFA 4X66L 5IE8A 2HHHQ 4DV4Q 1P8LA 1BKBA 4DR2Q 4RMFA 1YNXA 1PYSB 4POGA 3CXCA 2BH8A 3P23A 2F3CI 2D0PA 3F8TA 5M5XH 1I6HH 1Z47A 2HIVA 1PTRA 3CW2C 4X6AH 4IPGA 4JG2A 2UUBL 5IY0A 3J81c 1Q7YC 4BY7H 1K9MC 5GQOA 1CSPA 4DV0Q 3NEMA 4JI3L 4HIMA 1UE7A 5M3FH 2J9RA 3UE0A 2R7ZH 3S15H 5IP9G 4UXHA 2JAEA 3FC3A 1KIXA 2JE6I 1VQFA 3U4ZA 3CQZH 1M90C 1ASYA 1VQKA 4DV7Q 4JI4Q 3NELA 1MJEA 1M8CA 3I4MH 2E5RA 3OXFA 3M4PA 5M3MH 1X3FA 2LXJA 1A62A 5IYDG 1V9PA 4OAVB 1S72A 4A93H 1HR0Q 5IP7H 4DUZL 3TS2A 3BZKA 3T1YL 1CUKA 2RHSB 1KHIA 3J7A5 4BY7G 4LF8Q 4AYBG 2KKMA 5FUYA 3K8AA 2OQ0A 3CCVA 1PH2A 3SDJA 1XMOQ 1B8AA 2AWNA 1HNZL 1TURA 2Y0SG 2R7ZG 3RZOH 3PSIA 2CQOA 2HT1A 4DR5Q 2D0OA 4LF4Q 4TVAB 3HFZB 2JB3A 1YHBA 3I4MG 5GROA 1VQ9A 5M3MG 1XMQL 1PCEA 3CC7A 3PUXA 5JEAJ 3KJPA 1SGNI 2A8VA 1QZHA 4B3SL 2Q2UA 1YI2A 1L1OA 1N34Q 4A3DH 4A93G 2LEOA 1HH2P 2CAZB 5C0XI 2E5LL 4R4IA 2NN6I 2F6MB 2LXKA 2MO0A 4MNOA 1N32Q 5C0XJ 1OXTA 4LNQA 1B70B 1EQQA 3F2DA 4QJFA 1FYBA 4R4OA 3S1RH 3M7NA 1C7YA 4GKJL 4B3ML 5FLMH 4A75A 4GLVB 1SGRI 4B3TQ 4YHHL 4IOAA 1VDDA 4QQBX 4LFAQ 3NENA 1DS2I 3A0JA 1KD1C 4NB3A 5M5WH 4E1RA 1J5EQ 2OCEA 3BZCA 4A24A 3PUWA 1N8RC 4LF5Q 4L5SA 2AHOB 4YWLA 4JYAQ 2K5HA 4GNXA 3J80c 2ZRRA 2LUYA 4P73A 3DLLA 2QQEA 2JYYA 4JOIA 4HIOA 1J6QA 4UP7A 3CPWA 1N13A 2N1AB 1LUZA 4JBWA 4DUYL 1NY4A 1GM5A 1G291 4X62Q 3S2HH 2ARPF 5FJ8H 2VQFQ 4B3RL 2CWAA 3I7FA 2WVJA 3EBEA 3J81j 5FLMG 5IYBG 5JJIA 1K8AC 4PG3A 4JI1L 2JA6H 2AKWB 4LFBL 2B3GA 3VDYA 3ICEA 2NZOA 1PH4A 1VQGA 2A2CA 3DA4A 2R7FA 2PQAB 2N17A 4DR7Q 4PZ6A 3VE5A 2KHIA 3OTOL 5LMUL 5C3EH 3SGIA 1DGSA 3PUZA 4BA2I 3RR5A 3HOZH 1EIYB 4R4QA 2QA4A 1I3QH 3MEFA 5FJ8G 3OW2A 2QEXA 4IOCA 1I94Q 2JA7H 3STBD 1I50H 4OVOA 5ELNA 3CCMA 3UEJA 3PF4A 4A3GH 1EFWA 1VQ6A 2JXDA 1VS0A 4DR3Q 4OWWB 1UVFA 1MKHA 1XNQL 1Q86C 3PV0A 1M1KC 5C3EG 3PUYA 2MFIA 3S16H 4ME3A 2NVYH 1D7QA 4DV3Q 1MT1A 5HI7A 1CHOI 4PL5A 1VQHA 1FARA 5EX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC Q;  1WFQ A;  4JC0 A;  2ATW A;  2RHQ B;  2FXQ A;  2YYZ A;  2V1C C;  1QVC A;  3L7Z C;  2VQE L;  1U0L A;  3I56 A;  1Q81 C;  2IX1 A;  4K0K L;  4AQY L;  4HJA A;  1JJG A;  1FGU A;  2R7D A;  1YJ9 A;  1E1O A;  1PYB A;  3PO3 H;  2MQH A;  1YZ6 A;  4LF6 L;  2IHF A;  3S1Q H;  5IWA L;  1QUQ B;  2DGY A;  3UDF A;  2VQF L;  1JJC B;  4DV6 L;  1PHJ A;  3KYH C;  3GTK H;  3GD7 A;  5C4X H;  1PH8 A;  2B63 H;  3H15 A;  4GNX C;  3MXN B;  2Z0S A;  2L15 A;  2ZJQ A;  4GNX B;  3AFQ A;  5GAH C;  1N36 Q;  3HKZ G;  4LF7 Q;  1Q1B A;  2K52 A;  2JA5 H;  2K4K A;  2QGQ A;  2JA7 G;  3JAM i;  1V1Q A;  1VCI A;  1CKM A;  4DR5 L;  4JI7 L;  1Q12 A;  1GKH A;  4Y7N H;  1HJP A;  4IJL A;  2UXD L;  1KAW A;  3ZJY C;  4JCV E;  2JEA I;  4LUZ A;  2R92 H;  4LUV A;  3HOV G;  2EXD A;  1ASZ A;  2BA1 A;  1KRT A;  1YJN A;  2GVA A;  5M3F G;  1K0R A;  1WJJ A;  4A3G G;  3GTM H;  1VQL A;  4KHP Q;  4OO1 I;  3HOU G;  1TWA H;  4BXX G;  1PV4 A;  4DR7 L;  4XIG S;  4GKK Q;  1KL9 A;  4QIW E;  1HZC A;  1RIP A;  4LF9 L;  2NVQ H;  3RLF A;  4X66 L;  4JI1 Q;  2I0Q A;  3CPF A;  4OO1 G;  2OTJ A;  5IE8 A;  2HHH Q;  5AJ3 L;  2R93 G;  1WCM H;  3A5U A;  4DV4 Q;  3W5O A;  1P8L A;  4YWM A;  1BKB A;  2ID0 A;  1N34 L;  1VQE A;  4DR2 Q;  3M3Y H;  4LFB Q;  2Q2T A;  1XMQ Q;  1KXL A;  4JI6 L;  3J7Z C;  1CKN B;  1IBM Q;  2K5V A;  4RMF A;  1VQC A;  1YNX A;  1Y1V H;  1PYS B;  1XJV A;  4DR4 Q;  2N78 A;  4POG A;  3TRZ A;  2D62 A;  2OQK A;  3CME A;  1R9T H;  3CXC A;  4HJ8 A;  2VL6 A;  1H95 A;  2BH8 A;  3F1Z A;  2UUA Q;  2A1A A;  2D0P A;  1GD7 A;  1I5F A;  3F8T A;  1VQA A;  3L0O A;  4OX9 Q;  3S1M H;  4MTN A;  4DAM A;  5M5X H;  1I6H H;  4O2D A;  1Z47 A;  1P16 A;  2HIV A;  3CW2 C;  4YCU A;  5IP7 G;  1VQP A;  1N32 L;  4GS3 A;  4OWX B;  1JB7 A;  4X6A H;  4JI0 Q;  4P72 A;  3I4N G;  4IPG A;  4EX5 A;  2JA9 A;  5C4J H;  4JG2 A;  1TWH H;  2UUB L;  3Q8D A;  4P75 A;  3PO3 G;  5IY0 A;  4GN4 B;  3J81 c;  1Q7Y C;  4JI8 Q;  3UDI A;  1IBK L;  4BY7 H;  5C4X G;  3KDF A;  1E7Z A;  1S3O A;  2B63 G;  2WB1 E;  4BY1 G;  2N49 A;  2JA5 G;  5BR8 Q;  1HNW L;  3W1G A;  1PH5 A;  1K9M C;  1I94 L;  2EQS A;  2LSS A;  5LMN Q;  4GN5 A;  3JC6 6;  5GQO A;  4R4C A;  4QGU A;  3S1N H;  4WJ4 A;  4MZ9 A;  1CSP A;  4DV0 Q;  2R92 G;  2K75 A;  3EN2 A;  3NEM A;  5E7N A;  4LFA L;  4JI3 L;  1UE6 A;  4HIM A;  3L2P A;  1W2B A;  1IYJ B;  1UE7 A;  1VQ8 A;  4HID A;  2UU9 Q;  5M3F H;  1X3G A;  2IHE A;  4WJ3 M;  2KCT A;  2I5L X;  3UE0 A;  2NVT H;  4A3M H;  3JAM c;  4JI2 Q;  3H3V I;  1NTG A;  2PMZ E;  5IP9 G;  2R7Z H;  4DAY B;  3S15 H;  3UE1 A;  1XNR L;  1Y1W H;  2CCZ A;  5C44 H;  4A76 A;  2WFW A;  1J5E L;  1KIX A;  3NBH B;  2JE6 I;  1VQF A;  3U4Z A;  4YHH Q;  3CQZ H;  4P74 A;  3HKZ E;  1M90 C;  1ASY A;  5JJL A;  4YCW A;  2HIX A;  4DV5 Q;  1VQK A;  3PUV A;  5M5Y H;  4DV7 Q;  2R93 H;  1WCM G;  4C3H H;  4A3J H;  4LF5 L;  3RLO A;  4JI4 Q;  3NEL A;  1MJE A;  3GTL H;  3I2Z A;  4PZ7 A;  3I4M H;  2AMC B;  3GTO H;  3M4P A;  5M3M H;  4A3C H;  1PVO A;  1X3F A;  1CSQ A;  2LXJ A;  1EOV A;  2UUC Q;  1A62 A;  1EUJ A;  4DV1 Q;  3ULP A;  3M85 A;  5IYD G;  4JBM A;  2VS1 A;  4IPD A;  2Z6K A;  1V9P A;  4NXN Q;  3J81 i;  1JJ2 A;  4R1J A;  1VQ7 A;  1KRS A;  1IBL L;  1S72 A;  4Y52 H;  4A3D G;  3CC2 A;  1AH9 A;  4A93 H;  3U50 C;  5IP7 H;  4DUZ L;  1HR0 Q;  1KQS A;  3TS2 A;  3BZK A;  3T1Y L;  2YU9 H;  4LFC L;  2RF4 A;  1CUK A;  3FHW A;  1SRO A;  4YY3 Q;  3I4N H;  4JV5 Q;  2K50 A;  1S40 A;  2RHS B;  1E3P A;  3HOX H;  3CCQ A;  2HQL A;  3CCS A;  3T1H L;  2OTL A;  1KHI A;  4X62 L;  2KCM A;  3J7A 5;  3HOY H;  2ES2 A;  4BY7 G;  4LF8 Q;  4AYB G;  4L5R C;  1PFS A;  4L5Q A;  4OON A;  4GOP C;  1UEB A;  1QVF A;  4GOP B;  3KFU A;  4X65 L;  4BY1 H;  4DR6 Q;  3OYY A;  1N36 L;  4LF7 L;  3K8A A;  3RN2 A;  2OQ0 A;  2PQA A;  4BBR H;  2VNU D;  2VQE Q;  4DUY Q;  5H1S E;  3CCV A;  1PH2 A;  1XMO Q;  2BH2 A;  1B8A A;  1C9O A;  4JI5 L;  4JBJ A;  2AWN A;  3DM3 A;  4AQY Q;  1Q82 C;  3U4V A;  1BVS A;  4B3R Q;  4C2M H;  3PGZ A;  2CFM A;  5IWA Q;  1HNZ L;  5GAG C;  2F52 A;  5K36 G;  4DKA C;  4A3M G;  2Y0S G;  2ZJP A;  5IP9 H;  2ZM6 Q;  2ALY B;  2R7Z G;  3RZO H;  3PSI A;  4L5T A;  2UXC Q;  2NZH A;  1PA6 A;  4KHP L;  2CQO A;  2YTY A;  1Y1W G;  1XPO A;  5C44 G;  3KLW A;  4NXM L;  3ULJ A;  2HT1 A;  3CD6 A;  4DR5 Q;  4P71 A;  4GKK L;  3CAM A;  3KF8 B;  5GAD C;  2D0O A;  4DV2 Q;  4TVA B;  3RZD H;  3M4Q A;  4LF4 Q;  5HY6 A;  1NMF A;  3H3V H;  1UE5 A;  3FP9 A;  3HFZ B;  4IPC A;  3E9I A;  1Y14 B;  1YHB A;  1NBW A;  1UE1 A;  3AFP A;  1EQR A;  5JEA G;  4A3J G;  2MO1 A;  4DV4 L;  3STB C;  4EQ5 A;  3I4M