4NV5A

C50a mutant of synechococcus vkor, c2 crystal form (dehydrated)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
266
structure length
259
Chain Sequence
RHSRLILAILAGLGSLLTAYLTYTKLTEQPAAGGCDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPDLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPLEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of an intramembrane vitamin K epoxide reductase homolog reveal control mechanisms for electron transfer.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Oxidoreductase
molecule keywords VKORC1/thioredoxin domain protein
total genus 80
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4nv5A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nv5A02
2KLXA 4KA0A 3PH9A 4ILFA 3ED3A 2HNLA 3LQ7A 4OFMA 1THXA 3N5OA 1XWCA 3HZ8A 5LD0A 1RQMA 5J3RA 2CZ2A 2YZUA 3FZAA 4O5RA 5G1KA 5DVBA 4TR0A 2BJXA 2KP1A 2HSYA 2L57A 2HYXA 2HXKA 1UN2A 4MPFA 5F0GA 1T4YA 1V98A 5G1LA 1JLVA 5J4UA 5LCZA 4F0CA 3DVWA 1Z7PA 1W89A 1SL1B 1EP7A 1W4VA 2MMAA 3TJBA 6GSYA 2R37A 1KNGA 4AF2A 3ZMKA 1Z5YE 2I1UA 5D9WA 5F06A 2HRNA 4FYUA 2CX3A 1XFLA 1V2AA 3DMLA 2YZHA 1M0UA 5AIXA 5B8BA 1K0OA 3SBCA 3H4KA 1SKWB 3M0FA 2B7JA 3KM6A 2X8CA 5DAKB 2PU9C 5JCWA 11GSA 3PGTA 1FVJA 5IMZA 2E2GA 1BEDA 2PVQA 4D73B 6GSXA 5KEJA 2CT6A 1EGRA 3KP8A 2YWOA 4G2EA 3IAM2 2R5GA 3QAGA 1HQOA 4Q5FA 3C71A 5J9BA 3WYWA 2O7KA 2R6KA 1GWCA 2REMA 1QMVA 1SYRA 3GKNA 5G30A 1EZKA 4HQSA 3V1WA 1X9MB 3BJ5A 5ECMB 5JWOB 5AGYA 1I5GA 3ZTLA 5C00A 1PKWA 4F82A 1GULA 2GTUA 4DSRA 2DMLA 2WZ9A 3FR6A 1XWAA 5IIZA 3F4SA 3GKKA 5ABRA 3HZ4A 2OBKA 1K0DA 2P5QA 1ZYEA 2XHFA 3G9BA 1PKZA 1XWBA 1OC3A 2CVBA 4RQXA 5DQYA 4NAXA 4V2MA 1WWJA 3FZ5A 1EV4A 4Z7XA 4F2IA 1BQ7A 2FWGA 3UBLA 1NHYA 2G0FA 2O8VB 1AIUA 3EE2A 3R2QA 1XW5A 2C3NA 1ERUA 20GSA 1TRSA 4N0ZA 4D73A 2VL9A 2P0GA 4PX1A 1O7UA 5CRHA 4DSQA 2HLSA 3RPPA 4ZIJA 2DJJA 1QK8A 3G7JA 2OE0A 3PR8A 5DAKA 2PWJA 3C7MA 3EURA 4MH2A 3LXZA 3KMOA 1S3AA 5EY6A 1ILOA 4EDZA 2FNOA 2V41A 1M99A 1X5EA 2PUKC 3VFIA 1SJZA 2FLSA 1TK8B 4K2DA 2NVLA 4NPBA 2RUEA 3IAS2 2H72A 2FY6A 1O73A 2NPBA 2WCIA 1X9SB 5EPFA 1GSSA 3RPNA 2BMXA 5HFIA 2RM5A 3TKPA 3FEUA 4I2UA 3Q18A 1GL8A 2EIRA 4PNGA 3TKSC 3UAPA 5ECPB 4MLYA 3BOAA 2VCWA 3E3EA 1B4QA 3GX8A 2N5AA 2H01A 4WR5A 3TJFA 1Z3EA 2AHEA 1SK2A 3TB2A 1H75A 2B1LA 1A0RP 2QGVA 1TU7A 3EU3A 4CW9A 2F9SA 4GRFA 5D9TA 1M7TA 2H6ZA 2X64A 4LL4B 3IR4A 4EC0A 1AXDA 2WS2A 1YY7A 4IP6A 6GSVA 1GTUA 2NTOA 1NSWA 1V40A 4GQFA 1QQ2A 5JWQB 3HD5A 4ZBBA 3GMFA 3TGZA 3VWUA 1THOA 4KE3A 1SENA 1XCCA 3VK9A 5HR1A 12GSA 2IWTA 1ERWA 2H70A 4PUAA 1SKSB 1V57A 2IIYA 2AAWA 2X8HA 3GA4A 1T8EB 3ZL5A 2JU5A 3FY7A 3VLNA 1C72A 3CSJA 13GSA 5B7CA 3D5JA 1GNWA 3GURA 3ZYWA 3IC4A 3EC3A 3US3A 4KUNA 3UEMA 3UVHA 2E7PA 4TR1A 2MYGA 3E0UA 3GH6A 4BVYA 2GSQA 4NHWA 3F6FA 5ECHB 2VL2A 2JACA 3IBHA 2IMDA 1T00A 2IMEA 2P5RA 4ECCA 1XWGA 2YV7A 3L9UA 3IXRA 4V2NA 1KTEA 5G5FA 2NDOA 2C0GA 2IPAA 2YANA 4HZ2A 2ALBA 5H5QA 7GSSA 4P3YB 2H0HA 2H71A 1TTZA 1CQGA 1XVQA 2FWEA 3GUSA 1JZWA 2LRCA 1B8XA 1WE0A 2E0QA 2LS5A 1AW9A 4IS0A 1TRVA 1A24A 3ERGA 3DD3A 4QQ7A 2XPEA 1XIYA 2LNSA 2FA8A 2HT9A 1K3OA 5FHIA 4FYBA 2YJ7A 2F3MA 2DC5A 3ZMLA 2AB6A 2ON5A 1LU4A 1UC7A 4IW9A 3D4MA 5DALB 2FHEA 3WGXA 2HZEB 2B5XA 2V6OA 4IELA 4ID0A 4XS4A 2V6KA 3HDCA 1OKDA 4F03A 2CX4A 5LNKe 2ZUPA 2IL3A 3C1SA 3KCMA 4I97A 2N5BA 1PRXA 2L5OA 2QC7A 2GSSA 1OC9A 3TKRA 3MSZA 5D8IA 3DXBA 3IA1A 1SJIA 1HD2A 3KZQA 2C3QA 2GGTA 1AQVA 1GLPA 2H1GA 1AQXA 2I3YA 3BD2A 2ZCTA 2MMNA 1TRWA 4MJCA 3FKFA 4WF4A 4ZB6A 2VLTA 3HJMA 4PQIA 3L0HA 2H8LA 2YCDA 2H6XA 1SK1A 3EMPA 4TXOB 1R4WA 3H79A 2OKAA 3KD0A 1PN9A 3WT2A 2NBSA 3JCML 1GSEA 1A8LA 1G7OA 2GZYA 1MD3A 1AAZA 2L4QA 4JR4A 4RI7A 1TOFA 3QFBC 4L5LA 1K0MA 2YNXA 5AN1A 4IJIA 3HKRA 4MPGA 2VAFA 1EP8A 1F6MC 1ON4A 2GVPA 2H0IA 4OMVA 4MF6A 3CSHA 4GXZA 4K7OA 3C1RA 1UVZA 5IO2A 3TRXA 4ZL8A 1DE2A 5DBQA 2YOIA 3DGQA 4WXTA 4X1UA 4N30A 1URMA 5GAND 4OD7A 1FB6A 4MF5A 2IJYA 4BA7A 5IPHA 3EMXA 1VF1A 1B9XC 2XC2A 3KH7A 4BWSA 1S3DA 3LFLA 2AJQB 2OA7A 4Q5RA 1WMJA 2OE3A 4EUYA 1GTBA 3UL3A 3CRUA 4F0BA 1SD9A 1YEPA 1EEMA 1KEBA 1FB0A 2YV9A 4NWYA 1EOGA 2A2RA 3QR6A 5CREA 