G;  1VQ4 A;  5GRO A;  4A3E G;  1AE3 A;  1VQ9 A;  5M3M G;  1XMQ L;  4A3C G;  1IBM L;  2CKZ B;  2JQO A;  3D31 A;  3PUX A;  4H02 A;  5JEA J;  3TRE A;  3KJP A;  3CC7 A;  1VQM A;  2A8V A;  4KHZ A;  2YTV A;  4A3I H;  1QZH A;  1YIJ A;  1K73 C;  5IYD H;  1XPR A;  2JK8 A;  1X9N A;  3OTO Q;  4LF9 Q;  4X66 Q;  1TWF H;  2Q2H A;  3GO5 A;  2Q2U A;  4B3S L;  2MNA A;  2UUA L;  3J80 i;  4HJ7 A;  1YI2 A;  5AJ3 Q;  1EIF A;  1L1O A;  1N34 Q;  1VQB A;  3G6E A;  4OX9 L;  5LMU Q;  4A3D H;  4A93 G;  4C3I H;  3TS0 A;  1T9H A;  1NJI C;  2UXB L;  1HH2 P;  1SN8 A;  1AE2 A;  2ZTE A;  3K81 C;  5C0X I;  2N8N A;  3K7A H;  3PCO B;  3CMA A;  2C35 B;  5DLQ E;  2E5L L;  1C0A A;  5JJK A;  3HOX G;  1RL2 A;  2K5N A;  4R4I A;  2VUM G;  1SFO H;  2KBN A;  1K3R A;  1N33 L;  3M4O H;  2NN6 I;  2DUD A;  1E1T A;  4JI8 L;  3HOY G;  5C0X G;  1U5K A;  1K83 H;  1YIT A;  3K0X A;  3GDE A;  4TQU S;  2JJQ A;  2LXK A;  2MO0 A;  5EAY A;  3AQQ A;  3KF6 A;  4MNO A;  1YJW A;  1L2F A;  4GN3 B;  2F3I A;  2NN6 G;  4BBR G;  5BR8 L;  1N32 Q;  2KEN A;  1OXT A;  5C0X J;  5LMN L;  4LNQ A;  1B70 B;  1OXV A;  1EQQ A;  3F2D A;  1BBU A;  1A0I A;  4QJF A;  1JMC A;  2UUB Q;  4R4O A;  3U58 A;  5J3B A;  1HNX Q;  1YVC A;  3M9B A;  3A5Z B;  3S1R H;  3M7N A;  1C7Y A;  4GKJ L;  2UU9 L;  2IY5 B;  1FJG L;  1K8G A;  4B3M L;  5FLM H;  3F2C A;  4A75 A;  3HOW H;  4AYB E;  3UDG A;  4YCV A;  4GLV B;  2F4V Q;  4DR3 L;  1O7I A;  5HGQ A;  1SLJ A;  4B3T Q;  2BA0 A;  4YHH L;  2N3S A;  1Q46 A;  3HOV H;  4IOA A;  1X56 A;  3ER0 A;  4QQB X;  4LFA Q;  3GTP H;  3I4O A;  3NEN A;  1X3E A;  2JA6 G;  3A0J A;  3KDF B;  1A8V A;  1LYL A;  1KD1 C;  4NB3 A;  4AH6 A;  4ALP A;  4A3E H;  1X54 A;  5M5W H;  1FL0 A;  3PIO A;  2OWO A;  2NVX H;  2RCN A;  1J5E Q;  2OCE A;  2Y0S E;  5LMN W;  3BZC A;  3H0G H;  4A3I G;  2CWP A;  2WP8 J;  4DV1 L;  1Q1E A;  4DV3 L;  1XTD A;  3ERS X;  2VZA A;  4IFD I;  2A19 A;  3CP0 A;  3PUW A;  4A3F G;  1N8R C;  1XNQ Q;  3A74 A;  1VQD A;  3K80 C;  4LF5 Q;  3GTJ H;  4L5S A;  1QUQ A;  1X55 A;  2AHO B;  4FDB A;  4RG1 A;  3UDX A;  4X64 L;  1SMX A;  4DPG A;  4DR1 L;  4YWL A;  4A3K H;  1VQN A;  4JYA Q;  4UPA A;  1SRU A;  2K5H A;  4GNX A;  4IFD G;  2WAQ G;  1QVG A;  4DK3 C;  2XTI A;  4JV5 L;  4UP9 A;  4YY3 L;  3WWV A;  3LGJ A;  3J80 c;  1FVI A;  2VUM H;  3EIV A;  4P73 A;  3DLL A;  2YV5 A;  1X6O A;  4QL5 A;  3PIP A;  4IFD J;  4JOI A;  4HJ9 A;  2JA8 H;  4HIO A;  1NE3 A;  1J6Q A;  4UP7 A;  4LF8 L;  2F4V L;  2ZTC A;  2IX0 A;  2AWO A;  3CPW A;  4DR6 L;  4DUZ Q;  3HOZ G;  5ELO A;  1E22 A;  4LUO A;  2PI2 E;  1UWV A;  1VQI A;  1WYD A;  4HIK A;  3T1Y Q;  2Z6K C;  3CCJ A;  1PH3 A;  2E2H H;  4K0K Q;  1LUZ A;  4JBW A;  4DUY L;  2GVB A;  1XMO L;  3T1H Q;  1NY4 A;  1GM5 A;  1X65 A;  1G29 1;  4X62 Q;  4LF6 Q;  4A3B G;  3S2H H;  3FKI H;  1SR3 A;  5FJ8 H;  2VQF Q;  2E2I H;  4B3R L;  4DV6 Q;  2JEB I;  3K7U C;  2CWA A;  3I7F A;  1LM0 A;  3EBE A;  4X65 Q;  3J81 j;  5FLM G;  3IRB A;  2ZM6 L;  5IYB G;  1HR0 W;  1PH1 A;  3CC4 A;  4JI7 Q;  3HOW G;  2UXC L;  1CKN A;  5JJI A;  1K8A C;  4YWK A;  4OWT B;  2UXD Q;  2ZJR A;  1OXU A;  4DV2 L;  4PG3 A;  5GAE C;  2GN5 A;  4JI5 Q;  4GLA C;  4JOI C;  4JI1 L;  4LF4 L;  2JA6 H;  3AEV A;  3S14 H;  2AKW B;  2HHH L;  3D0F A;  3HKS A;  1HNZ Q;  2ZTD A;  4DR2 L;  4A3L H;  4LFB L;  1MJC A;  2B3G A;  3VDY A;  1HZ9 A;  3ICE A;  3S17 H;  4PMW A;  1YHA A;  2NZO A;  1VQG A;  4POF A;  5IT9 c;  1PH4 A;  4BBS H;  2R7F A;  2PQA B;  1GO3 E;  2KHJ A;  4DR4 L;  3B6Y A;  4DR7 Q;  4PZ6 A;  4DNI A;  4LW1 A;  4NXM Q;  5IYC H;  3H0G G;  4IPH A;  1CKO A;  3S24 A;  2IT1 A;  2KHI A;  1W3S A;  1VQJ A;  3OTO L;  4A3F H;  3PO2 H;  1VQ5 A;  4PZ8 A;  3KOJ A;  1EYG A;  4KLK A;  1TWC H;  3F2B A;  1MIU A;  5LMU L;  4JI6 Q;  4A3K G;  5C3E H;  3SGI A;  1N9W A;  3CCR A;  4IJH A;  1KC8 C;  4UY8 C;  1DGS A;  4JI0 L;  1GVP A;  4JBK A;  4QY7 A;  1SE8 A;  2I5M X;  1VQO A;  4GLX A;  3PUZ A;  4B3S Q;  4BA2 I;  2JA8 G;  4AIM A;  1OXX K;  1PH9 A;  3S2D H;  3RR5 A;  3W1B A;  1JT8 A;  3HOZ H;  4J15 A;  3G4S A;  1EIY B;  4R4Q A;  2UXB Q;  2XGT A;  3G48 A;  2QA4 A;  2E5L Q;  3RLN A;  1OTC A;  1I3Q H;  4DV0 L;  3MEF A;  1Z9F A;  4UP8 A;  2K14 A;  4A3B H;  1L1O C;  3FKI G;  2WAQ E;  1LTL A;  1L1O B;  5FJ8 G;  4APV A;  1IBK Q;  4OXP A;  3E9H A;  3CCU A;  1HNX L;  1N33 Q;  3OW2 A;  1Q8K A;  1G51 A;  1EWI A;  3RN5 A;  3BJU A;  4JI2 L;  4BA1 I;  1YHQ A;  5IYB H;  1A63 A;  2QEX A;  1HNW Q;  4IOC A;  1I94 Q;  1PH6 A;  2JA7 H;  3STB D;  2PI2 A;  1JE5 A;  1I50 H;  1TXY A;  3E0E A;  4B3T L;  4JI3 Q;  4HJ5 A;  4DV5 L;  4DV7 L;  5ELN A;  3CCM A;  5FLX c;  3GTQ H;  4C3J H;  1WI5 A;  4R4T A;  2E2J H;  1D8L A;  1QZG A;  4JI4 L;  1NMG A;  4A3L G;  4GKJ Q;  3PF4 A;  1FJG Q;  4B3M Q;  4A3G H;  3KF6 B;  1EFW A;  4BBS G;  2R6G A;  2B29 A;  2I5H A;  1VQ6 A;  1XNR Q;  3TQY A;  1IL2 A;  2ASB A;  3HOU H;  4IO9 A;  2UUC L;  3AYH B;  1VS0 A;  2Q2I A;  3ULL A;  4BXX H;  5IYC G;  4DR3 Q;  1PH7 A;  1IZ6 A;  4OWW B;  1BBW A;  1MKH A;  2VW9 A;  1B7Y B;  4NXN L;  4XTC S;  3PO2 G;  2E8G A;  2YTX A;  1XNQ L;  1Q86 C;  1XPU A;  3I55 A;  1E24 A;  3PV0 A;  5C3E G;  1M1K C;  3PUY A;  1HR0 L;  4GOP A;  1L0W A;  4DK6 C;  1YEZ A;  1IXR A;  2MFI A;  1WOC A;  3G71 A;  3CCL A;  4JYA L;  4NPS A;  3S16 H;  4ME3 A;  1G6P A;  1Y1V G;  1HZB A;  4LWC A;  2NVY H;  3GTG H;  1D7Q A;  3TEH B;  2VY3 A;  3CCE A;  1V43 A;  1TWG H;  3CF5 A;  4DV3 Q;  3RNU A;  2H5X A;  4KI0 A;  1HZA A;  2WB1 G;  1OXS C;  1VQH A;  4O0A A;  4A4I A;  1IBL Q;  1YBY A;  2EIF A;  4X64 Q;  3KJO A;  3PF5 A;  2PNH A;  4DR1 Q;  3BU2 A; 
#chains in the Genus database with same CATH topology