2H1BA 5IQYA 3A3TA 4BWQA 1B4PA 2HRFA 3ZVJD 5F8BA 1GUHA 3ZLPA 1OAZA 3ZREA 2PMTA 3WGDA 3M3MA 4X43A 3QAVA 3NIVA 4NV2A 3UJ1A 1PX6A 3J7Yb 4YH2A 4YAPA 2V1MA 2GZPA 2C0FA 2MMOA 2DJKA 1TJDA 3D6IA 5EL8A 3U5RE 3W8SA 5DJLA 1JZOA 2CZ3A 5B6MA 1HNCA 1X9WB 3F9UA 3KTBA 3UBKA 5KN3A 5ENUA 2DJ2A 2VUPA 3F0IA 5D93A 4PQ1A 4RQRA 1T7PB 5F07A 1GSUA 2FD3A 4O92A 1XVWA 2M46A 3I6AA 4GTUA 3LXTA 2VCTA 1TW9A 1ZYQB 3CMIA 3TKSE 5DCHA 3GFKA 1TP9A 3GL3A 1FO5A 3H93A 2MBSA 5HR2A 2PN8A 4PURA 4POMA 2CAIA 5A5KA 2LRNA 2N5FA 16GSA 3DVXA 4Q5NA 5IMVA 2GSRA 4ZILA 4OWYA 4DSSB 1DSBA 3GRXA 1FW1A 4OO4A 5INYA 5B6NA 4KX4A 1E6BA 3GYKA 3MNGA 3QD9A 3IK7A 4GSTA 3C8EA 3GKMA 2RUFA 2ON7A 3KEBA 3HCZA 5EVOA 1YDKA 2CA8A 3FHKA 4FO5A 3SWLA 6GSWA 4MK3A 3TRPA 1BJXA 2RM6A 2IFQB 1MDIA 1SJ6A 1JZRA 4ECBA 1K3LA 4G10A 2LJAA 3EYTA 4I2TA 3DYRA 2K6VA 4KSMA 3HVVA 5CNWA 3LGCA 3RHCA 3F8UA 2C0DA 2PVOC 1BX9A 4MJBA 3HA9A 1QUWA 3EU4A 2IMIA 3W8JA 3F63A 3ZFBA 4J2FA 1OE8A 2HSHA 2VL2C 3A2XA 2H6YA 2VM1A 3L4NA 2FWFA 1S3CA 2L59A 2L5LA 3HVXA 4IKHA 1ZMAA 1QXHA 2VLUA 4EE0A 4K0NA 4K1FA 2LQQA 5GSTA 4XHMA 2DIYA 1QFNA 1VGLA 2IMFA 3CRTA 5HR0A 3G7IA 2AYTA 3FW2A 3IE3A 4L8EA 1TKDB 4EKZA 1YEXA 2H1DA 3P2AA 2AV4A 2HZFA 3M8NA 2MZCA 3APSA 1DUGA 3DEXA 5J41A 2LQOA 5ECNB 3FK8A 3GSTA 3P90A 1U88A 3GSSA 1F3AA 5KN0A 2O85A 5KN1A 2H75A 5DDLA 2V2GA 4XRDA 3D0ZA 4KDUA 5GZZB 5IMDA 3QPMA 1K0AA 4IP1A 5A4VA 4MJAA 1A2JA 2R3XA 2HE3A 3EWLA 3HXSA 4FYCA 3W6GA 2YWMA 5ECLB 5E4WA 2QSIA 1GSQA 1SU9A 1O81A 1K3YA 1RK4A 3TKSA 1SK0A 1O8WA 1GH2A 2FCHA 1AC1A 3NOFA 2BTOT 4KH7A 4TR4A 5ID2A 1SKRB 2C3TA 4CDOA 1BAYA 1E2YA 1WPIA 2K18A 1FVKA 3HYPA 1GSYA 1Z6NA 1NHOA 1JHBA 2H73A 1BYEA 4Q5QA 1O8XA 2GS3A 1N8JA 4YQUA 4TN8A 4HZ4A 4AJ7A 1J0FA 4PNFA 4JBBA 3EVIA 1K0CA 3GTUA 4F9ZA 5IOXA 1Z9HA 2WDUA 4ZXGA 4AGSA 4ZBAA 1Z7RA 3C73A 2D2ZA 4G19A 4XRAA 1XWKA 2C0EA 2GZZA 2TRXA 4YQVA 1WJKA 4GSNA 3L9VA 3I9V2 1RW1A 3QMXA 1SL0B 5L71A 3EINA 1Y25A 2F51A 2A2SA 5JCGA 4N10A 1MDKA 2P31A 2WULA 5IOWA 2EC4A 1PL1A 1MDJA 3OR5A 2H19A 1H4OA 4IQ1A 2VCVA 4PUFC 5ECOB 4IGJA 3ZVJA 4KDYA 1U3IA 1T3BA 1GUKA 5IMCA 4TRXA 2B7KA 2WRTA 4I8BA 4IN0A 5D9XA 3UVTA 3J7Yk 3ISOA 2EIQA 3D21A 3APQA 2LUSA 1A8YA 5H5RA 3K8NA 4QL7A 1NM3A 3L78A 1V9WA 4LLRA 2WFCA 3MAKA 10GSA 2LTKA 3MWHA 1USBA 4K9ZA 3F4TA 1PL2A 2FGXA 3IV4A 3P7XA 2AUVA 4V2LA 1Q98A 1YF1A 2L4CA 2QKEA 4QL9A 3KXOA 2GQKA 4KCAA 1FHEA 4NHZA 1F9MA 1HNBA 2FWHA 4OFTA 4OCEA 3QDNA 1J08A 1OC8A 2KUCA 2H30A 3APOA 4IBPA 3FRCA 1TK5B 4K0GA 6GSUA 2FUG2 2JZSA 18GSA 3GNJA 5CRWA 4MZBA 3N9JA 3FYGA 4HJ2A 3KTLA 4X0XA 4DEJA 1DBYA 4HU7A 3F3RA 2F8FA 3P8WA 5HR3A 3VI7A 1NW2A 3GKXA 1U87A 4G9HA 4NMUA 3QFAC 1OE7A 4IQAA 4L0UA 1K0BA 2DJ0A 2OADA 1F3BA 1A0FA 4MA9A 4MCUA 3O6TA 3KP9A 3GTUB 4TR3A 3LG6A 4LA1A 4OO5A 5ECKB 5CRGA 4EF0A 1VF3A 4BL7A 3CYNA 1XOAA 3KGKA 1IYIA 3CTGA 6GSTA 4KW6A 5HQPA 5F05A 3LYPA 1EGOA 5ELGA 4CHSA 4WETA 1M9AA 3LSZA 1R7HA 2VD0A 4OCFA 1EV9A 2RLIA 5ID2B 3LORA 3CBUA 4ECJA 1LJRA 2CAQA 3IOSA 2YJHA 1G7EA 4KB3A 1G6YA 4EXJA 2GSTA 1V58A 4ISDA 3QCPA 5ECIB 1XPVA 1OYJA 1FAAA 2L6DA 4HEA2 2DSAA 2H74A 5CRDA 5J5NA 2VLVA 1ZL9A 4HJMA 1B48A 1B9YC 3UARA 1JLWA 2OBIA 3TOUA 1XW9A 2EIOA 5DQSA 3FZ9A 3PINA 2E2MA 4L0WA 5GSSA 1PQNA 3IRAA 3RHBA 5IPGA 2JL4A 3GIXA 5ECRB 4MZCA 4WF5A 2PPTA 5E59A 3IHQA 1YF0A 2VCXA 2YWIA 14GSA 4FH8A 5ECSA 2LJRA 1X5DA 1Y6EA 5G2ZA 2LEGA 2PBJA 4HOJA 3ZFLA 3DIEA 2XBIA 2HFDA 5FT3A 2M80A 4WKWA 1O6JA 4TKYA 4POLA 1T4ZA 3U6VA 2JSYA 2CVKA 2I81A 3H1NA 4E8HA 9GSSA 1BG5A 5IM9A 2TRCP 5IMAA 4MF7A 2JZTA 2LJKA 5ECQB 3CXGA 5COHA 1ML6A 3HJOA 2YN1A 1M2DA 2RIIA 1YKCA 4JU5A 3A2VA 1TU8A 3WT1A 1TK0B 3ZIJA 1WP0A 5G31A 2OE1A 2H76A 1FG4A 2C4JA 1SD8A 4XS6A 3UMAA 4POBA 2XBQA 3GX0A 4ZBDA 3LYKA 3TJJA 2IFQA 5C04A 1X5CA 3FR3A 4OFNA 4GSSA 3FZ4A 2DJ3A 4JEDA 1YZXA 4J56E 1GSDA 2KHPA 4ML6A 5DJMA 4HUAA 3UOMA 4ECIA 1PD21 4EDYA 3DKSA 3ZITA 1XXUA 3ZZXA 1TI1A 1Z6MA 4HI7A 2ZNMA 2O89A 1F37A 17GSA 3LWAA 1ST9A 4XCSA 4MABA 4DSSA 3IDVA 2VO4A 2GT5A 3AY8A 3S9FA 2LSTA 4AJ8A 3LJRA 3HVSA 3Q74A 1KBNA 3DRNA 3O3TA 2H66A 4TOPA 4DVCA 3I69A 4PGTA 3BBYA 3RDWA 1EEJA 3ZIVA 4E8EA 1GP1A 4PXOA 5D9VA 3VI5A 4HS1A 2YWNA 4LMWA 3H8QA 4O7HA 2LRTA 1OKTA 2MBTA 4MMMA 4EO3A 5JWRB 1PGTA 2C8UA 5A4UA 3HY2A 4BPYA 1TDIA 5DCGA 4RUVA 3CTFA 5CAXA 19GSA 1GLQA 2K9FA 1N2AA 2DLXA 2A4VA 5HFKA 1JFUA 4ZB8A 1TXXA 4WEYA 4BVXA 5A4WA 2VIMA 2F8AA 4EVMA 4JRRA 4KCEA 3VWXA 4WBRD 4MP4A 5KN2A 4ZL7A 1G6WA 4POKA 2KP2A 1FOVA 2DBCA 3M1GA 4MZWA 2X99A 3ME7A 3TOTA 3FR9A 1R5PA 1QGVA 3VPTA 2FA4A 1ZGNA 1CQHA 4PQHA 2IN3A 1MTCA 1XOBA 4HDEA 1UA5A 22GSA 4XTSA 1ERTA 4GLTA 2X8GA 2PERA 2CQ9A 1G0TA 3KH9A 5FWGA 1XW6A 5D73A 2LKUA 4TVEA 4NXIA 4L5OA 3QAWA 4N0VA 2L6CA 2YPMA 2GQLA 5IMFA 3GV1A 1AQWA 2Z9SA 4AJ6A 3BCKA 1PMTA 4XS1A 3NZNA 2I9HA 3G7YA 2GDRA 3BCIA 3RAZA 4V1Ag 1J9BA 3TUEA 1TI3A 2VCZA 4FIWA 1R5AA 4KNDA 1ZOFA 3RBTA 3VWWA 2B3SA 1IYHA 1GTIA 5HFGA 8GSSA 1GNEA 2VOCA 5AIVA 1VF4A 3ZRDA 1WIKA 1DE1A 1XZOA 4EL1A 3D22A 3M9KA 5GAPD 1R26A 2VD1A 1ACVA 4K7NA 3ERWA 1Q4JA 4KDXA 4I5QA 3KMNA 6GSSA 1GSFA 1SL2B 4GCIA 4H86A 2VCQA 3GHAA 4K6XA 4J57E 2J9HA 2V32A 1O85A 4GQCA 1VF2A 2B5YA 3GN3A 2LV3A 4JZQA 1ABAA 3KIJA 4TXOA 2VL3A 5IO0A 2DMMA 3A2WA 2I4AA 5H5SA 4KAEA 4LL1B 1EOHA 3GH9A 1U3AA 3IK9A 4JE1A 3KJYA 1OC9B 1MEKA 1WRYA 4O32A 3HHVA 4I6XA 4K8MA 2GT6A 3E9JB 4LMVA 4ACSA 4IVFA 1YJ6A 1A2LA 3M9JA 4XS4B 1YKAA 2R2JA 3TDGA 2PGTA 2HZEA 1XBSA 2O87A 1EWXA 3CSIA 5DALA 1M2AA 4KGIA 1M2BA 2TIRA 4KSOA 3VPQA 1GTAA 2B1KA 2HI7A 1HNAA 2H0GA 3Q6OA 5CYYA 3L9SA 1M9BA 3A5WA 2MMZA 1X0RA 1VRSD 1GRXA 4N11A 3I43A 3DWVA 2JZRA 3VWVA 4JR6A 1YQ1A 4ZB9A 2C80A 4WR4A 2G2QA 3TJKA 2GQMA 3VURA 1PSQA 2CV4A 2OJLA 4MDCA 4NV5A 3MDKA 3TRQA 4IJ3A 4V1Ap 3HJPA 4XIHA 1GUMA 1ZZYA 4TW5A 3QOUA 2WB9A 2KOKA 4YAVA 1TRUA 2GLRA 4HQZA 3ERFA 1A2MA 1JZDA 3UIWA 1ZCPA 2JSZA 2YP6A 5G5EA 1PX7A 2J23A 1T1VA 2R4VA 4K7IA 4MH3A 3Q19A 5ELAA 4TR1B 4ML1A 1SYXA 1PA3A 2DJ1A 2WGRA 4ZL9A 1U6TA 1HYUA 3D4TA 2B6MA 4YQMA 5JCUA 2DIZA 5B8AA 3WGEA 5D96A 1WOUA 3LEFA 1F2EA 4WBJA 4TXVA 3WD6A 3ME8A 1ERVA 2VM2A 3F4RA 5CO3A 3TKQA 4HU9A 5J9CA 5CP1A 4IHUA 1A23A 2C1YA 1AUCA 2CVDA 4GF0A 4MJEA 3F3QA 2K8VA 2B5EA 1LBKA 2JADA 1MD4A 2WJUA 2OACA 1K0NA 2K8SA 2H1AA 5AISA 3F6DA 2LNTA 4GWRA 4ULXA 3O76A 1OVNA 1I9DA 3TCOA 4RI6A 2IMKA 2ES7A 3TJGA 2M72A 3IPZA 2XPDA 3GL5A
chains in the Genus database with same CATH superfamily
2KLXA 4KA0A 3PH9A 4ILFA 3ED3A 2HNLA 3LQ7A 4OFMA 3FNBA 1THXA 4HEA1 3N5OA 4YZDA 1XWCA 3HZ8A 5LD0A 1RQMA 5J3RA 2CZ2A 2YZUA 3FZAA 4O5RA 5G1KA 5DVBA 4TR0A 2BJXA 2KP1A 2HSYA 2L57A 2HYXA 2HXKA 1UN2A 1U5KA 4MPFA 5F0GA 1T4YA 1V98A 5G1LA 1JLVA 4YZCA 4DWLA 5J4UA 5LCZA 4Z7HA 4F0CA 3DVWA 1Z7PA 1W89A 1SL1B 3VA9A 4FQUA 1EP7A 1W4VA 2MMAA 2A2DA 3TJBA 6GSYA 2R37A 1KNGA 4AF2A 3ZMKA 1Z5YE 2I1UA 5D9WA 5F06A 2HRNA 4FYUA 2CX3A 1XFLA 2R0CA 1S3RA 1V2AA 3DMLA 2YZHA 1M0UA 5AIXA 5B8BA 1K0OA 3SBCA 3H4KA 1SKWB 3M0FA 2B7JA 3KM6A 2X8CA 5DAKB 2PU9C 5JCWA 11GSA 3PGTA 1FVJA 5IMZA 2E2GA 4Z2TA 1BEDA 2PVQA 4D73B 6GSXA 5KEJA 2CT6A 1EGRA 4BIKA 3KP8A 2YWOA 3DA3A 4G2EA 3IAM2 2R5GA 3QAGA 1HQOA 4Q5FA 3C71A 5J9BA 2RIOA 3WYWA 2XTQA 2O7KA 2R6KA 1GWCA 2REMA 1QMVA 1SYRA 3GKNA 5G30A 1EZKA 4HQSA 3V1WA 1X9MB 3BJ5A 5ECMB 5JWOB 5AGYA 1I5GA 3ZTLA 4O1PA 5C00A 1PKWA 4F82A 1GULA 2GTUA 4DSRA 2DMLA 2WZ9A 3FR6A 1XWAA 5IIZA 3F4SA 3GKKA 5ABRA 3HZ4A 2OBKA 1K0DA 2P5QA 1ZYEA 2XHFA 3G9BA 1PKZA 1XWBA 1OC3A 2CVBA 4RQXA 5DQYA 4NAXA 4V2MA 1WWJA 3FZ5A 3UITA 1EV4A 4Z7XA 4F2IA 1BQ7A 2FWGA 3UBLA 1NHYA 2G0FA 2O8VB 1AIUA 3DA4A 3EE2A 3R2QA 1XW5A 2C3NA 3IHGA 1ERUA 20GSA 1TRSA 4N0ZA 4D73A 2VL9A 2P0GA 4PX1A 1O7UA 5CRHA 4DSQA 2HLSA 3RPPA 4ZIJA 2DJJA 1QK8A 3G7JA 2OE0A 3PR8A 5KOWA 5DAKA 2PWJA 3C7MA 3EURA 4MH2A 3F4MA 3LXZA 3KMOA 4MNNA 1S3AA 5EY6A 1ILOA 4EDZA 2FNOA 2V41A 1M99A 1X5EA 2PUKC 3VFIA 1SJZA 1FOHA 2FLSA 1TK8B 4K2DA 2NVLA 4NPBA 2RUEA 3IAS2 2H72A 2FY6A 1O73A 3PPUA 2NPBA 2WCIA 1X9SB 5EPFA 2QGMA 1GSSA 3RPNA 2BMXA 5HFIA 2RM5A 3TKPA 3FEUA 4I2UA 3Q18A 1GL8A 2EIRA 4PNGA 3TKSC 3UAPA 5ECPB 4MLYA 3BOAA 2VCWA 3E3EA 1B4QA 3GX8A 2N5AA 2H01A 4WR5A 3TJFA 1Z3EA 2AHEA 1SK2A 3TB2A 1H75A 2B1LA 1A0RP 2QGVA 4ICYA 1TU7A 3EU3A 4CW9A 2F9SA 4GRFA 5D9TA 1M7TA 2H6ZA 2X64A 4LL4B 3IR4A 4EC0A 4G0IA 1AXDA 4GXTA 2WS2A 1YY7A 4IP6A 6GSVA 1GTUA 5KOXA 2NTOA 1NSWA 1V40A 4GQFA 1QQ2A 5JWQB 3HD5A 4ZBBA 3GMFA 2HSMA 3TGZA 3VWUA 