 2ATW A;  1ILQ A;  3L7Z C;  3U9S A;  3IL8 A;  1U0L A;  5D3I B;  3UGI A;  2R7D A;  3PIO 3;  1E1O A;  1TGS I;  3PO3 H;  1KBF A;  2IHF A;  4PV1 C;  3IFD A;  4JK1 C;  1YNJ D;  1QIL A;  1H0Z A;  3DWA A;  2QKI C;  4EQN A;  3KYH C;  1B9N A;  1PH8 A;  2D9U A;  4PMB A;  4EQO A;  3SEK C;  3AFQ A;  1DOM A;  5GAH C;  4ZKB B;  2K52 A;  2JA5 H;  2JA7 G;  3SVM A;  5G3L F;  1V1Q A;  1VCI A;  2WKC A;  1WGT A;  1LR7 A;  3TOB A;  1KAW A;  1G2S A;  1H9S B;  2KEE A;  2RSN A;  2ZT9 C;  3G7L A;  3OWF A;  1JQO A;  1WJJ A;  5HGI A;  4A3G G;  3GTM H;  2UZ3 A;  1EEF D;  5CR3 A;  4ZCK A;  2NU3 I;  1IKL A;  2WKD A;  3NE5 B;  5JVH 3;  1KL9 A;  1S5E D;  1HZC A;  3BYT B;  4HMJ A;  1Z2I A;  2F3V A;  4LF9 L;  3L0I A;  1YO7 A;  2I0Q A;  3CPF A;  4OO1 G;  2OTJ A;  5C6A A;  2R93 G;  1Y1C A;  4YWM A;  1VQE A;  1KXL A;  3J7Z C;  1IBM Q;  4DR4 Q;  4IUN A;  2D62 A;  3GOX A;  2KA7 A;  3S9W A;  1H95 A;  2QEJ C;  2NU2 I;  3F1Z A;  2UUA Q;  4PL4 A;  2GKR I;  1Z7K B;  1NAP A;  3I91 A;  1I6V C;  1MSH A;  1BMO A;  1OYV I;  1KAB A;  4KD4 A;  1RHP A;  4RAU C;  3LJ0 A;  4V19 0;  3OPO A;  3Q6S A;  1JB7 A;  1C48 A;  3VR2 A;  4JI0 Q;  3I4N G;  1GUO A;  1SE3 A;  4EX5 A;  5C4J H;  2NU1 I;  4P75 A;  3T51 B;  3PO3 G;  4JI8 Q;  5EGT A;  1IBK L;  2ZXO A;  4BWG B;  3KDF A;  1S3O A;  4O1N A;  3LJ2 A;  2WB1 E;  4HSV A;  2Z9H A;  1AZQ A;  2JA5 G;  2RCF A;  5BR8 Q;  1LLR D;  2NBF A;  5JJZ A;  2BE5 C;  4WJ4 A;  3JC6 6;  1BCP D;  3S1N H;  4MZ9 A;  1JWS D;  3EN2 A;  5E7N A;  2W0T A;  4HGU A;  2XTR A;  1FGB D;  1X3G A;  1WTX A;  2KCT A;  4WJ3 M;  5K36 H;  2PO4 A;  3ERQ A;  3OXL A;  4A3M H;  3JAM c;  4JI2 Q;  1NTG A;  4EQP A;  4FXD A;  4H7B A;  4DAY B;  3EJI A;  2CCZ A;  2Z4H A;  4A76 A;  3NBH B;  4P74 A;  2E2D C;  4U6R A;  2Q8T A;  5JJL A;  2BUS A;  4DV5 Q;  3PUV A;  5M5Y H;  4C3H H;  4H13 C;  3HEJ A;  5I9O A;  4PZ7 A;  2AMC B;  4MN3 A;  3GTO H;  2QW7 A;  4A3C H;  1M4V A;  1CSQ A;  2F3W A;  5ELC A;  2K05 A;  4A3K B;  1EUJ A;  4DV1 Q;  3ULP A;  4ZK9 B;  1YU6 C;  5IOC A;  4JBM A;  1JCK B;  2SGP I;  5DEH A;  3GP7 A;  1NUC A;  4KN7 C;  1JJ2 A;  2L5T A;  3MC0 B;  1SNQ A;  2VUM B;  3CXL A;  3U9O A;  2AUK A;  4G7Z C;  4Y52 H;  1AH9 A;  2JA8 B;  3BDL A;  4LJZ C;  2NTT A;  1KQS A;  3GQB A;  4LFC L;  2RF4 A;  3FHW A;  5KGU A;  4WRD A;  3CCS A;  1LT4 D;  1RCV D;  4GI3 C;  4L5R C;  1PFS A;  4L5Q A;  4OON A;  3IFT A;  3KK7 A;  5I6W A;  4DR6 Q;  4Q0F A;  2E2I B;  2SEB D;  3OYY A;  1N36 L;  4LF7 L;  1IW7 D;  2JW6 A;  1TVX A;  1LT5 D;  2BH2 A;  1C9O A;  3DM3 A;  2F66 B;  4RFB A;  1LTB D;  3U4V A;  5DAE A;  1BVS A;  4C2M H;  3PGZ A;  5IWA Q;  1JWU D;  5GAG C;  3J7A F;  5K36 G;  4K8J A;  4C56 C;  4DKA C;  4A3M G;  5IP9 H;  3PIP 3;  2ZM6 Q;  1A3U A;  2UXC Q;  1PA6 A;  1JWM D;  1SBB B;  4NXM L;  3ULJ A;  5KYI A;  5JAV A;  2SGF I;  4GKK L;  3CAM A;  3KF8 B;  4DV2 Q;  3RZD H;  1RFH A;  3FP9 A;  4IPC A;  4C3H G;  1EY6 A;  1UE1 A;  3AFP A;  1EQR A;  4DAP A;  1HHV A;  5FUW A;  3NTK A;  4DV4 L;  4A3F B;  4A3C G;  1ULN A;  1ZXT A;  3MAQ A;  1W6J A;  2JQO A;  1TWC B;  1VQM A;  1SEB D;  3VA7 A;  3V96 A;  4DU9 A;  2NTS A;  1K73 C;  5IYD H;  3W3A A;  2TSS A;  3SE0 A;  4X66 Q;  1TWF H;  3GO5 A;  5C4H A;  2MNA A;  1ET9 A;  2Z6B A;  4RGM A;  2PZU A;  3G6E A;  3N52 A;  2B8G A;  4C3I H;  2SGQ I;  2RVL A;  2UXB L;  1K83 B;  2ZTE A;  3K81 C;  2QGM A;  4IFD H;  3K7A H;  3PCO B;  2C35 B;  1RL2 A;  1YTP A;  2N52 A;  2VUM G;  1SFO H;  3DEP A;  1N33 L;  3M4O H;  3BS1 A;  2F0H A;  4CKC A;  4A3B B;  3SHL A;  1K83 H;  1X74 A;  1YIT A;  2FHT A;  3FSY A;  1RJT A;  3GDE A;  4TQU S;  1V1I A;  3AQQ A;  1TUS A;  1QNK A;  3H94 A;  3J80 E;  1L2F A;  4GN3 B;  2F3I A;  1AFP A;  1OXV A;  1BBU A;  2UUB Q;  1YVC A;  3M9B A;  3A5Z B;  1S5C D;  1WD0 A;  2MJF B;  2HQE A;  2E2J B;  2KEC A;  3HOW H;  7WGA A;  3J81 L;  5E4X A;  4HFV A;  2FNF X;  3PMF A;  1SLJ A;  4G57 A;  2BA0 A;  3HOV H;  3GTP H;  2B2Y A;  3I4O A;  5FO9 B;  1LYL A;  5JPN C;  3IAS 1;  2SGD I;  1LTA D;  4ALP A;  1F9S A;  1HA5 A;  2KQ3 A;  2SGE I;  2K7V A;  3MXG A;  3OSO A;  1MJB A;  2EE1 A;  5LMN W;  1V1P B;  2CWP A;  1Q1E A;  3ERS X;  1PJU A;  1HQM C;  4IUV A;  2A19 A;  3GV3 A;  1PPF I;  3CP0 A;  4A3F G;  2BL7 A;  1TWG B;  5E3F A;  3OIQ A;  4X64 L;  1WKX A;  4C3I G;  2F0N A;  2ENB A;  4KJO A;  4ABN A;  3MXN A;  4UPA A;  1SRU A;  2B39 A;  4IFD G;  2XVS A;  3WWV A;  1SGY I;  3DUZ A;  1VMP A;  4G4K A;  1NE3 A;  4LF8 L;  2Z8L A;  2ZTC A;  3K5O A;  2IX0 A;  1BR9 A;  2AWO A;  2VRW B;  4DUZ Q;  1K7V A;  1UEA B;  5ELO A;  5CGK A;  1VQI A;  1WYD A;  4QB4 A;  3T1Y Q;  2B63 B;  2Z6K C;  1EYD A;  2ORW A;  1VMC A;  1XMO L;  1X65 A;  1EIH A;  4A3B G;  3ERO A;  1NR4 A;  2CW0 D;  3WDN A;  5J1Z A;  1F77 A;  2ENN A;  3IRB A;  1YNN C;  3HOW G;  1PH1 A;  4JI7 Q;  2G5D A;  1PFM A;  2FMM A;  3HOV G;  4LF4 L;  5GAE C;  4RA8 A;  1VF5 C;  1HNZ Q;  3OL0 A;  4A3L H;  2Z1C A;  1MJC A;  1LTT D;  1HZ9 A;  4KY5 A;  4PMW A;  1BCP B;  4G76 A;  4POF A;  2HCC A;  2AQ3 B;  5JPM C;  1QG7 A;  2XNA C;  3B6Y A;  4Z9C B;  4DNI A;  4LW1 A;  2VB3 X;  4J8Q A;  5COY A;  1CKO A;  3S24 A;  2IT1 A;  4H0L C;  1Y1V B;  4CKB A;  3QAH A;  2A5H A;  2EY6 A;  2IP6 A;  3FPU B;  4PZ8 A;  4KLK A;  5I6Y A;  3KLS A;  1TQO A;  1IKM A;  4JI6 Q;  3SK5 A;  4IJH A;  2DB6 A;  1BUS A;  3S1M B;  2X6L A;  3E59 A;  5EPK A;  1JOO A;  4JBK A;  2I5M X;  2SOB A;  1EY5 A;  1VQO A;  4B3S Q;  4EVO A;  4DN4 M;  2QF7 A;  2ORV A;  1CHQ D;  2NZ1 D;  3W1B A;  4FP5 D;  4LK1 C;  1JT8 A;  2N55 A;  5DAU A;  3K5N A;  2A2D A;  4PNY A;  1IY6 A;  2XGT A;  2E5L Q;  3RLN A;  2MPM A;  1LTS D;  2F1M A;  4HR7 B;  1LTL A;  4DNC A;  3IAY A;  2FIN B;  1EWI A;  4M1U B;  1QNU A;  5IYB H;  3KP9 A;  1A63 A;  2EYH A;  1HNW Q;  1G2T A;  2PI2 A;  1SGE I;  1DYQ A;  4G7H C;  3E0E A;  1TIH A;  4B3T L;  2PYK A;  1BDO A;  5C44 B;  1AEX A;  2F4I A;  4PQX A;  2A68 C;  5FLX c;  3GTQ H;  4C3J H;  2R61 A;  4A3L G;  3BJI A;  4GKJ Q;  4B3M Q;  3KF6 B;  1PXU A;  5LL6 S;  1RKN A;  2I5H A;  3A7A B;  1XNR Q;  3QOJ A;  3HOU H;  4IO9 A;  2UUC L;  3AYH B;  1L0X B;  2VW9 A;  1PRT C;  4CKE A;  4NXN L;  4FO2 A;  3G6J B;  1ONL A;  1W4R A;  2A69 C;  3EVQ A;  3MXU A;  2RKS A;  1L0W A;  2WAC A;  1SJH D;  1YEZ A;  4HCE A;  1WOC A;  3CCL A;  2NUC A;  4JYA L;  1Y1V G;  2F0F A;  2F0T A;  3GTG H;  2KUM A;  2G9H D;  1CQF A;  3CCE A;  1R0R I;  2D5D A;  3OXG A;  3RNU A;  2H5X A;  3NP8 A;  1HZA A;  4NKL A;  3DXJ C;  2WB1 G;  1OXS C;  2F0K A;  1IY5 A;  2F0J A;  1IBL Q;  2XSC A;  1WTQ A;  2M5X A;  1JOQ A;  5JOB A;  1CA6 A;  1ZYR D;  2XMX A;  1PYW D;  2FFK B;  3HOY B;  2PNH A;  1A6X A;  2K01 A;  1K8M A;  4JC0 A;  2RHQ B;  2V1C C;  2KVM A;  2VQE L;  4BY1 B;  3I56 A;  3P75 A;  5L37 A;  4AQY L;  1U9R A;  1YJ9 A;  1PYB A;  1YZ6 A;  3S1Q H;  4E6I A;  1QUQ B;  2DGY A;  2VQF L;  3UGL A;  1BOS A;  4UXI A;  2RQX A;  1JJC B;  3GTK H;  1S5F D;  1SND A;  5C4X H;  4K2K A;  2ZXR A;  2B2V C;  2L15 A;  2LKV A;  3J80 L;  2DKV A;  3FMC A;  5CV4 A;  1CKM A;  4DXF A;  4Y7N H;  1UAP A;  2K1B A;  3ZJY C;  2R92 H;  4WP4 A;  1SGD I;  2EXD A;  2CHB D;  3SDZ A;  4C3J G;  1KRT A;  5EKI A;  3M4Y A;  4KHP Q;  3FBV A;  3H09 A;  4OO1 I;  3HOU G;  1TWA H;  1HDL A;  2GSC A;  2EYL A;  4DR7 L;  1OVO A;  4QIW E;  1RIP A;  3QJY A;  4F8M A;  2HD3 A;  4JI1 Q;  5KEE A;  1ZKO A;  3JAM E;  5AJ3 L;  4A3I B;  1WCM H;  3A5U A;  3W5O A;  5J8C A;  2ID0 A;  3M3Y H;  2F0Q A;  4LFB Q;  4CHT B;  2KMQ A;  1CKN B;  1QCB D;  1SYG A;  3BDC A;  1XJV A;  2K32 A;  1BUV T;  2OQK A;  3CME A;  1R9T H;  2VL6 A;  3BG3 A;  2SNS A;  4CGY B;  2QCP X;  1SAP A;  1I5F A;  1VQA A;  4OX9 Q;  1X3Q A;  4XQJ A;  1SMY D;  1ICF B;  4L6T B;  1P16 A;  3OMC A;  1EY4 A;  1VQP A;  5EX3 A;  1IHZ A;  1FNU A;  1HA6 A;  2KMP A;  1PLF A;  2JN4 A;  2JA9 A;  1TWH H;  5G3L D;  4GN4 B;  1KLU D;  5M9O A;  1SYB A;  1STN A;  3UDI A;  1K28 A;  2XWJ B;  3D4D A;  2EJG C;  1K8O A;  5C4X G;  1E7Z A;  2F0S A;  2YFB A;  3AJF A;  1H9M A;  4BY1 G;  1O7Y A;  2N49 A;  1PH5 A;  1I94 L;  2F4V L;  2LSS A;  3OWE B;  5LMN Q;  4GN5 A;  4QGU A;  1KDA A;  2XTQ A;  1GUW A;  2KCN A;  2R92 G;  4Q9V A;  3D8G A;  2K75 A;  3I73 A;  5A35 A;  1EIG A;  1IYJ B;  2ODD A;  1VQ8 A;  3KLR A;  5IIF A;  2UU9 Q;  1STH A;  3FEW X;  2I5L X;  2NVT H;  2Q8R E;  2J4X A;  2PMZ E;  3K59 A;  3T53 B;  3UE1 A;  1RTO A;  1Y1W H;  4A3E B;  2PPB C;  2WFW A;  1MBY A;  3R2T A;  5KND A;  4QUF A;  2NVX B;  2VXW A;  3ND8 A;  3TP6 A;  3K5L A;  4G7O C;  1PRT B;  2KHS A;  3AB9 A;  2R93 H;  2V4D A;  3H0G B;  1KTK A;  1WCM G;  4A3J H;  3RLO A;  3GTL H;  1HQR D;  1ET6 A;  4HAE A;  1B3Q A;  1PVO A;  2A74 C;  1LTI D;  3GTJ B;  1EOV A;  3NTH A;  2A20 A;  1WVL A;  4OGQ C;  4IPD A;  4YZC A;  5LL6 X;  2Z6K A;  4MIU A;  1F2M A;  5EBD A;  3URY A;  1IYV A;  1VQ7 A;  1KRS A;  4FVM A;  3CC2 A;  1FAQ A;  5EKK A;  5FK9 C;  1H9K A;  1EFI D;  2YU9 H;  3I4N H;  4JV5 Q;  4YY3 Q;  1SRO A;  2K50 A;  1S40 A;  1EYA A;  1E3P A;  4HED A;  3CCQ A;  1HFG A;  1D2B A;  3T1H L;  2E2H B;  3R5A A;  1PTO C;  2KCM A;  3TO6 A;  2ES2 A;  3CU7 A;  1UEB A;  4GOP B;  3FKI B;  4X65 L;  1O7L A;  1GHJ A;  3J81 E;  3C3L A;  2K5Q A;  2FU2 A;  3RN2 A;  2PQA A;  5H1S E;  4JI5 L;  3K0Y A;  4JBJ A;  5LNK 1;  1IW4 A;  1ENA A;  4C1N I;  2CFM A;  3NQT A;  4DF7 A;  2F52 A;  5IGG A;  1Y8N B;  3S14 B;  3FDT A;  2ALY B;  3LJ1 A;  4L5T A;  4CDF C;  2YTY A;  4RHR A;  3DMU A;  1Y1W G;  3CD6 A;  5KIX A;  3S17 B;  4P71 A;  4ULL A;  1JQY D;  5GAD C;  3M4Q A;  3D4R A;  1NMF A;  2DN8 A;  1UE5 A;  3E9I A;  3I70 A;  1NBW A;  4A3J G;  2MO1 A;  1LR9 A;  3STB C;  4EQ5 A;  1VQ4 A;  4A3E G;  2LB7 A;  1AE3 A;  3PO2 B;  1SNC A;  1IBM L;  2CKZ B;  3TRE A;  4TKO B;  4KHZ A;  4KMU C;  2YTV A;  5K5P A;  4UDU C;  1X9N A;  1CE3 A;  4YZ9 A;  1GOZ A;  4LF9 Q;  2UUA L;  2A6E C;  3J80 i;  2VB2 X;  3E5S A;  1EIF A;  3F2U A;  1VQB A;  2QQC A;  4FNF A;  3Q0A A;  5C4Z A;  3TS0 A;  1NJI C;  1SN8 A;  3S2D B;  1MJA A;  1AE2 A;  1DS3 I;  3CMA A;  1J8I A;  1KNE A;  2K5N A;  3WOE A;  3A55 A;  2KBN A;  1HJA I;  4JI8 L;  1T5X D;  1XX6 A;  1F2L A;  4K6L A;  2IJ0 A;  3BDO A;  2BDO A;  2J87 A;  1GUS A;  5C3W A;  1YJW A;  5CBA E;  5BR8 L;  2LFN A;  3VA5 A;  2KEN A;  4UAI A;  1EEI D;  2TMP A;  3D6C A;  1BXT A;  1A0I A;  3HKZ B;  1JMC A;  2GVI A;  1TOT A;  4ZYS A;  1HNX Q;  2OF1 A;  2IX3 A;  2JZM A;  1F9Q A;  3UGD A;  2IY5 B;  1FJG L;  1K8G A;  1CM9 A;  2A6H C;  4Z7H A;  1STB A;  3F2C A;  3K5M A;  2WCY A;  4YCV A;  3J7Y W;  2P6A C;  1YNJ C;  2HDM A;  3LWE A;  1Q9B A;  2PCF B;  4ZQ3 A;  2ROW A;  3VA9 A;  2N3S A;  2Y0M A;  1X56 A;  1Z6H A;  3ER0 A;  1S20 A;  4O1O A;  1X3E A;  1EWH A;  2KCX A;  3VR6 A;  4AH6 A;  4HN7 A;  1FL0 A;  5ELE A;  4G75 A;  4O42 A;  1AN1 I;  4UXJ A;  2WP8 J;  4DV1 L;  2V1C A;  2H1E A;  3ZYY X;  4B9X A;  1CZW A;  4B9W A;  4DK0 A;  2FJ2 A;  3JAM L;  4IFD I;  2DY8 A;  2ETD A;  1VQD A;  3K80 C;  3C1E A;  2RSO A;  1X55 A;  3UDX A;  4K8I A;  4RG1 A;  1LAC A;  5F2D A;  3HS0 C;  4A3K H;  4DR1 L;  1VQN A;  1K7U A;  4BS9 A;  3TP5 A;  1ULK A;  2OXP A;  4CDE C;  4GXT A;  4UP9 A;  3I72 A;  3AMU A;  2VUM H;  3EIV A;  3F4M A;  1PTO B;  1X6O A;  3PIP A;  4IFD J;  3TO9 A;  4HJ9 A;  2JA8 H;  1H9S A;  2EPB A;  4DR6 L;  4HMI A;  1D1K A;  4QIW B;  5CYU A;  4HIK A;  1PH3 A;  4K0K Q;  1PTO H;  3LX0 A;  4FXK C;  4LF6 Q;  1Y8P B;  2E2I H;  4DV6 Q;  2LY7 A;  3K7U C;  1CGJ I;  2KMO A;  2PW7 A;  1EWC A;  4M8A A;  2ZM6 L;  4F87 A;  3CC4 A;  1SXT A;  2UXC L;  3PQI A;  5DNF A;  1Z7T A;  2EYO A;  3JSB A;  1RF2 D;  4OWT B;  2UXD Q;  2ZJR A;  4DV2 L;  3AEV A;  2GN5 A;  4JOI C;  2NYZ D;  1G91 A;  3TJQ A;  2HHH L;  2EJM A;  3A56 A;  2BL8 A;  2ZTD A;  1TY2 A;  4DR2 L;  2F0W A;  2NVQ B;  1ULM A;  2C9O A;  1BCP C;  1FNV A;  2SNM A;  1V1O A;  4L8J A;  5IT9 c;  1P9G A;  5E1F A;  4DGZ A;  1GO3 E;  1KAA A;  3KY9 A;  4NXM Q;  1CT0 I;  1UVG A;  4IPH A;  2XWB B;  4DNR B;  3TN2 A;  1I4G A;  2F0V A;  2F0O A;  4RGN A;  5CBE E;  4K14 A;  4A3F H;  3EA6 A;  3KOJ A;  3TDQ A;  2V6E A;  1TWC H;  1ICW A;  3F2B A;  3TO7 A;  3UIT A;  4A3K G;  1N9W A;  3TZD A;  2QQD A;  1KC8 C;  4ZUJ A;  5I9P A;  1WTO A;  5M5X B;  4UY8 C;  1DJR D;  1X3P A;  1I6H B;  1GVP A;  1F9R A;  4QY7 A;  1SE8 A;  2CVR A;  2K9H A;  3MEH A;  3RU0 A;  4NDX A;  3VR3 A;  2JA8 G;  1OXX K;  1PH9 A;  2JBW A;  1CT1 D;  4NV5 A;  2PMZ B;  3NWT A;  1D5Z C;  4BY7 B;  2UXB Q;  4AYB B;  3G48 A;  4DAY A;  3QWP A;  3FVV A;  4RHS A;  4WFN 3;  1SYD A;  4K5V A;  3NBH A;  4UP8 A;  4DV0 L;  4A3B H;  1C4Q A;  2WAQ E;  3SK6 A;  1L1O B;  1N33 Q;  5D3D A;  3N6R A;  4APV A;  3E9H A;  3CCU A;  1K3B C;  1TT2 A;  3IAM 1;  5EKL A;  3RN5 A;  4BA1 I;  3I9V 1;  3D4W A;  1SNO A;  2MUY A;  5IGE A;  5M3F B;  2DJF C;  1SE4 A;  2JYO A;  1JE5 A;  2Y0S B;  1TXY A;  3S15 B;  2YFA A;  3SGB I;  4JI3 Q;  2NWG A;  4HJ5 A;  4DV7 L;  3KUP A;  1LV9 A;  3CQZ B;  2E2J H;  1QZG A;  1IW7 C;  4R8N A;  4JI4 L;  4OIJ A;  2KMR A;  2B29 A;  1ENF A;  4BXX H;  2Q2I A;  3ULL A;  2IPK D;  1PH7 A;  1IZ6 A;  5M3M B;  1BBW A;  5FO8 B;  2RIO A;  1B7Y B;  2JSO A;  4XTC S;  2E8G A;  2I46 A;  4KKS A;  4DA2 A;  2YQP A;  1XPU A;  3I55 A;  1E24 A;  2OEO A;  2ELI A;  1HEV A;  1HR0 L;  2QPO A;  1SNP A;  1IXR A;  3MEK A;  2KJX A;  4NPS A;  4C1N K;  1G6P A;  4AS2 A;  3TEH B;  3NPP A;  3P1H A;  1V43 A;  1TWG H;  3CF5 A;  9WGA A;  2DY7 A;  3OVO A;  1R79 A;  1L0Y B;  2FMC A;  4O0A A;  2XN9 C;  1YBY A;  2K6A A;  3ND9 A;  3HH2 C;  2IL8 A;  4X64 Q;  3KJO A;  3DO9 A;  2O5J C;  3BU2 A;  1HPT A;  5D65 A;  4ZUI A;  2YYZ A;  1KDC A;  2IX1 A;  3I3C A;  3QR8 A;  4HJA A;  1JJG A;  3KF8 A;  2MQH A;  3I90 A;  2A73 B;  2X6G A;  1KDB A;  3UDF A;  1H9J A;  2B63 H;  5NUC A;  3H15 A;  3OOC A;  2Z0S A;  4GNX B;  1Q1B A;  2QGQ A;  3JAM i;  4DR5 L;  3DM1 A;  4JI7 L;  4L9M A;  1GKH A;  4U68 A;  2CH4 A;  1HJP A;  4IJL A;  1TBR R;  4JCV E;  2JEA I;  3CHB D;  2HDL A;  1AN8 A;  4LUV A;  4FF4 A;  1ASZ A;  3HRZ C;  3H3V C;  1YJN A;  2GVA A;  5M3F