1THOA 4KE3A 1SENA 1XCCA 3VK9A 5HR1A 12GSA 2IWTA 1ERWA 2H70A 4PUAA 1SKSB 3I9V1 1V57A 2IIYA 2AAWA 2X8HA 3GA4A 1T8EB 3ZL5A 2JU5A 3FY7A 3VLNA 1C72A 3CSJA 13GSA 5B7CA 3D5JA 1GNWA 3GURA 3ZYWA 3IC4A 3EC3A 2YFBA 3US3A 4KUNA 3UEMA 3CQFA 3UVHA 2JBWA 2E7PA 4TR1A 2MYGA 3E0UA 3GH6A 4BVYA 2GSQA 4NHWA 3F6FA 5ECHB 2VL2A 2JACA 3IBHA 2IMDA 1T00A 2IMEA 1PN0A 2P5RA 4ECCA 1XWGA 2YV7A 3L9UA 3IXRA 4V2NA 1KTEA 5G5FA 2NDOA 2C0GA 2IPAA 2X4AA 2YANA 4HZ2A 2ALBA 5H5QA 7GSSA 4P3YB 2H0HA 2H71A 1TTZA 1CQGA 1XVQA 2FWEA 3GUSA 1JZWA 2LRCA 1B8XA 1WE0A 2E0QA 2LS5A 1AW9A 4IS0A 1TRVA 1A24A 3ERGA 2DKHA 3DD3A 4QQ7A 2A4HA 2XPEA 1XIYA 2LNSA 2FA8A 2HT9A 1K3OA 5FHIA 4FYBA 2YJ7A 2F3MA 2DC5A 3ZMLA 2AB6A 2ON5A 1LU4A 1UC7A 4IW9A 3D4MA 5DALB 2FHEA 3WGXA 2HZEB 2B5XA 2V6OA 4IELA 4ID0A 4XS4A 3R3EA 2V6KA 3HDCA 2K19A 1OKDA 4F03A 2CX4A 5LNKe 2ZUPA 2IL3A 3C1SA 3KCMA 4I97A 2N5BA 1PRXA 2L5OA 2QC7A 2GSSA 3EPTA 1OC9A 3TKRA 2L1LB 3MSZA 5D8IA 3DXBA 3IA1A 1SJIA 1HD2A 3KZQA 2C3QA 2GGTA 1AQVA 5LNK1 1GLPA 2H1GA 1AQXA 2I3YA 3BD2A 2ZCTA 2MMNA 1TRWA 4MJCA 3FKFA 4WF4A 4ZB6A 2VLTA 3HJMA 4PQIA 3L0HA 5BMUA 2H8LA 2YCDA 2H6XA 1SK1A 3EMPA 4TXOB 1R4WA 3H79A 2OKAA 4K2XA 3KD0A 1M3JA 1PN9A 3WT2A 2NBSA 3JCML 2MJFB 1GSEA 1A8LA 1G7OA 2GZYA 1MD3A 1AAZA 2L4QA 4JR4A 4RI7A 1TOFA 3QFBC 4L5LA 1K0MA 2YNXA 5AN1A 4IJIA 3HKRA 4MPGA 2VAFA 1EP8A 1F6MC 1ON4A 2GVPA 2IP6A 2H0IA 4OMVA 3AJFA 4MF6A 3CSHA 4GXZA 4K7OA 3C1RA 1UVZA 5IO2A 3TRXA 4ZL8A 1DE2A 3MYDA 5DBQA 2YOIA 3DGQA 4WXTA 4X1UA 4N30A 1URMA 5GAND 4OD7A 1FB6A 4MF5A 2IJYA 4BA7A 5IPHA 3EMXA 1VF1A 1B9XC 2XC2A 3KH7A 4BWSA 1S3DA 3LFLA 2AJQB 2OA7A 4Q5RA 1WMJA 2OE3A 4EUYA 2V1CC 1GTBA 4G0LA 3UL3A 3CRUA 4KF9A 4F0BA 1SD9A 1YEPA 1EEMA 1KEBA 1FB0A 2YV9A 4NWYA 1EOGA 2A2RA 3QR6A 5BRTA 5CREA 2H1BA 5IQYA 3A3TA 4BWQA 1B4PA 2HRFA 3ZVJD 5F8BA 1GUHA 3ZLPA 1OAZA 4CY6A 3ZREA 2PMTA 3WGDA 3M3MA 4X43A 3QAVA 3NIVA 4NV2A 3UJ1A 2F6MB 1PX6A 3J7Yb 4YH2A 4YAPA 2V1MA 2GZPA 2C0FA 2MMOA 2DJKA 1TJDA 3D6IA 5EL8A 3U5RE 3W8SA 5DJLA 1JZOA 3Q8DA 2CZ3A 5B6MA 1HNCA 4BVXB 1X9WB 3F9UA 3KTBA 3UBKA 5KN3A 5ENUA 2DJ2A 4U6RA 2ETDA 2VUPA 3F0IA 5D93A 4PQ1A 4RQRA 1T7PB 5F07A 1GSUA 2FD3A 4O92A 1XVWA 2M46A 3I6AA 4GTUA 3LXTA 2VCTA 1TW9A 1ZYQB 3CMIA 3TKSE 5DCHA 3GFKA 3LJ1A 1TP9A 3GL3A 1FO5A 3H93A 2MBSA 5HR2A 2PN8A 4PURA 4POMA 2CAIA 5A5KA 2LRNA 2N5FA 16GSA 3DVXA 4Q5NA 5IMVA 4Q9VA 2GSRA 4ZILA 4OWYA 4DSSB 3IAM1 1DSBA 3GRXA 1FW1A 2R0GA 4OO4A 5INYA 5B6NA 4KX4A 1E6BA 3GYKA 3MNGA 3QD9A 3IK7A 4GSTA 3C8EA 3GKMA 2RUFA 2ON7A 3KEBA 3HCZA 5EVOA 1YDKA 2CA8A 3FHKA 4FO5A 3SWLA 6GSWA 4MK3A 3TRPA 1BJXA 2RM6A 2IFQB 1MDIA 1SJ6A 3IC8A 1JZRA 4ECBA 1K3LA 4G10A 4Z2UA 2LJAA 3EYTA 4I2TA 3DYRA 2K6VA 4KSMA 3HVVA 5CNWA 3LGCA 3RHCA 3F8UA 2C0DA 2PVOC 1BX9A 1PFOA 4MJBA 3HA9A 1QUWA 4YKFA 3EU4A 2IMIA 3W8JA 3F63A 4J2FA 3ZFBA 1OE8A 2HSHA 2VL2C 4O5QA 3A2XA 2H6YA 2VM1A 3L4NA 2FWFA 1S3CA 2L59A 2L5LA 3HVXA 4IKHA 1ZMAA 1QXHA 2VLUA 3JSBA 4EE0A 4K0NA 4K1FA 2LQQA 5GSTA 4XHMA 2DIYA 1QFNA 1VGLA 3P23A 2JAEA 2IMFA 3CRTA 5HR0A 3G7IA 2AYTA 3FW2A 3IE3A 4L8EA 1TKDB 4EKZA 1YEXA 2H1DA 3P2AA 2AV4A 2HZFA 3M8NA 2MZCA 2QA1A 3APSA 1DUGA 3DEXA 5J41A 2LQOA 5ECNB 3FK8A 3GSTA 3P90A 1U88A 3GSSA 1F3AA 5KN0A 2O85A 3FVVA 5KN1A 2H75A 5DDLA 2V2GA 2QSBA 4XRDA 3D0ZA 4KDUA 5GZZB 5IMDA 3QPMA 1K0AA 4IP1A 5A4VA 4AS2A 4MJAA 1A2JA 2R3XA 2HE3A 3EWLA 3HXSA 4FYCA 3W6GA 2YWMA 5ECLB 5E4WA 2QSIA 1GSQA 1SU9A 1O81A 2QZGA 1K3YA 1RK4A 3TKSA 1SK0A 1O8WA 1GH2A 2FCHA 1AC1A 3NOFA 2BTOT 4PL5A 4KH7A 4TR4A 5ID2A 1SKRB 2C3TA 4CDOA 1BAYA 1E2YA 1WPIA 2K18A 1FVKA 3HYPA 1GSYA 1Z6NA 1NHOA 1JHBA 2H73A 1BYEA 4Q5QA 1O8XA 5HGIA 2GS3A 1N8JA 4BL7B 4YQUA 4TN8A 4HZ4A 4AJ7A 1J0FA 4PNFA 4JBBA 3EVIA 1K0CA 3GTUA 4F9ZA 5IOXA 1Z9HA 2WDUA 2QA2A 4JCVE 4ZXGA 4AGSA 4CY8A 4ZBAA 1Z7RA 3C73A 2D2ZA 4G19A 4XRAA 1XWKA 2C0EA 2GZZA 2TRXA 4YQVA 1WJKA 4GSNA 3L9VA 3I9V2 1RW1A 2ZRRA 3QMXA 1SL0B 5L71A 3EINA 4OAVB 1Y25A 2F51A 2A2SA 5JCGA 4N10A 1MDKA 2P31A 2WULA 5IOWA 2EC4A 1PL1A 1MDJA 2A2PA 1XG8A 3OR5A 4G75A 2H19A 1H4OA 4IQ1A 2VCVA 4PUFC 5ECOB 4IGJA 3ZVJA 4KDYA 1U3IA 1T3BA 1GUKA 5IMCA 4TRXA 2B7KA 2WRTA 4I8BA 4IN0A 5D9XA 3UVTA 3J7Yk 3ISOA 2EIQA 