G;  1K0R A;  3EQL C;  1MSG A;  1NSN S;  1B53 A;  4KD3 A;  4BXX G;  1HTL D;  3TSS A;  2E73 A;  2A69 D;  2ICE C;  4RGO S;  2AUJ D;  3SK8 A;  3MZ5 A;  3RD4 A;  2F0D A;  1MD2 D;  1N34 L;  1UUC A;  5I2X A;  2Q2T A;  1XMQ Q;  1X4S A;  1D5M C;  4JI6 L;  2MJ8 A;  3ITP A;  2K5V A;  1VQC A;  1Y1V H;  4A3D B;  4Z7G A;  1OMT A;  2N78 A;  3TRZ A;  3MA2 B;  4YZD A;  2OVO A;  1A2T A;  4HJ8 A;  1SYE A;  4CJ2 C;  4J6H A;  4AS3 A;  1RD9 D;  4HSP A;  2A1A A;  3T4A C;  1GD7 A;  3L0O A;  4ID6 A;  3S1M H;  4MTN A;  5ELB A;  4DAM A;  2L12 A;  4O2D A;  2UVO A;  2GIV A;  5FO7 B;  2QQ0 A;  4YCU A;  5IP7 G;  1N32 L;  4GS3 A;  1DOK A;  4OWX B;  1F2Y A;  1RTN A;  1E2W A;  1WTR A;  2L8E A;  1E0B A;  4P72 A;  3D6W A;  4MPI A;  2JP1 A;  3Q8D A;  1F2Z A;  1Q8I A;  1PTQ A;  5E4W C;  2PNR C;  3HP3 A;  4NMZ A;  2B63 G;  3S1R B;  1HNW L;  3W1G A;  2EQS A;  5BN4 A;  4R4C A;  3A8I E;  4KTA A;  4LFA L;  1V1P A;  4DWL A;  1EY8 A;  1UE6 A;  2O2L D;  4X3K A;  3L2P A;  5C3X A;  1W2B A;  2DIP A;  4HID A;  2IHE A;  1KBE A;  4IAL A;  1A3V A;  2QDB A;  3H3V I;  4XYO A;  4LAA A;  1XNR L;  5C44 H;  1J5E L;  5M5W B;  1B9M A;  1PFB A;  4YHH Q;  3ONA B;  2CW0 C;  3HKZ E;  1II3 A;  4YCW A;  2HIX A;  1PRT F;  1IYU A;  1S4Z A;  1JOR A;  4E1P A;  4LF5 L;  5JEA H;  2RBM A;  5HUR A;  3I2Z A;  2EZV A;  3PDN A;  1B4O A;  1PZJ D;  2CJS C;  4IUR A;  2UUC Q;  1DXM A;  2AQ1 B;  2GKT I;  4ODG A;  3UFF A;  3VR4 A;  3M85 A;  2VS1 A;  1JC7 A;  4OL7 A;  3HOX B;  2HUG A;  4NXN Q;  3J81 i;  2OZU A;  4R1J A;  1IL8 A;  1IBL L;  4A3D G;  3NQI A;  3U50 C;  2K5W A;  1LT3 D;  2ERW A;  1TBO A;  1RDP D;  3HOX H;  2HQL A;  1WTW A;  4BBR B;  4X62 L;  2OTL A;  1DON A;  1AZP A;  3HOY H;  1SGP I;  1SYC A;  1QVF A;  4GOP C;  3KFU A;  4J1M A;  3NHH A;  5C0X H;  3S2H B;  2EXZ A;  4BY1 H;  1M8B A;  5DM7 3;  1EY7 A;  3VYS A;  1TBQ R;  5FUV A;  1XX8 A;  4PL3 A;  4BBR H;  2VNU D;  5E3Q A;  2VQE Q;  4DUY Q;  3FPP A;  4ZRZ A;  4AQY Q;  1A3T A;  5CV9 A;  1Q82 C;  1EL0 A;  3TME A;  2OD1 A;  1NR2 A;  2N71 A;  4B3R Q;  5EQ0 A;  1CGI I;  4NP5 A;  1FD7 D;  4EGV A;  2ZJP A;  2JA6 B;  1B1Z A;  2PZW A;  3QIA A;  2NZH A;  4KHP L;  1XPO A;  5C44 G;  3KLW A;  4XYQ A;  3BZD B;  3D3R A;  4X3T A;  5HY6 A;  3H3V H;  3X3N A;  4R8I A;  5J39 A;  1Y14 B;  5CV6 A;  5JEA G;  3A7L A;  4HEA 1;  2ZW3 A;  5EPL A;  4H02 A;  3D31 A;  1ROD A;  2QDL A;  2CH4 W;  5C3E B;  5D14 A;  1D6E C;  1BNZ A;  4A3I H;  3D00 A;  1YIJ A;  3QB3 A;  2JK8 A;  2WAQ B;  3OTO Q;  2Q2H A;  3QG1 A;  1KMA A;  1EZ6 A;  2HCI A;  4CJ1 B;  3E0J A;  4HJ7 A;  5AJ3 Q;  5ELD A;  5FUX A;  4IUU A;  4KY6 A;  5LMU Q;  1SNM A;  4OX9 L;  1NUB A;  3HZX A;  5KRU A;  5KYL A;  1T9H A;  3NK9 A;  4QMG A;  4RCO A;  2CWH A;  2N8N A;  5JJK A;  1C0A A;  5DLQ E;  1WTP A;  3HOZ B;  3HOX G;  4KKT A;  4ME5 A;  2EVB A;  1K3R A;  2DUD A;  1E1T A;  3HOY G;  1EU4 A;  1XTC D;  1Q90 A;  4CBV A;  5C0X G;  3HG9 A;  4K5W A;  1U5K A;  3K0X A;  5EAY A;  2JJQ A;  3UI2 A;  4I7Z C;  3T56 B;  3KF6 A;  4N8F A;  2NN6 G;  4BBR G;  1Q3L A;  5LMN L;  3DWQ A;  2QIL A;  2X69 A;  2SDF A;  2EYP A;  2JA7 B;  1ZYR C;  3QO2 A;  3U58 A;  4TRD A;  5CCL A;  5J3B A;  1I50 B;  4Q5V A;  2UU9 L;  2B0U C;  1LO5 D;  2KCC A;  1XYI A;  2K03 A;  4XXE A;  4AYB E;  3UDG A;  2F4V Q;  2B2T C;  5FKA C;  3O13 A;  1O7I A;  5HGQ A;  4DR3 L;  1BF4 A;  4A3G B;  4TSS A;  1Q46 A;  1STE A;  2E74 C;  3VR5 A;  3E2I A;  2K5D A;  2JA6 G;  3KDF B;  1A8V A;  4JW0 A;  5HQ8 A;  4A3E H;  1X54 A;  1B44 D;  3PIO A;  2OWO A;  2NVX H;  3C46 A;  2RCN A;  2L7X A;  1AW7 A;  2Y0S E;  2F0G A;  3H0G H;  4A3I G;  3FNB A;  1XA6 A;  4DV3 L;  4I1T A;  1XTD A;  3S16 B;  3J7A V;  2VZA A;  5T1I A;  2NVY B;  2JA1 A;  5E3R A;  1XNQ Q;  2B2U C;  3A74 A;  5CMD A;  5IT9 E;  3TOA A;  3GTJ H;  2RDF A;  1QUQ A;  4FDB A;  5JVG 3;  1SMX A;  4DPG A;  4B6D A;  2P22 B;  1S5D D;  2KED A;  2WAQ G;  3K58 A;  4N9T A;  4DK3 C;  1QVG A;  2XTI A;  4JV5 L;  4YY3 L;  3LGJ A;  2K19 A;  3W2D A;  1SE2 A;  1FVI A;  1U4M A;  1FYC A;  3R8B A;  1GUG A;  4SGB I;  2YV5 A;  2BE5 D;  4QL5 A;  1X32 A;  2GKV A;  1PTO F;  5IGD A;  3PO3 B;  2L9H A;  4V0B A;  3HOZ G;  1Y69 U;  1E22 A;  2AQ2 B;  1DM0 B;  4LUO A;  4DNT B;  2PI2 E;  1UWV A;  2CQA A;  4KY7 A;  3T13 A;  1CTM A;  3CCJ A;  2E2H H;  1JOK A;  1TII D;  2A6H D;  2GVB A;  3C1F A;  1SMY C;  2JA5 B;  3T1H Q;  2YUU A;  1Y8F A;  2L1L B;  5I2Y A;  3OW7 A;  1V1H A;  3FKI H;  1SR3 A;  1STG A;  2XRC A;  4IUQ A;  2RDG A;  2JEB I;  3T16 A;  4RGT A;  4CDC C;  1LM0 A;  3VDP A;  4X65 Q;  3VYT A;  3GV6 A;  1HR0 W;  1SGQ I;  1VDZ A;  1CKN A;  1M8A A;  3MWY W;  4BBS B;  4YWK A;  1CI3 M;  3GTM B;  4FKD A;  1SJ8 A;  1OXU A;  4JI5 Q;  3MVV A;  3B4V C;  4GLA C;  3S14 H;  3I4L A;  3H91 A;  3D0F A;  5EJW A;  2L0C A;  3HKS A;  5KNB A;  5JHW C;  3S17 H;  1YHA A;  4BBS H;  2KHJ A;  4DR4 L;  2O5I C;  3DA3 A;  5IYC H;  3H0G G;  3NWS A;  1PZK D;  1S5B D;  5KNC A;  1W3S A;  1VQJ A;  3PO2 H;  1VQ5 A;  2MHV A;  4QUC A;  2I07 B;  1EYG A;  2NU4 I;  3NUC A;  4K5X A;  3TP7 A;  1MIU A;  1NCV A;  3BVZ A;  3CCR A;  1R4Q B;  4JI0 L;  4IZ8 A;  3HGB A;  3SXH A;  1CHP D;  1CT2 I;  4GLX A;  4OAU C;  4AIM A;  2MGS A;  1JE4 A;  4RCN A;  1WTH A;  2IWH A;  5C4J B;  3S2D H;  3VDU A;  4IUP A;  1OMU A;  5C5M A;  4J15 A;  3G4S A;  2FUG 1;  2H4O A;  1NNX A;  3DEO A;  5FOB B;  1HTP A;  1TS4 A;  1D5X C;  1OTC A;  1Z9F A;  2K14 A;  1L1O C;  3FKI G;  1IBK Q;  3S1N B;  1HNX L;  4OXP A;  4XDX A;  1Q8K A;  1G51 A;  1E2V A;  3BJU A;  4JI2 L;  1YHQ A;  3QWN A;  3A8J E;  4KV6 A;  4N9P A;  1B3A A;  3NTI A;  1PH6 A;  4RKL A;  1LTG D;  2DNE A;  4A3M B;  2RLD A;  1FR3 A;  3L3O C;  5J22 A;  1CSO I;  4DV5 L;  2V53 A;  1WI5 A;  1PFN A;  4R4T A;  1D8L A;  4FF1 A;  1ESR A;  1NMG A;  4XT1 B;  1FJG Q;  1TBN A;  1XBT A;  2JB1 A;  4BBS G;  2R6G A;  5M5Y B;  2B8T A;  4C3H B;  1XWE A;  3TQY A;  1IL2 A;  2ASB A;  1Y1B A;  3AU7 A;  3QTL D;  3A54 A;  5IYC G;  2MP1 A;  1TU2 B;  1G8Z D;  3GTO B;  3SGQ I;  3P20 A;  1C8C A;  2X52 A;  1JB3 A;  4IN3 A;  4I7A A;  2DNC A;  5CCM A;  4H44 C;  3PO2 G;  2JB2 A;  2YTX A;  5J8F A;  4GOP A;  2XRQ D;  4DK6 C;  1FY7 A;  3G71 A;  2B2V A;  2IW3 A;  2QZG A;  1GHK A;  1HZB A;  1TY0 A;  4LWC A;  1ILP A;  1CT4 I;  5CV5 A;  3TBI B;  2VY3 A;  1SJE D;  2XRS D;  4MTK A;  4FYD A;  4KI0 A;  2EOT A;  2N88 A;  2XIW A;  1HCZ A;  5T1G A;  2BOS A;  4A4I A;  4DFA A;  2EIF A;  5I4D A;  2WII B;  1XXG A;  3PF5 A;  4DR1 Q;  3FRP B;  1XPR A;  4O1P A;  1WFQ A;  4LFC Q;  2ENZ A;  2FXQ A;  1H9R A;  2NU0 