3D21A 3APQA 2LUSA 1A8YA 5H5RA 3K8NA 4QL7A 1NM3A 3L78A 1V9WA 4LLRA 2WFCA 3MAKA 10GSA 2LTKA 3MWHA 1USBA 4K9ZA 3F4TA 1PL2A 2FGXA 3IV4A 3P7XA 2AUVA 4V2LA 1Q98A 1ZYPA 1YF1A 2L4CA 2QKEA 4QL9A 3KXOA 2GQKA 4KCAA 1FHEA 4NHZA 1F9MA 1HNBA 2FWHA 4OFTA 4OCEA 3QDNA 1J08A 1OC8A 2KUCA 2H30A 3APOA 4IBPA 3FRCA 1TK5B 4K0GA 6GSUA 2FUG2 2JZSA 18GSA 3GNJA 5CRWA 4MZBA 3N9JA 3FYGA 4HJ2A 3KTLA 4X0XA 3B55A 4DEJA 1DBYA 2F66B 4HU7A 3F3RA 2F8FA 3P8WA 5HR3A 3VI7A 1NW2A 3GKXA 1U87A 4G9HA 4NMUA 3QFAC 1YO7A 1OE7A 4IQAA 4L0UA 1K0BA 2DJ0A 2OADA 1F3BA 4X4JA 1A0FA 4MA9A 4MCUA 3O6TA 3KP9A 3GTUB 4A5PA 4TR3A 3LG6A 4LA1A 4OO5A 5ECKB 5CRGA 4EF0A 1VF3A 4BL7A 3CYNA 1XOAA 3KGKA 1IYIA 3CTGA 4Z2RA 6GSTA 4KW6A 5HQPA 5F05A 3LYPA 1EGOA 5ELGA 4CHSA 4WETA 2X49A 1M9AA 3LSZA 1R7HA 2VD0A 4OCFA 1EV9A 2RLIA 3LJ0A 3LORA 5ID2B 3CBUA 4ECJA 1LJRA 2CAQA 2BL8A 3IOSA 2YJHA 1G7EA 4KB3A 1G6YA 4EXJA 2GSTA 1V58A 4ISDA 3QCPA 4K5RA 5ECIB 1XPVA 3LW9A 1OYJA 1FAAA 2L6DA 2FU2A 4HEA2 2DSAA 2ZW3A 2H74A 5CRDA 5J5NA 2VLVA 1ZL9A 4HJMA 1B48A 1B9YC 3UARA 1JLWA 2OBIA 3TOUA 1XW9A 2EIOA 5DQSA 3FZ9A 3PINA 2E2MA 4L0WA 5GSSA 1PQNA 3IRAA 3RHBA 5IPGA 2JL4A 3GIXA 5ECRB 4MZCA 4WF5A 2PPTA 5E59A 3IHQA 1YF0A 2VCXA 2YWIA 14GSA 4FH8A 5ECSA 2LJRA 2KKMA 1X5DA 4G0KA 1Y6EA 5G2ZA 2LEGA 2PBJA 4HOJA 3ZFLA 3DIEA 2XBIA 2HFDA 5FT3A 2FEFA 2M80A 4O5UA 4WKWA 1O6JA 4TKYA 4POLA 1T4ZA 3U6VA 2JSYA 1SJ8A 3SDJA 2CVKA 2I81A 3H1NA 4E8HA 9GSSA 1BG5A 5IM9A 2TRCP 5IMAA 4HSCX 4MF7A 2JZTA 2LJKA 5ECQB 3CXGA 5COHA 1ML6A 2HRAA 3HJOA 2YN1A 1M2DA 2RIIA 1YKCA 4JU5A 3A2VA 1TU8A 3WT1A 1TK0B 4AS3A 2JB2A 4G76A 3ZIJA 1WP0A 5G31A 2OE1A 4YKGA 2H76A 1FG4A 2C4JA 1SD8A 4XS6A 3UMAA 4POBA 2XBQA 3GX0A 4ZBDA 3LYKA 3TJJA 2IFQA 5C04A 1X5CA 3FR3A 4OFNA 4GSSA 3FZ4A 2DJ3A 4JEDA 1YZXA 4J56E 1GSDA 2KHPA 4ML6A 5DJMA 4HUAA 3UOMA 4ECIA 1PD21 4EDYA 3DKSA 3ZITA 1XXUA 3ZZXA 1TI1A 1Z6MA 4HI7A 2ZNMA 3L0IA 2O89A 1F37A 17GSA 3LWAA 1ST9A 4XCSA 4MABA 4DSSA 3IDVA 2VO4A 2GT5A 3AY8A 3S9FA 2LSTA 4AJ8A 3LJRA 3HVSA 3Q74A 1KBNA 3DRNA 3O3TA 2RADA 2H66A 4TOPA 4DVCA 3I69A 4PGTA 3BBYA 3RDWA 1EEJA 1W3SA 3ZIVA 4E8EA 1GP1A 4PXOA 5D9VA 3VI5A 4HS1A 2YWNA 4LMWA 3H8QA 4O7HA 2GSCA 2LRTA 1OKTA 2UZ8A 2MBTA 4MMMA 4EO3A 5JWRB 1PGTA 2C8UA 5A4UA 3HY2A 4BPYA 1TDIA 5DCGA 4RUVA 3CTFA 5CAXA 19GSA 1GLQA 2K9FA 1N2AA 2DLXA 2A4VA 5HFKA 1JFUA 2R0PA 4ZB8A 1TXXA 4WEYA 4BVXA 5A4WA 2VIMA 2F8AA 4EVMA 4JRRA 4KCEA 3VWXA 4WBRD 1JQOA 4MP4A 5KN2A 4ZL7A 2A2CA 4PL3A 1G6WA 4POKA 2KP2A 1FOVA 2DBCA 3M1GA 4MZWA 2X99A 3ME7A 3TOTA 2E8GA 3FR9A 1R5PA 1QGVA 3VPTA 2FA4A 1ZGNA 1CQHA 4PQHA 2IN3A 1MTCA 1XOBA 4HDEA 4USSA 4K5SA 1UA5A 2HGKA 22GSA 4XTSA 1ERTA 2DKIA 4GLTA 2X8GA 2PERA 2CQ9A 1G0TA 3KH9A 5FWGA 1XW6A 5D73A 2LKUA 4TVEA 4I1TA 4NXIA 4L5OA 3QAWA 4N0VA 2L6CA 2YPMA 2GQLA 2XMXA 5IMFA 3GV1A 1AQWA 2Z9SA 4AJ6A 3BCKA 1PMTA 3LJ2A 4XS1A 3NZNA 2I9HA 3G7YA 2GDRA 3BCIA 3RAZA 4V1Ag 2BL7A 1J9BA 3FMWA 3TUEA 1TI3A 2VCZA 4FIWA 1R5AA 4KNDA 1ZOFA 3RBTA 3VWWA 2B3SA 1IYHA 3MIXA 1GTIA 5HFGA 8GSSA 3FBVA 1GNEA 1TDPA 2VOCA 5AIVA 1VF4A 3ZRDA 1WIKA 1DE1A 1XZOA 4EL1A 3D22A 3M9KA 5GAPD 1R26A 2VD1A 1ACVA 4K7NA 3ERWA 4YZ9A 1Q4JA 4KDXA 4I5QA 2RLDA 3KMNA 6GSSA 1GSFA 1SL2B 4GCIA 4H86A 2VCQA 3GHAA 4K6XA 4J57E 2J9HA 2V32A 1O85A 4GQCA 1VF2A 2B5YA 3GN3A 2YFAA 2LV3A 4JZQA 1ABAA 3KIJA 4TXOA 2VL3A 5IO0A 2DMMA 3A2WA 2I4AA 5H5SA 4KAEA 4LL1B 3A5IA 1EOHA 3GH9A 1U3AA 3IK9A 4JE1A 3KJYA 4EIPA 1OC9B 1MEKA 1WRYA 4O32A 3HHVA 4I6XA 4K8MA 2GT6A 3E9JB 2CAZB 4LMVA 4ACSA 4IVFA 1YJ6A 1A2LA 3M9JA 4XS4B 1YKAA 2R2JA 2PGTA 3CSIA 2HZEA 1XBSA 2O87A 1EWXA 3TDGA 5DALA 1M3IA 1M2AA 4KGIA 1M2BA 2TIRA 4KSOA 3VPQA 1GTAA 2JB1A 2B1KA 2HI7A 1HNAA 2H0GA 3Q6OA 4Z7GA 5CYYA 3L9SA 1M9BA 3A5WA 2MMZA 1X0RA 1VRSD 3HVNA 1GRXA 4N11A 3I43A 3DWVA 2JZRA 3DO9A 4JR6A 3VWVA 3IAS1 1YQ1A 4OAUC 4ZB9A 2C80A 4WR4A 2G2QA 4PTSA 3TJKA 2GQMA 3VURA 1PSQA 2CV4A 2OJLA 2P22B 4MDCA 4NV5A 3MDKA 3TRQA 4IJ3A 4V1Ap 3HJPA 4XIHA 1GUMA 1ZZYA 4TW5A 3QOUA 2WB9A 2V6EA 2KOKA 4YAVA 1TRUA 2XTRA 2GLRA 4HQZA 3ERFA 1A2MA 1JZDA 3UIWA 1ZCPA 2JSZA 2YP6A 5G5EA 4EIQA 1PX7A 2J23A 1T1VA 2R4VA 4BVYB 4HFVA 4K7IA 4MH3A 3Q19A 5ELAA 4TR1B 4ML1A 1SYXA 1PA3A 2DJ1A 2WGRA 4ZL9A 1U6TA 2FUG1 1HYUA 3D4TA 2B6MA 4YQMA 5JCUA 2DIZA 5B8AA 3WGEA 5D96A 1WOUA 3LEFA 1F2EA 4WBJA 4TXVA 3WD6A 4PL4A 3ME8A 1ERVA 2VM2A 3F4RA 5CO3A 3TKQA 4HU9A 5J9CA 5CP1A 1ZYNA 4IHUA 1A23A 2C1YA 1AUCA 2CVDA 4GF0A 4MJEA 3F3QA 2K8VA 2JB3A 2B5EA 1LBKA 2JADA 1MD4A 2WJUA 2OACA 1K0NA 2K8SA 2H1AA 5AISA 3F6DA 2LNTA 4GWRA 4ULXA 3O76A 1OVNA 4O1OA 1I9DA 3TCOA 4RI6A 2IMKA 2ES7A 3TJGA 2M72A 3IPZA 2XPDA 2HRKA 3GL5A
chains in the Genus database with same CATH topology
2KLXA 4KA0A 3PH9A 4ILFA 3ED3A 2HNLA 3LQ7A 4OFMA 1THXA 4HEA1 3N5OA 4YZDA 1XWCA 3HZ8A 5LD0A 1RQMA 5J3RA 2CZ2A 2YZUA 3FZAA 4O5RA 5G1KA 5DVBA 4TR0A 2BJXA 2KP1A 2HSYA 2L57A 2HYXA 2HXKA 1UN2A 1U5KA 4MPFA 5F0GA 1T4YA 1V98A 5G1LA 1JLVA 4YZCA 4DWLA 5J4UA 5LCZA 4Z7HA 4F0CA 3DVWA 1Z7PA 1W89A 1SL1B 3VA9A 4FQUA 1EP7A 1W4VA 2MMAA 2A2DA 3TJBA 6GSYA 2R37A 1KNGA 4AF2A 3ZMKA 1Z5YE 2I1UA 5D9WA 5F06A 2HRNA 4FYUA 2CX3A 1XFLA 2R0CA 1V2AA 3DMLA 2YZHA 1M0UA 5AIXA 5B8BA 1K0OA 3SBCA 3H4KA 1SKWB 3M0FA 2B7JA 3KM6A 2X8CA 5DAKB 2PU9C 5JCWA 11GSA 3PGTA 1FVJA 5IMZA 2E2GA 4Z2TA 1BEDA 2PVQA 4D73B 6GSXA 5KEJA 2CT6A 1EGRA 3KP8A 2YWOA 3DA3A 4G2EA 3IAM2 2R5GA 3QAGA 1HQOA 4Q5FA 3C71A 5J9BA 2RIOA 3WYWA 2XTQA 2O7KA 2R6KA 1GWCA 2REMA 1QMVA 1SYRA 3GKNA 5G30A 1EZKA 4HQSA 3V1WA 1X9MB 3BJ5A 5ECMB 5JWOB 5AGYA 1I5GA 3ZTLA 4O1PA 5C00A 1PKWA 4F82A 1GULA 2GTUA 4DSRA 2DMLA 2WZ9A 3FR6A 1XWAA 5IIZA 3F4SA 3GKKA 5ABRA 3HZ4A 2OBKA 1K0DA 2P5QA 1ZYEA 2XHFA 3G9BA 1PKZA 1XWBA 1OC3A 2CVBA 4RQXA 5DQYA 4NAXA 4V2MA 1WWJA 3FZ5A 3UITA 1EV4A 4Z7XA 4F2IA 1BQ7A 2FWGA 3UBLA 1NHYA 2G0FA 2O8VB 1AIUA 3DA4A 3EE2A 3R2QA 1XW5A 2C3NA 3IHGA 1ERUA 20GSA 1TRSA 4N0ZA 4D73A 2VL9A 2P0GA 4PX1A 1O7UA 5CRHA 4DSQA 2HLSA 3RPPA 4ZIJA 2DJJA 1QK8A 3G7JA 2OE0A 3PR8A 5KOWA 5DAKA 2PWJA 3C7MA 3EURA 4MH2A 3F4MA 3LXZA 3KMOA 4MNNA 1S3AA 5EY6A 1ILOA 4EDZA 2FNOA 2V41A 1M99A 1X5EA 2PUKC 3VFIA 1SJZA 1FOHA 2FLSA 1TK8B 4K2DA 2NVLA 4NPBA 2RUEA 3IAS2 2H72A 2FY6A 1O73A 3PPUA 2NPBA 2WCIA 1X9SB 5EPFA 1GSSA 3RPNA 2BMXA 5HFIA 2RM5A 3TKPA 3FEUA 4I2UA 3Q18A 1GL8A 2EIRA 4PNGA 3TKSC 3UAPA 5ECPB 4MLYA 3BOAA 2VCWA 3E3EA 1B4QA 3GX8A 2N5AA 2H01A 4WR5A 3TJFA 1Z3EA 2AHEA 1SK2A 3TB2A 1H75A 2B1LA 1A0RP 2QGVA 4ICYA 1TU7A 3EU3A 4CW9A 2F9SA 4GRFA 5D9TA 1M7TA 2H6ZA 2X64A 4LL4B 3IR4A 4EC0A 4G0IA 1AXDA 4GXTA 2WS2A 1YY7A 4IP6A 6GSVA 1GTUA 5KOXA 2NTOA 1NSWA 1V40A 4GQFA 1QQ2A 5JWQB 3HD5A 4ZBBA 3GMFA 2HSMA 3TGZA 3VWUA 1THOA 4KE3A 1SENA 1XCCA 3VK9A 5HR1A 12GSA 2IWTA 1ERWA 2H70A 4PUAA 1SKSB 3I9V1 1V57A 2IIYA 2AAWA 2X8HA 3GA4A 1T8EB 3ZL5A 2JU5A 3FY7A 3VLNA 1C72A 3CSJA 13GSA 5B7CA 3D5JA 1GNWA 3GURA 3ZYWA 3IC4A 3EC3A 2YFBA 3US3A 4KUNA 3UEMA 3UVHA 2E7PA 4TR1A 2MYGA 3E0UA 3GH6A 4BVYA 2GSQA 4NHWA 3F6FA 5ECHB 2VL2A 2JACA 3IBHA 2IMDA 1T00A 2IMEA 1PN0A 2P5RA 4ECCA 1XWGA 2YV7A 3L9UA 3IXRA 4V2NA 1KTEA 5G5FA 2NDOA 2C0GA 2IPAA 2X4AA 2YANA 4HZ2A 2ALBA 5H5QA 7GSSA 4P3YB 2H0HA 2H71A 1TTZA 1CQGA 1XVQA 2FWEA 3GUSA 1JZWA 2LRCA 1B8XA 1WE0A 2E0QA 2LS5A 1AW9A 4IS0A 1TRVA 1A24A 3ERGA 2DKHA 3DD3A 4QQ7A 2A4HA 2XPEA 1XIYA 2LNSA 2FA8A 2HT9A 1K3OA 5FHIA 4FYBA 2YJ7A 2F3MA 2DC5A 3ZMLA 2AB6A 2ON5A 1LU4A 1UC7A 4IW9A 3D4MA 5DALB 2FHEA 3WGXA 2HZEB 2B5XA 2V6OA 4IELA 4ID0A 4XS4A 3R3EA 2V6KA 3HDCA 2K19A 1OKDA 4F03A 2CX4A 5LNKe 2ZUPA 2IL3A 3C1SA 3KCMA 4I97A 2N5BA 1PRXA 2L5OA 2QC7A 2GSSA 3EPTA 1OC9A 3TKRA 2L1LB 3MSZA 5D8IA 3DXBA 3IA1A 1SJIA 1HD2A 3KZQA 2C3QA 2GGTA 1AQVA 5LNK1 1GLPA 2H1GA 1AQXA 2I3YA 3BD2A 2ZCTA 2MMNA 1TRWA 4MJCA 3FKFA 4WF4A 4ZB6A 2VLTA 3HJMA 4PQIA 3L0HA 5BMUA 2H8LA 2YCDA 2H6XA 1SK1A 3EMPA 4TXOB 1R4WA 3H79A 2OKAA 4K2XA 3KD0A 1PN9A 3WT2A 2NBSA 3JCML 2MJFB 1GSEA 1A8LA 1G7OA 2GZYA 1MD3A 1AAZA 2L4QA 4JR4A 4RI7A 1TOFA 3QFBC 4L5LA 1K0MA 2YNXA 5AN1A 4IJIA 3HKRA 4MPGA 2VAFA 1EP8A 1F6MC 1ON4A 2GVPA 2IP6A 2H0IA 4OMVA 3AJFA 4MF6A 3CSHA 4GXZA 4K7OA 3C1RA 1UVZA 5IO2A 3TRXA 4ZL8A 1DE2A 3MYDA 5DBQA 2YOIA 3DGQA 4WXTA 4X1UA 4N30A 1URMA 5GAND 4OD7A 1FB6A 4MF5A 2IJYA 4BA7A 5IPHA 3EMXA 1VF1A 1B9XC 2XC2A 3KH7A 4BWSA 1S3DA 3LFLA 2AJQB 2OA7A 4Q5RA 1WMJA 2OE3A 4EUYA 2V1CC 1GTBA 4G0LA 3UL3A 3CRUA 4KF9A 4F0BA 1SD9A 1YEPA 1EEMA 1KEBA 1FB0A 