I;  1QVC A;  1Q81 C;  3R5D A;  2NB0 A;  4K0K L;  1FGU A;  1STA A;  4LF6 L;  5IWA L;  3OIP A;  2M2L A;  3UEY A;  2Q8I B;  4DV6 L;  1KLG D;  1PHJ A;  2JXM B;  3GD7 A;  4GNX C;  3MXN B;  1LTR D;  4C2M B;  2ZJQ A;  1N36 Q;  4LF7 Q;  1TS5 A;  2O4X A;  3HKZ G;  2K4K A;  4NV2 A;  2EDG A;  1Q12 A;  4HTH A;  2UXD L;  4LUZ A;  1TS3 A;  1I4P A;  1LR8 A;  1A15 A;  2Z4I A;  2BA1 A;  1F9P A;  2F0P A;  4OIK A;  3RZD B;  1BCP F;  1VQL A;  4ZLT F;  2LMC B;  4U67 3;  2P5Z X;  1PV4 A;  4XIG S;  5FLX E;  4GKK Q;  1BO0 A;  2ICI A;  2NVQ H;  1T5E A;  3RLF A;  4X66 L;  3QOL A;  3H6M A;  5IE8 A;  2HHH Q;  5ISR A;  4DV4 Q;  1P8L A;  1BKB A;  4DR2 Q;  4DXG A;  1TWF B;  4RMF A;  1YNX A;  1PYS B;  4AML A;  4POG A;  4C3I B;  1MHW C;  2RA4 A;  3CXC A;  2BH8 A;  3P23 A;  1EQV A;  2WIN B;  2F3C I;  3K7A B;  1UNS A;  2D0P A;  2EY1 A;  5IT9 L;  1BBX C;  3F8T A;  4WJW A;  1SFO B;  5M5X H;  3M4O B;  1I6H H;  5AFW A;  1Z47 A;  2HIV A;  1PTR A;  3CW2 C;  1TS2 A;  2HGK A;  3UOE A;  2D2C C;  4ZAI A;  3DHQ A;  4X6A H;  4IPG A;  2B2T A;  4JG2 A;  1YNN D;  1E2Z A;  1PDQ A;  1TR5 A;  2UUB L;  5IY0 A;  4FF2 A;  3J81 c;  1Q7Y C;  3K57 A;  1CA5 A;  4PMC A;  4BY7 H;  1EQT A;  1DOL A;  3Q22 A;  1JIC A;  5IGB A;  3TZU A;  2EYF A;  1K9M C;  2R7Z B;  5GQO A;  3RMH A;  3NBI A;  1CSP A;  4DV0 Q;  3HOW B;  3NEM A;  4R9W A;  4JI3 L;  4HIM A;  4S3S A;  1UE7 A;  5LHY 1;  5M3F H;  2J9R A;  3HOV B;  3UE0 A;  2B2W C;  4N8X 1;  2B2U A;  3GTP B;  1P9Z A;  2R7Z H;  3S15 H;  5IP9 G;  4UXH A;  3I4M B;  1PZI D;  2JAE A;  4MHE A;  3FC3 A;  1KIX A;  3VYU A;  2JE6 I;  1VQF A;  3LNN A;  4L63 B;  3U4Z A;  1EY9 A;  3CQZ H;  1M90 C;  1ASY A;  2F0U A;  1VQK A;  1NXU A;  1DCZ A;  4DV7 Q;  2J7Z A;  3NEL A;  1MJE A;  4JI4 Q;  1M8C A;  1EOT A;  3I4M H;  2E5R A;  3OXF A;  3M4P A;  5M3M H;  3Q24 A;  1X3F A;  2LXJ A;  4A93 B;  1W6K A;  3TP8 A;  1A62 A;  2EJF C;  2WV6 D;  3SEB A;  5IYD G;  4K2L A;  1V9P A;  4OAV B;  3BVM A;  2R3Z A;  4XQQ A;  1S72 A;  1DZ1 A;  4A93 H;  5IOD A;  1SDF A;  3I8Z A;  5IP7 H;  4DUZ L;  1HR0 Q;  1DD2 A;  3TS2 A;  5BN5 A;  3BZK A;  3T1Y L;  1CUK A;  1EU3 A;  2RHS B;  4KKU A;  2OU2 A;  4X3S A;  1KHI A;  1U4L A;  3J7A 5;  4BY7 G;  2M00 A;  4LF8 Q;  4AYB G;  2KKM A;  5A2Q E;  2CWG A;  2A68 D;  1V8Q A;  5FUY A;  1HUM A;  3K8A A;  3RZO B;  2OQ0 A;  2L11 A;  3R5C A;  3CCV A;  1PH2 A;  3SDJ A;  1I4R A;  1XMO Q;  1B8A A;  2AWN A;  2EY2 A;  1CK1 A;  1HNZ L;  1JR0 D;  3IKJ A;  3Q23 A;  1TUR A;  4IQZ A;  2Y0S G;  5EPJ A;  1PRT D;  2R7Z G;  3RZO H;  3PSI A;  2CQO A;  2HT1 A;  4DR5 Q;  2DJG C;  1Y8O B;  5CV8 A;  3B55 A;  2D0O A;  1ZEQ X;  4TVA B;  1SYF A;  4LF4 Q;  3RUZ A;  3HFZ B;  2JB3 A;  1YHB A;  1O78 A;  3I4M G;  5GRO A;  1VQ9 A;  5M3M G;  1XMQ L;  2ZXP A;  1PCE A;  3CC7 A;  3PUX A;  5JEA J;  3KJP A;  1SGN I;  4CDD C;  3OHX C;  5BN3 A;  2RDH A;  3R5B A;  2A8V A;  1K0S A;  1QZH A;  4B3S L;  2Q2U A;  1YI2 A;  1L1O A;  1N34 Q;  1HPC A;  4A3D H;  4A93 G;  2WGC A;  2WB1 B;  2EYM A;  2LEO A;  3WOF A;  1HH2 P;  2CAZ B;  1QB5 D;  1ENC A;  5C0X I;  2E5L L;  1O7Z A;  4R4I A;  4F88 A;  2F0I A;  2KOL A;  2NN6 I;  3C2P A;  4FF3 A;  2QSB A;  4HCS A;  1HRJ A;  1OO9 B;  2PQ8 A;  2PW5 A;  2F6M B;  4RH6 A;  4XT3 B;  1A2U A;  2LXK A;  2MO0 A;  4MNO A;  1MI2 A;  4ILW A;  5IGF A;  1N32 Q;  5C0X J;  1OXT A;  4LNQ A;  1B70 B;  1EQQ A;  3F2D A;  4QJF A;  1FYB A;  4R4O A;  4UHV A;  3S1R H;  3KLS X;  3K6O A;  3M7N A;  1C7Y A;  4GKJ L;  3NSW A;  4B3M L;  1TDP A;  3KBG A;  5C5L A;  5FLM H;  3A8K E;  4C3J B;  3GTQ B;  4A75 A;  4GLV B;  1SGR I;  3P7J A;  4B3T Q;  1QE6 A;  4YHH L;  3HOU B;  4IOA A;  1VDD A;  4QQB X;  4LFA Q;  3NEN A;  1DS2 I;  3A0J A;  2X3T A;  1KD1 C;  4NB3 A;  4P2C B;  4YIJ A;  5M5W H;  3E6Z X;  3OMG A;  2PZT A;  1ML0 D;  4E1R A;  4OEM B;  3MXP A;  1KNA A;  5FLX L;  1J5E Q;  2OCE A;  3BZC A;  2E75 C;  4A24 A;  3CRK C;  1QWY A;  4RKB A;  3GTG B;  3PUW A;  1N8R C;  4JVZ A;  4LF5 Q;  3CKI B;  4L5S A;  2AHO B;  1MGS A;  4YWL A;  4JYA Q;  1I4H A;  3X3M A;  3MFY A;  2K5H A;  4GNX A;  4LMQ D;  1B50 A;  3J80 c;  2ZRR A;  2F0M A;  1UHA A;  3M7G A;  4P73 A;  2LUY A;  3DLL A;  2QQE A;  1QOH A;  2JYY A;  4JOI A;  3KBX A;  2OT2 A;  4HIO A;  1BQQ T;  1J6Q A;  4UP7 A;  5CC4 A;  2F0L A;  1I4X A;  4KJN A;  3S1Q B;  2K33 A;  3CPW A;  5EBC A;  2LS0 1;  5TSS A;  2NN6 H;  1HFN A;  3GTK B;  1N13 A;  5C4X B;  3R3O A;  4WOR A;  1FNW A;  1HXY D;  1VF7 A;  1PMR A;  4OEL B;  2N1A B;  1LUZ A;  1EYC A;  4JBW A;  3SK4 A;  4DUY L;  2L1B A;  1NY4 A;  1O80 A;  1GM5 A;  1G29 1;  4X62 Q;  3S2H H;  3LWU A;  2ARP F;  5FJ8 H;  2VQF Q;  4Y7N B;  4B3R L;  2K04 A;  2CWA A;  3I7F A;  2R92 B;  2WVJ A;  3MHB A;  3EBE A;  3SR1 A;  3J81 j;  1J9O A;  5FLM G;  5IYB G;  1STY A;  5JJI A;  2RC4 A;  1K8A C;  5E3P A;  1GUT A;  1CQV A;  4OHJ A;  3MFG A;  1U4P A;  1TWA B;  4PG3 A;  1WTV A;  4JI1 L;  2JA6 H;  2AKW B;  1LAB A;  4NW2 A;  5HGT A;  4LFB L;  2B3G A;  3VDY A;  3ICE A;  2C5C A;  2NZO A;  1PH4 A;  1VQG A;  4QCL A;  2A2C A;  1WCM B;  3DA4 A;  2R7F A;  4CJ0 B;  2PQA B;  4ZKC B;  2N17 A;  4DR7 Q;  3M3Y B;  4PZ6 A;  2PQE A;  2L55 A;  3R2I A;  3BYY B;  4B08 A;  3VE5 A;  5DM6 3;  2KHI A;  3OTO L;  4I65 A;  1CFM A;  1R9T B;  1U4R A;  3CRL C;  3EFX D;  4GZY C;  1MJ9 A;  5LMU L;  3VYR A;  1LT6 D;  5C3E H;  1PTO D;  3SGI A;  1DGS A;  3MTS A;  1UUP A;  4X3U A;  5CV7 A;  1QJO A;  3BVG A;  2E76 C;  2RAD A;  3PUZ A;  4BA2 I;  1I3Q B;  4K6D A;  2L4N A;  1AP0 A;  4JPB W;  1TWH B;  1HUN A;  3RR5 A;  2FEF A;  4DAV A;  2CWF A;  3FVQ A;  3NXW A;  3HOZ H;  2B2W A;  1EIY B;  4R4Q A;  2QA4 A;  4KHV A;  1WGC A;  1ESF A;  1WD1 A;  1I3Q H;  2M9V A;  3MEF A;  5FJ8 G;  1I4Q A;  2EY5 A;  3OW2 A;  1B2T A;  1K7T A;  5A2Q L;  4QF4 A;  3L9A X;  2QEX A;  2BCO A;  1TKW B;  3V2T A;  4IOC A;  1I94 Q;  2RIJ A;  2NVT B;  2JA7 H;  3STB D;  1EZ8 A;  1I50 H;  2K28 A;  4OVO A;  1GXD C;  1Y1W B;  4KN4 C;  5ELF A;  5ELN A;  3V05 A;  3CCM A;  3UEJ A;  2F03 A;  2GA4 B;  3PF4 A;  5IGC A;  4A3G H;  2R93 B;  1EFW A;  2A6E D;  1VQ6 A;  2JXD A;  4A3J B;  3E3X A;  4IUT A;  3GTL B;  1VS0 A;  4DR3 Q;  1SSO A;  4OWW B;  1UVF A;  1MKH A;  1G6Z A;  5COR A;  4F7X A;  1D1I A;  4OO1 H;  1XNQ L;  1Q86 C;  1WTJ A;  4RWS C;  1R4P B;  3PV0 A;  1M1K C;  5C3E G;  3DWP A;  3PUY A;  4FXG C;  1GJX A;  2MFI A;  3S16 H;  4XQN A;  4ME3 A;  2NVY H;  1D7Q A;  2B2Y C;  2BDN A;  4DV3 Q;  4KK7 A;  2YU9 B;  1MT1 A;  3I4N B;  5HI7 A;  2EYJ A;  2J0T D;  1CZG A;  4PL5 A;  1VQH A;  1CHO I;  3FSX A;  4DK1 A;  2G9D A;  2F0E A;  2B8F A;  3R93 A;  1EY0 A;  1FAR A;  5EX0 A;  1GUN A; 