2YV9A 4NWYA 1EOGA 2A2RA 3QR6A 5BRTA 5CREA 2H1BA 5IQYA 3A3TA 4BWQA 1B4PA 2HRFA 3ZVJD 5F8BA 1GUHA 3ZLPA 1OAZA 4CY6A 3ZREA 2PMTA 3WGDA 3M3MA 4X43A 3QAVA 3NIVA 4NV2A 3UJ1A 2F6MB 1PX6A 3J7Yb 4YH2A 4YAPA 2V1MA 2GZPA 2C0FA 2MMOA 2DJKA 1TJDA 3D6IA 5EL8A 3U5RE 3W8SA 5DJLA 1JZOA 3Q8DA 2CZ3A 5B6MA 1HNCA 4BVXB 1X9WB 3F9UA 3KTBA 3UBKA 5KN3A 5ENUA 2DJ2A 4U6RA 2VUPA 3F0IA 5D93A 4PQ1A 4RQRA 1T7PB 5F07A 1GSUA 2FD3A 4O92A 1XVWA 2M46A 3I6AA 4GTUA 3LXTA 2VCTA 1TW9A 1ZYQB 3CMIA 3TKSE 5DCHA 3GFKA 3LJ1A 1TP9A 3GL3A 1FO5A 3H93A 2MBSA 5HR2A 2PN8A 4PURA 4POMA 2CAIA 5A5KA 2LRNA 2N5FA 16GSA 3DVXA 4Q5NA 5IMVA 4Q9VA 2GSRA 4ZILA 4OWYA 4DSSB 3IAM1 1DSBA 3GRXA 1FW1A 2R0GA 4OO4A 5INYA 5B6NA 4KX4A 1E6BA 3GYKA 3MNGA 3QD9A 3IK7A 4GSTA 3C8EA 3GKMA 2RUFA 2ON7A 3KEBA 3HCZA 5EVOA 1YDKA 2CA8A 3FHKA 4FO5A 3SWLA 6GSWA 4MK3A 3TRPA 1BJXA 2RM6A 2IFQB 1MDIA 1SJ6A 3IC8A 1JZRA 4ECBA 1K3LA 4G10A 4Z2UA 2LJAA 3EYTA 4I2TA 3DYRA 2K6VA 4KSMA 3HVVA 5CNWA 3LGCA 3RHCA 3F8UA 2C0DA 2PVOC 1BX9A 4MJBA 3HA9A 1QUWA 4YKFA 3EU4A 2IMIA 3W8JA 3F63A 4J2FA 3ZFBA 1OE8A 2HSHA 2VL2C 4O5QA 3A2XA 2H6YA 2VM1A 3L4NA 2FWFA 1S3CA 2L59A 2L5LA 3HVXA 4IKHA 1ZMAA 1QXHA 2VLUA 3JSBA 4EE0A 4K0NA 4K1FA 2LQQA 5GSTA 4XHMA 2DIYA 1QFNA 1VGLA 3P23A 2JAEA 2IMFA 3CRTA 5HR0A 3G7IA 2AYTA 3FW2A 3IE3A 4L8EA 1TKDB 4EKZA 1YEXA 2H1DA 3P2AA 2AV4A 2HZFA 3M8NA 2MZCA 2QA1A 3APSA 1DUGA 3DEXA 5J41A 2LQOA 5ECNB 3FK8A 3GSTA 3P90A 1U88A 3GSSA 1F3AA 5KN0A 2O85A 5KN1A 2H75A 5DDLA 2V2GA 4XRDA 3D0ZA 4KDUA 5GZZB 5IMDA 3QPMA 1K0AA 4IP1A 5A4VA 4AS2A 4MJAA 1A2JA 2R3XA 2HE3A 3EWLA 3HXSA 4FYCA 3W6GA 2YWMA 5ECLB 5E4WA 2QSIA 1GSQA 1SU9A 1O81A 1K3YA 1RK4A 3TKSA 1SK0A 1O8WA 1GH2A 2FCHA 1AC1A 3NOFA 2BTOT 4PL5A 4KH7A 4TR4A 5ID2A 1SKRB 2C3TA 4CDOA 1BAYA 1E2YA 1WPIA 2K18A 1FVKA 3HYPA 1GSYA 1Z6NA 1NHOA 1JHBA 2H73A 1BYEA 4Q5QA 1O8XA 5HGIA 2GS3A 1N8JA 4BL7B 4YQUA 4TN8A 4HZ4A 4AJ7A 1J0FA 4PNFA 4JBBA 3EVIA 1K0CA 3GTUA 4F9ZA 5IOXA 1Z9HA 2WDUA 2QA2A 4JCVE 4ZXGA 4AGSA 4CY8A 4ZBAA 1Z7RA 3C73A 2D2ZA 4G19A 4XRAA 1XWKA 2C0EA 2GZZA 2TRXA 4YQVA 1WJKA 4GSNA 3L9VA 3I9V2 1RW1A 2ZRRA 3QMXA 1SL0B 5L71A 3EINA 4OAVB 1Y25A 2F51A 2A2SA 5JCGA 4N10A 1MDKA 2P31A 2WULA 5IOWA 2EC4A 1PL1A 1MDJA 2A2PA 3OR5A 4G75A 2H19A 1H4OA 4IQ1A 2VCVA 4PUFC 5ECOB 4IGJA 3ZVJA 4KDYA 1U3IA 1T3BA 1GUKA 5IMCA 4TRXA 2B7KA 2WRTA 4I8BA 4IN0A 5D9XA 3UVTA 3J7Yk 3ISOA 2EIQA 3D21A 3APQA 2LUSA 1A8YA 5H5RA 3K8NA 4QL7A 1NM3A 3L78A 1V9WA 4LLRA 2WFCA 3MAKA 10GSA 2LTKA 3MWHA 1USBA 4K9ZA 3F4TA 1PL2A 2FGXA 3IV4A 3P7XA 2AUVA 4V2LA 1Q98A 1ZYPA 1YF1A 2L4CA 2QKEA 4QL9A 3KXOA 2GQKA 4KCAA 1FHEA 4NHZA 1F9MA 1HNBA 2FWHA 4OFTA 4OCEA 3QDNA 1J08A 1OC8A 2KUCA 2H30A 3APOA 4IBPA 3FRCA 1TK5B 4K0GA 6GSUA 2FUG2 2JZSA 18GSA 3GNJA 5CRWA 4MZBA 3N9JA 3FYGA 4HJ2A 3KTLA 4X0XA 4DEJA 1DBYA 2F66B 4HU7A 3F3RA 2F8FA 3P8WA 5HR3A 3VI7A 1NW2A 3GKXA 1U87A 4G9HA 4NMUA 3QFAC 1YO7A 1OE7A 4IQAA 4L0UA 1K0BA 2DJ0A 2OADA 1F3BA 4X4JA 1A0FA 4MA9A 4MCUA 3O6TA 3KP9A 3GTUB 4A5PA 4TR3A 3LG6A 4LA1A 4OO5A 5ECKB 5CRGA 4EF0A 1VF3A 4BL7A 3CYNA 1XOAA 3KGKA 1IYIA 3CTGA 4Z2RA 6GSTA 4KW6A 5HQPA 5F05A 3LYPA 1EGOA 5ELGA 4CHSA 4WETA 2X49A 1M9AA 3LSZA 1R7HA 2VD0A 4OCFA 1EV9A 2RLIA 3LJ0A 3LORA 5ID2B 3CBUA 4ECJA 1LJRA 2CAQA 3IOSA 2YJHA 1G7EA 4KB3A 1G6YA 4EXJA 2GSTA 1V58A 4ISDA 3QCPA 4K5RA 5ECIB 1XPVA 3LW9A 1OYJA 1FAAA 2L6DA 4HEA2 2DSAA 2H74A 5CRDA 5J5NA 2VLVA 1ZL9A 4HJMA 1B48A 1B9YC 3UARA 1JLWA 2OBIA 3TOUA 1XW9A 2EIOA 5DQSA 3FZ9A 3PINA 2E2MA 4L0WA 5GSSA 1PQNA 3IRAA 3RHBA 5IPGA 2JL4A 3GIXA 5ECRB 4MZCA 4WF5A 2PPTA 5E59A 3IHQA 1YF0A 2VCXA 2YWIA 14GSA 4FH8A 5ECSA 2LJRA 2KKMA 1X5DA 4G0KA 1Y6EA 5G2ZA 2LEGA 2PBJA 4HOJA 3ZFLA 3DIEA 2XBIA 2HFDA 5FT3A 2M80A 4O5UA 4WKWA 1O6JA 4TKYA 4POLA 1T4ZA 3U6VA 2JSYA 1SJ8A 3SDJA 2CVKA 2I81A 3H1NA 4E8HA 9GSSA 1BG5A 5IM9A 2TRCP 5IMAA 4MF7A 2JZTA 2LJKA 5ECQB 3CXGA 5COHA 1ML6A 2HRAA 3HJOA 2YN1A 1M2DA 2RIIA 1YKCA 4JU5A 3A2VA 1TU8A 3WT1A 1TK0B 4AS3A 2JB2A 4G76A 3ZIJA 1WP0A 5G31A 2OE1A 4YKGA 2H76A 1FG4A 2C4JA 1SD8A 4XS6A 3UMAA 4POBA 2XBQA 3GX0A 4ZBDA 3LYKA 3TJJA 2IFQA 5C04A 1X5CA 3FR3A 4OFNA 4GSSA 3FZ4A 2DJ3A 4JEDA 1YZXA 4J56E 1GSDA 2KHPA 4ML6A 