#chains in the Genus database with same CATH homology
 2ATW A;  3L7Z C;  1U0L A;  3UGI A;  2R7D A;  1E1O A;  1TGS I;  3PO3 H;  1KBF A;  2IHF A;  1H0Z A;  3KYH C;  1PH8 A;  3SEK C;  3AFQ A;  5GAH C;  2K52 A;  2JA5 H;  2JA7 G;  1V1Q A;  1VCI A;  1LR7 A;  1KAW A;  1WJJ A;  5HGI A;  4A3G G;  3GTM H;  2UZ3 A;  2NU3 I;  1KL9 A;  1HZC A;  4LF9 L;  3L0I A;  1YO7 A;  2I0Q A;  3CPF A;  4OO1 G;  2OTJ A;  2R93 G;  1Y1C A;  4YWM A;  1VQE A;  1KXL A;  3J7Z C;  1IBM Q;  4DR4 Q;  2D62 A;  3GOX A;  1H95 A;  2NU2 I;  3F1Z A;  2UUA Q;  4PL4 A;  2GKR I;  1Z7K B;  1BMO A;  1OYV I;  3LJ0 A;  1JB7 A;  4JI0 Q;  3I4N G;  4EX5 A;  5C4J H;  2NU1 I;  4P75 A;  3PO3 G;  4JI8 Q;  1IBK L;  3KDF A;  1S3O A;  3LJ2 A;  2WB1 E;  2JA5 G;  5BR8 Q;  4WJ4 A;  3JC6 6;  3S1N H;  4MZ9 A;  3EN2 A;  5E7N A;  2W0T A;  4HGU A;  2XTR A;  1X3G A;  4WJ3 M;  2KCT A;  3OXL A;  4A3M H;  3JAM c;  4JI2 Q;  1NTG A;  4DAY B;  2CCZ A;  4A76 A;  3NBH B;  4P74 A;  4U6R A;  5JJL A;  2BUS A;  4DV5 Q;  3PUV A;  5M5Y H;  4C3H H;  4PZ7 A;  2AMC B;  3GTO H;  4A3C H;  1CSQ A;  1EUJ A;  4DV1 Q;  3ULP A;  1YU6 C;  4JBM A;  2SGP I;  1JJ2 A;  3CXL A;  4Y52 H;  1AH9 A;  1KQS A;  4LFC L;  2RF4 A;  3FHW A;  3CCS A;  4GI3 C;  4L5R C;  1PFS A;  4L5Q A;  4OON A;  4DR6 Q;  3OYY A;  1N36 L;  4LF7 L;  2JW6 A;  2BH2 A;  1C9O A;  3DM3 A;  2F66 B;  3U4V A;  5DAE A;  1BVS A;  4C2M H;  3PGZ A;  5IWA Q;  5GAG C;  5K36 G;  4DKA C;  4A3M G;  5IP9 H;  2ZM6 Q;  2UXC Q;  1PA6 A;  4NXM L;  3ULJ A;  2SGF I;  4GKK L;  3CAM A;  3KF8 B;  4DV2 Q;  3RZD H;  1RFH A;  3FP9 A;  4IPC A;  1UE1 A;  3AFP A;  1EQR A;  5FUW A;  4DV4 L;  4A3C G;  2JQO A;  1VQM A;  1K73 C;  5IYD H;  4X66 Q;  1TWF H;  3GO5 A;  2MNA A;  3G6E A;  4C3I H;  2SGQ I;  2UXB L;  2ZTE A;  3K81 C;  3K7A H;  3PCO B;  2C35 B;  1RL2 A;  1YTP A;  2N52 A;  2VUM G;  1SFO H;  1N33 L;  3M4O H;  1K83 H;  1X74 A;  1YIT A;  3GDE A;  4TQU S;  1V1I A;  3AQQ A;  1TUS A;  1L2F A;  4GN3 B;  2F3I A;  1OXV A;  1BBU A;  2UUB Q;  1YVC A;  3M9B A;  3A5Z B;  2MJF B;  3HOW H;  4HFV A;  2FNF X;  1SLJ A;  2BA0 A;  3HOV H;  3GTP H;  3I4O A;  1LYL A;  3IAS 1;  2SGD I;  4ALP A;  2SGE I;  5LMN W;  2CWP A;  1Q1E A;  3ERS X;  1PJU A;  2A19 A;  1PPF I;  3CP0 A;  4A3F G;  4X64 L;  4UPA A;  1SRU A;  4IFD G;  3WWV A;  1SGY I;  1NE3 A;  4LF8 L;  2ZTC A;  2IX0 A;  2AWO A;  2VRW B;  4DUZ Q;  5ELO A;  1VQI A;  1WYD A;  3T1Y Q;  2Z6K C;  2ORW A;  1XMO L;  1X65 A;  4A3B G;  2ENN A;  3IRB A;  3HOW G;  1PH1 A;  4JI7 Q;  3HOV G;  4LF4 L;  5GAE C;  1HNZ Q;  3OL0 A;  4A3L H;  1MJC A;  1HZ9 A;  4PMW A;  4POF A;  4G76 A;  3B6Y A;  4DNI A;  4LW1 A;  1CKO A;  3S24 A;  2IT1 A;  2IP6 A;  4PZ8 A;  4KLK A;  4JI6 Q;  4IJH A;  2DB6 A;  1BUS A;  3E59 A;  4JBK A;  2I5M X;  1VQO A;  4B3S Q;  2ORV A;  3W1B A;  1JT8 A;  2A2D A;  1IY6 A;  2XGT A;  2E5L Q;  3RLN A;  1LTL A;  1EWI A;  5IYB H;  3KP9 A;  1A63 A;  1HNW Q;  2PI2 A;  1SGE I;  3E0E A;  1TIH A;  4B3T L;  5FLX c;  3GTQ H;  4C3J H;  4A3L G;  3BJI A;  4GKJ Q;  4B3M Q;  3KF6 B;  2I5H A;  1XNR Q;  3HOU H;  4IO9 A;  2UUC L;  3AYH B;  2VW9 A;  4NXN L;  1W4R A;  1L0W A;  1YEZ A;  4JYA L;  1WOC A;  3CCL A;  1Y1V G;  3GTG H;  1R0R I;  3CCE A;  3OXG A;  3RNU A;  2H5X A;  1HZA A;  2WB1 G;  1OXS C;  1IY5 A;  1IBL Q;  2M5X A;  2XMX A;  2PNH A;  4JC0 A;  2RHQ B;  2V1C C;  2VQE L;  3I56 A;  4AQY L;  1YJ9 A;  1PYB A;  1YZ6 A;  3S1Q H;  1QUQ B;  2DGY A;  2VQF L;  3UGL A;  4UXI A;  1JJC B;  3GTK H;  5C4X H;  2L15 A;  1CKM A;  4Y7N H;  3ZJY C;  2R92 H;  1SGD I;  2EXD A;  1KRT A;  4KHP Q;  3FBV A;  4OO1 I;  3HOU G;  1TWA H;  1HDL A;  4DR7 L;  1OVO A;  4QIW E;  1RIP A;  4JI1 Q;  5AJ3 L;  1WCM H;  3A5U A;  3W5O A;  2ID0 A;  3M3Y H;  4LFB Q;  2KMQ A;  1CKN B;  1XJV A;  2OQK A;  3CME A;  1R9T H;  2VL6 A;  1I5F A;  1VQA A;  4OX9 Q;  1P16 A;  1VQP A;  5EX3 A;  2KMP A;  2JA9 A;  1TWH H;  4GN4 B;  3UDI A;  5C4X G;  1E7Z A;  2YFB A;  3AJF A;  4BY1 G;  2N49 A;  1PH5 A;  1I94 L;  2F4V L;  2LSS A;  5LMN Q;  4GN5 A;  4QGU A;  2XTQ A;  2R92 G;  4Q9V A;  2K75 A;  1IYJ B;  2ODD A;  1VQ8 A;  2UU9 Q;  2NVT H;  2I5L X;  2PMZ E;  3UE1 A;  1Y1W H;  2WFW A;  2R93 H;  1WCM G;  4A3J H;  3RLO A;  3GTL H;  1PVO A;  1EOV A;  2A20 A;  4IPD A;  4YZC A;  2Z6K A;  1VQ7 A;  1KRS A;  3CC2 A;  1FAQ A;  2YU9 H;  3I4N H;  4JV5 Q;  4YY3 Q;  1SRO A;  2K50 A;  1S40 A;  1E3P A;  3CCQ A;  3T1H L;  2KCM A;  2ES2 A;  1UEB A;  4GOP B;  4X65 L;  3RN2 A;  2PQA A;  5H1S E;  4JI5 L;  4JBJ A;  5LNK 1;  1IW4 A;  2CFM A;  2F52 A;  2ALY B;  3LJ1 A;  4L5T A;  2YTY A;  3CD6 A;  1Y1W G;  4P71 A;  5GAD C;  3M4Q A;  1NMF A;  1UE5 A;  3E9I A;  1NBW A;  4A3J G;  2MO1 A;  1LR9 A;  3STB C;  4EQ5 A;  1VQ4 A;  4A3E G;  1AE3 A;  1IBM L;  2CKZ B;  3TRE A;  4KHZ A;  2YTV A;  1X9N A;  1CE3 A;  4YZ9 A;  4LF9 Q;  2UUA L;  3J80 i;  1EIF A;  1VQB A;  2QQC A;  3TS0 A;  1NJI C;  1SN8 A;  1AE2 A;  1DS3 I;  3CMA A;  2K5N A;  2KBN A;  1HJA I;  4JI8 L;  1XX6 A;  2J87 A;  1YJW A;  5BR8 L;  2KEN A;  1A0I A;  1JMC A;  2GVI A;  1TOT A;  1HNX Q;  2JZM A;  3UGD A;  2IY5 B;  1FJG L;  1K8G A;  4Z7H A;  3F2C A;  2WCY A;  4YCV A;  2P6A C;  2ROW A;  3VA9 A;  2N3S A;  1X56 A;  3ER0 A;  4O1O A;  1X3E A;  2KCX A;  4AH6 A;  1FL0 A;  4G75 A;  1AN1 I;  4UXJ A;  2WP8 J;  4DV1 L;  2V1C A;  4IFD I;  1VQD A;  3K80 C;  1X55 A;  3UDX A;  4RG1 A;  4A3K H;  4DR1 L;  1VQN A;  4GXT A;  4UP9 A;  2VUM H;  3EIV A;  3F4M A;  1X6O A;  3PIP A;  4IFD J;  4HJ9 A;  2JA8 H;  4DR6 L;  4HIK A;  1PH3 A;  4K0K Q;  4LF6 Q;  2E2I H;  4DV6 Q;  3K7U C;  1CGJ I;  2KMO A;  2ZM6 L;  3CC4 A;  2UXC L;  3JSB A;  4OWT B;  2UXD Q;  2ZJR A;  4DV2 L;  3AEV A;  2GN5 A;  4JOI C;  3TJQ A;  2HHH L;  2ZTD A;  4DR2 L;  5IT9 c;  1GO3 E;  3KY9 A;  4NXM Q;  1CT0 I;  1UVG A;  4IPH A;  4A3F H;  3KOJ A;  2V6E A;  1TWC H;  3F2B A;  3UIT A;  4A3K G;  1N9W A;  2QQD A;  1KC8 C;  4UY8 C;  1GVP A;  4QY7 A;  1SE8 A;  2K9H A;  3RU0 A;  2JA8 G;  1OXX K;  1PH9 A;  4NV5 A;  2UXB Q;  3G48 A;  3QWP A;  4DV0 L;  4UP8 A;  4A3B H;  2WAQ E;  1L1O B;  1N33 Q;  4APV A;  3E9H A;  3CCU A;  3IAM 1;  3RN5 A;  4BA1 I;  3I9V 1;  1JE5 A;  1TXY A;  2YFA A;  3SGB I;  4JI3 Q;  4HJ5 A;  4DV7 L;  2E2J H;  2KMR A;  1QZG A;  4JI4 L;  2B29 A;  4BXX H;  2Q2I A;  3ULL A;  1PH7 A;  1IZ6 A;  1BBW A;  2RIO A;  1B7Y B;  4XTC S;  2E8G A;  2YQP A;  1XPU A;  3I55 A;  1E24 A;  2ELI A;  1HR0 L;  2QPO A;  1IXR A;  3MEK A;  4NPS A;  1G6P A;  4AS2 A;  3TEH B;  1V43 A;  1TWG H;  3CF5 A;  3OVO A;  1R79 A;  4O0A A;  1YBY A;  3HH2 C;  4X64 Q;  3KJO A;  3DO9 A;  3BU2 A;  1HPT A;  2YYZ A;  2IX1 A;  4HJA A;  1JJG A;  2MQH A;  3UDF A;  2B63 H;  3H15 A;  2Z0S A;  4GNX B;  1Q1B A;  2QGQ A;  3JAM i;  4DR5 L;  4JI7 L;  4L9M A;  1GKH A;  1HJP A;  4IJL A;  1TBR R;  4JCV E;  2JEA I;  4LUV A;  1ASZ A;  1YJN A;  2GVA A;  5M3F G;  1K0R A;  4BXX G;  2E73 A;  1N34 L;  1UUC A;  2Q2T A;  1XMQ Q;  1X4S A;  4JI6 L;  2K5V A;  1VQC A;  1Y1V H;  1OMT A;  4Z7G A;  2N78 A;  3TRZ A;  4YZD A;  2OVO A;  4HJ8 A;  4AS3 A;  2A1A A;  1GD7 A;  3L0O A;  3S1M H;  4MTN A;  4DAM A;  4O2D A;  2QQ0 A;  4YCU A;  5IP7 G;  1N32 L;  4GS3 A;  4OWX B;  2L8E A;  4P72 A;  3Q8D A;  1PTQ A;  2B63 G;  1HNW L;  3W1G A;  2EQS A;  4R4C A;  4LFA L;  4DWL A;  1UE6 A;  3L2P A;  1W2B A;  2DIP A;  4HID A;  2IHE A;  1KBE A;  3H3V I;  1XNR L;  5C44 H;  1J5E L;  4YHH Q;  3HKZ E;  4YCW A;  2HIX A;  4E1P A;  4LF5 L;  3I2Z A;  3PDN A;  2CJS C;  2UUC Q;  2GKT I;  3UFF A;  3M85 A;  2VS1 A;  4NXN Q;  3J81 i;  4R1J A;  1IBL L;  4A3D G;  3U50 C;  2ERW A;  1TBO A;  3HOX H;  2HQL A;  2OTL A;  4X62 L;  3HOY H;  1SGP I;  1QVF A;  4GOP C;  3KFU A;  1M8B A;  4BY1 H;  1TBQ R;  5FUV A;  4PL3 A;  4BBR H;  2VNU D;  2VQE Q;  4DUY Q;  4AQY Q;  1Q82 C;  2OD1 A;  2N71 A;  4B3R Q;  1CGI I;  2ZJP A;  2NZH A;  4KHP L;  1XPO A;  5C44 G;  3KLW A;  5HY6 A;  3H3V H;  1Y14 B;  5JEA G;  4HEA 1;  4H02 A;  3D31 A;  4A3I H;  3D00 A;  1YIJ A;  2JK8 A;  3OTO Q;  2Q2H A;  1KMA A;  4HJ7 A;  5AJ3 Q;  5FUX A;  4OX9 L;  5LMU Q;  1NUB A;  1T9H A;  2N8N A;  5JJK A;  1C0A A;  5DLQ E;  3HOX G;  1K3R A;  2DUD A;  1E1T A;  3HOY G;  5C0X G;  1U5K A;  3K0X A;  5EAY A;  2JJQ A;  3KF6 A;  2NN6 G;  4BBR G;  5LMN L;  3U58 A;  5CCL A;  5J3B A;  2UU9 L;  2B0U C;  4AYB E;  3UDG A;  2F4V Q;  4DR3 L;  1O7I A;  5HGQ A;  1Q46 A;  3E2I A;  2JA6 G;  3KDF B;  1A8V A;  5HQ8 A;  4A3E H;  1X54 A;  3PIO A;  2OWO A;  2NVX H;  2RCN A;  2L7X A;  2Y0S E;  3H0G H;  4A3I G;  1XA6 A;  4DV3 L;  4I1T A;  1XTD A;  2VZA A;  2JA1 A;  1XNQ Q;  3A74 A;  3GTJ H;  1QUQ A;  4FDB A;  1SMX A;  4DPG A;  4B6D A;  2P22 B;  2WAQ G;  1QVG A;  4DK3 C;  2XTI A;  4JV5 L;  4YY3 L;  3LGJ A;  2K19 A;  1FVI A;  4SGB I;  2YV5 A;  4QL5 A;  2GKV A;  3HOZ G;  1E22 A;  4LUO A;  2PI2 E;  1UWV A;  2E2H H;  3CCJ A;  2GVB A;  3T1H Q;  2YUU A;  1Y8F A;  2L1L B;  1V1H A;  3FKI H;  1SR3 A;  2XRC A;  2JEB I;  1LM0 A;  3VDP A;  4X65 Q;  1HR0 W;  1SGQ I;  1CKN A;  4YWK A;  4FKD A;  1SJ8 A;  1OXU A;  4JI5 Q;  3B4V C;  4GLA C;  3S14 H;  3D0F A;  3HKS A;  5JHW C;  3S17 H;  1YHA A;  4BBS H;  2KHJ A;  4DR4 L;  3DA3 A;  5IYC H;  3H0G G;  1W3S A;  1VQJ A;  3PO2 H;  1VQ5 A;  1EYG A;  2NU4 I;  1MIU A;  3CCR A;  4JI0 L;  1CT2 I;  4GLX A;  4OAU C;  4AIM A;  3S2D H;  3VDU A;  1OMU A;  4J15 A;  3G4S A;  2FUG 1;  1OTC A;  1Z9F A;  2K14 A;  1L1O C;  3FKI G;  1IBK Q;  1HNX L;  4OXP A;  1Q8K A;  1G51 A;  3BJU A;  4JI2 L;  1YHQ A;  1PH6 A;  1CSO I;  4DV5 L;  2V53 A;  1WI5 A;  4R4T A;  1D8L A;  1NMG A;  1XBT A;  1FJG Q;  1TBN A;  2JB1 A;  4BBS G;  2R6G A;  2B8T A;  3TQY A;  1IL2 A;  2ASB A;  1Y1B A;  3QTL D;  5IYC G;  3SGQ I;  5CCM A;  3PO2 G;  2JB2 A;  2YTX A;  4GOP A;  4DK6 C;  3G71 A;  1HZB A;  1CT4 I;  4LWC A;  2VY3 A;  4KI0 A;  4A4I A;  2EIF A;  3PF5 A;  4DR1 Q;  1XPR A;  4O1P A;  1WFQ A;  4LFC Q;  2ENZ A;  2FXQ A;  2NU0 I;  1QVC A;  1Q81 C;  4K0K L;  1FGU A;  4LF6 L;  5IWA L;  3UEY A;  4DV6 L;  1PHJ A;  3GD7 A;  4GNX C;  3MXN B;  2ZJQ A;  1N36 Q;  4LF7 Q;  3HKZ G;  2K4K A;  4NV2 A;  1Q12 A;  2UXD L;  4LUZ A;  1LR8 A;  2BA1 A;  1VQL A;  1PV4 A;  4XIG S;  4GKK Q;  2NVQ H;  3RLF A;  4X66 L;  5IE8 A;  2HHH Q;  4DV4 Q;  1P8L A;  1BKB A;  4DR2 Q;  4RMF A;  1YNX A;  1PYS B;  4POG A;  3CXC A;  2BH8 A;  3P23 A;  2F3C I;  2D0P A;  3F8T A;  5M5X H;  1I6H H;  1Z47 A;  2HIV A;  1PTR A;  3CW2 C;  4X6A H;  4IPG A;  4JG2 A;  2UUB L;  5IY0 A;  3J81 c;  1Q7Y C;  4BY7 H;  1K9M C;  5GQO A;  1CSP A;  4DV0 Q;  3NEM A;  4JI3 L;  4HIM A;  1UE7 A;  5M3F H;  2J9R A;  3UE0 A;  2R7Z H;  3S15 H;  5IP9 G;  4UXH A;  2JAE A;  3FC3 A;  1KIX A;  2JE6 I;  1VQF A;  3U4Z A;  3CQZ H;  1M90 C;  1ASY A;  1VQK A;  4DV7 Q;  4JI4 Q;  3NEL A;  1MJE A;  1M8C A;  3I4M H;  2E5R A;  3OXF A;  3M4P A;  5M3M H;  1X3F A;  2LXJ A;  1A62 A;  5IYD G;  1V9P A;  4OAV B;  1S72 A;  4A93 H;  1HR0 Q;  5IP7 H;  4DUZ L;  3TS2 A;  3BZK A;  3T1Y L;  1CUK A;  2RHS B;  1KHI A;  3J7A 5;  4BY7 G;  4LF8 Q;  4AYB G;  2KKM A;  5FUY A;  3K8A A;  2OQ0 A;  3CCV A;  1PH2 A;  3SDJ A;  1XMO Q;  1B8A A;  2AWN A;  1HNZ L;  1TUR A;  2Y0S G;  2R7Z G;  3RZO H;  3PSI A;  2CQO A;  2HT1 A;  4DR5 Q;  2D0O A;  4LF4 Q;  4TVA B;  3HFZ B;  2JB3 A;  1YHB A;  3I4M G;  5GRO A;  1VQ9 A;  5M3M G;  1XMQ L;  1PCE A;  3CC7 A;  3PUX A;  5JEA J;  3KJP A;  1SGN I;  2A8V A;  1QZH A;  4B3S L;  2Q2U A;  1YI2 A;  1L1O A;  1N34 Q;  4A3D H;  4A93 G;  2LEO A;  1HH2 P;  2CAZ B;  5C0X I;  2E5L L;  4R4I A;  2NN6 I;  2F6M B;  2LXK A;  2MO0 A;  4MNO A;  1N32 Q;  5C0X J;  1OXT A;  4LNQ A;  1B70 B;  1EQQ A;  3F2D A;  4QJF A;  1FYB A;  4R4O A;  3S1R H;  3M7N A;  1C7Y A;  4GKJ L;  4B3M L;  5FLM H;  4A75 A;  4GLV B;  1SGR I;  4B3T Q;  4YHH L;  4IOA A;  1VDD A;  4QQB X;  4LFA Q;  3NEN A;  1DS2 I;  3A0J A;  1KD1 C;  4NB3 A;  5M5W H;  4E1R A;  1J5E Q;  2OCE A;  3BZC A;  4A24 A;  3PUW A;  1N8R C;  4LF5 Q;  4L5S A;  2AHO B;  4YWL A;  4JYA Q;  2K5H A;  4GNX A;  3J80 c;  2ZRR A;  2LUY A;  4P73 A;  3DLL A;  2QQE A;  2JYY A;  4JOI A;  4HIO A;  1J6Q A;  4UP7 A;  3CPW A;  1N13 A;  2N1A B;  1LUZ A;  4JBW A;  4DUY L;  1NY4 A;  1GM5 A;  1G29 1;  4X62 Q;  3S2H H;  2ARP F;  5FJ8 H;  2VQF Q;  4B3R L;  2CWA A;  3I7F A;  2WVJ A;  3EBE A;  3J81 j;  5FLM G;  5IYB G;  5JJI A;  1K8A C;  4PG3 A;  4JI1 L;  2JA6 H;  2AKW B;  4LFB L;  2B3G A;  3VDY A;  3ICE A;  2NZO A;  1PH4 A;  1VQG A;  2A2C A;  3DA4 A;  2R7F A;  2PQA B;  2N17 A;  4DR7 Q;  4PZ6 A;  3VE5 A;  2KHI A;  3OTO L;  5LMU L;  5C3E H;  3SGI A;  1DGS A;  3PUZ A;  4BA2 I;  3RR5 A;  3HOZ H;  1EIY B;  4R4Q A;  2QA4 A;  1I3Q H;  3MEF A;  5FJ8 G;  3OW2 A;  2QEX A;  4IOC A;  1I94 Q;  2JA7 H;  3STB D;  1I50 H;  4OVO A;  5ELN A;  3CCM A;  3UEJ A;  3PF4 A;  4A3G H;  1EFW A;  1VQ6 A;  2JXD A;  1VS0 A;  4DR3 Q;  4OWW B;  1UVF A;  1MKH A;  1XNQ L;  1Q86 C;  3PV0 A;  1M1K C;  5C3E G;  3PUY A;  2MFI A;  3S16 H;  4ME3 A;  2NVY H;  1D7Q A;  4DV3 Q;  1MT1 A;  5HI7 A;  1CHO I;  4PL5 A;  1VQH A;  1FAR A;  5EX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...