5DJMA 4HUAA 3UOMA 4ECIA 1PD21 4EDYA 3DKSA 3ZITA 1XXUA 3ZZXA 1TI1A 1Z6MA 4HI7A 2ZNMA 3L0IA 2O89A 1F37A 17GSA 3LWAA 1ST9A 4XCSA 4MABA 4DSSA 3IDVA 2VO4A 2GT5A 3AY8A 3S9FA 2LSTA 4AJ8A 3LJRA 3HVSA 3Q74A 1KBNA 3DRNA 3O3TA 2H66A 4TOPA 4DVCA 3I69A 4PGTA 3BBYA 3RDWA 1EEJA 1W3SA 3ZIVA 4E8EA 1GP1A 4PXOA 5D9VA 3VI5A 4HS1A 2YWNA 4LMWA 3H8QA 4O7HA 2LRTA 1OKTA 2UZ8A 2MBTA 4MMMA 4EO3A 5JWRB 1PGTA 2C8UA 5A4UA 3HY2A 4BPYA 1TDIA 5DCGA 4RUVA 3CTFA 5CAXA 19GSA 1GLQA 2K9FA 1N2AA 2DLXA 2A4VA 5HFKA 1JFUA 2R0PA 4ZB8A 1TXXA 4WEYA 4BVXA 5A4WA 2VIMA 2F8AA 4EVMA 4JRRA 4KCEA 3VWXA 4WBRD 4MP4A 5KN2A 4ZL7A 2A2CA 4PL3A 1G6WA 4POKA 2KP2A 1FOVA 2DBCA 3M1GA 4MZWA 2X99A 3ME7A 3TOTA 2E8GA 3FR9A 1R5PA 1QGVA 3VPTA 2FA4A 1ZGNA 1CQHA 4PQHA 2IN3A 1MTCA 1XOBA 4HDEA 4USSA 4K5SA 1UA5A 22GSA 4XTSA 1ERTA 2DKIA 4GLTA 2X8GA 2PERA 2CQ9A 1G0TA 3KH9A 5FWGA 1XW6A 5D73A 2LKUA 4TVEA 4I1TA 4NXIA 4L5OA 3QAWA 4N0VA 2L6CA 2YPMA 2GQLA 2XMXA 5IMFA 3GV1A 1AQWA 2Z9SA 4AJ6A 3BCKA 1PMTA 3LJ2A 4XS1A 3NZNA 2I9HA 3G7YA 2GDRA 3BCIA 3RAZA 4V1Ag 1J9BA 3FMWA 3TUEA 1TI3A 2VCZA 4FIWA 1R5AA 4KNDA 1ZOFA 3RBTA 3VWWA 2B3SA 1IYHA 3MIXA 1GTIA 5HFGA 8GSSA 3FBVA 1GNEA 2VOCA 5AIVA 1VF4A 3ZRDA 1WIKA 1DE1A 1XZOA 4EL1A 3D22A 3M9KA 5GAPD 1R26A 2VD1A 1ACVA 4K7NA 3ERWA 4YZ9A 1Q4JA 4KDXA 4I5QA 3KMNA 6GSSA 1GSFA 1SL2B 4GCIA 4H86A 2VCQA 3GHAA 4K6XA 4J57E 2J9HA 2V32A 1O85A 4GQCA 1VF2A 2B5YA 3GN3A 2YFAA 2LV3A 4JZQA 1ABAA 3KIJA 4TXOA 2VL3A 5IO0A 2DMMA 3A2WA 2I4AA 5H5SA 4KAEA 4LL1B 3A5IA 1EOHA 3GH9A 1U3AA 3IK9A 4JE1A 3KJYA 4EIPA 1OC9B 1MEKA 1WRYA 4O32A 3HHVA 4I6XA 4K8MA 2GT6A 3E9JB 2CAZB 4LMVA 4ACSA 4IVFA 1YJ6A 1A2LA 3M9JA 4XS4B 1YKAA 2R2JA 2PGTA 3CSIA 2HZEA 1XBSA 2O87A 1EWXA 3TDGA 5DALA 1M2AA 4KGIA 1M2BA 2TIRA 4KSOA 3VPQA 1GTAA 2JB1A 2B1KA 2HI7A 1HNAA 2H0GA 3Q6OA 4Z7GA 5CYYA 3L9SA 1M9BA 3A5WA 2MMZA 1X0RA 1VRSD 1GRXA 4N11A 3I43A 3DWVA 2JZRA 3DO9A 4JR6A 3VWVA 3IAS1 1YQ1A 4OAUC 4ZB9A 2C80A 4WR4A 2G2QA 4PTSA 3TJKA 2GQMA 3VURA 1PSQA 2CV4A 2OJLA 2P22B 4MDCA 4NV5A 3MDKA 3TRQA 4IJ3A 4V1Ap 3HJPA 4XIHA 1GUMA 1ZZYA 4TW5A 3QOUA 2WB9A 2V6EA 2KOKA 4YAVA 1TRUA 2XTRA 2GLRA 4HQZA 3ERFA 1A2MA 1JZDA 3UIWA 1ZCPA 2JSZA 2YP6A 5G5EA 4EIQA 1PX7A 2J23A 1T1VA 2R4VA 4BVYB 4HFVA 4K7IA 4MH3A 3Q19A 5ELAA 4TR1B 4ML1A 1SYXA 1PA3A 2DJ1A 2WGRA 4ZL9A 1U6TA 2FUG1 1HYUA 3D4TA 2B6MA 4YQMA 5JCUA 2DIZA 5B8AA 3WGEA 5D96A 1WOUA 3LEFA 1F2EA 4WBJA 4TXVA 3WD6A 4PL4A 3ME8A 1ERVA 2VM2A 3F4RA 5CO3A 3TKQA 4HU9A 5J9CA 5CP1A 1ZYNA 4IHUA 1A23A 2C1YA 1AUCA 2CVDA 4GF0A 4MJEA 3F3QA 2K8VA 2JB3A 2B5EA 1LBKA 2JADA 1MD4A 2WJUA 2OACA 1K0NA 2K8SA 2H1AA 5AISA 3F6DA 2LNTA 4GWRA 4ULXA 3O76A 1OVNA 4O1OA 1I9DA 3TCOA 4RI6A 2IMKA 2ES7A 3TJGA 2M72A 3IPZA 2XPDA 2HRKA 3GL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLX A;  4KA0 A;  3PH9 A;  4ILF A;  3ED3 A;  2HNL A;  3LQ7 A;  4OFM A;  1THX A;  3N5O A;  1XWC A;  3HZ8 A;  5LD0 A;  1RQM A;  5J3R A;  2CZ2 A;  2YZU A;  3FZA A;  4O5R A;  5G1K A;  5DVB A;  4TR0 A;  2BJX A;  2KP1 A;  2HSY A;  2L57 A;  2HYX A;  2HXK A;  1UN2 A;  4MPF A;  5F0G A;  1T4Y A;  1V98 A;  5G1L A;  1JLV A;  5J4U A;  5LCZ A;  4F0C A;  3DVW A;  1Z7P A;  1W89 A;  1SL1 B;  1EP7 A;  1W4V A;  2MMA A;  3TJB A;  6GSY A;  2R37 A;  1KNG A;  4AF2 A;  3ZMK A;  1Z5Y E;  2I1U A;  5D9W A;  5F06 A;  2HRN A;  4FYU A;  2CX3 A;  1XFL A;  1V2A A;  3DML A;  2YZH A;  1M0U A;  5AIX A;  5B8B A;  1K0O A;  3SBC A;  3H4K A;  1SKW B;  3M0F A;  2B7J A;  3KM6 A;  2X8C A;  5DAK B;  2PU9 C;  5JCW A;  11GS A;  3PGT A;  1FVJ A;  5IMZ A;  2E2G A;  1BED A;  2PVQ A;  4D73 B;  6GSX A;  5KEJ A;  2CT6 A;  1EGR A;  3KP8 A;  2YWO A;  4G2E A;  3IAM 2;  2R5G A;  3QAG A;  1HQO A;  4Q5F A;  3C71 A;  5J9B A;  3WYW A;  2O7K A;  2R6K A;  1GWC A;  2REM A;  1QMV A;  1SYR A;  3GKN A;  5G30 A;  1EZK A;  4HQS A;  3V1W A;  1X9M B;  3BJ5 A;  5ECM B;  5JWO B;  5AGY A;  1I5G A;  3ZTL A;  5C00 A;  1PKW A;  4F82 A;  1GUL A;  2GTU A;  4DSR A;  2DML A;  2WZ9 A;  3FR6 A;  1XWA A;  5IIZ A;  3F4S A;  3GKK A;  5ABR A;  3HZ4 A;  2OBK A;  1K0D A;  2P5Q A;  1ZYE A;  2XHF A;  3G9B A;  1PKZ A;  1XWB A;  1OC3 A;  2CVB A;  4RQX A;  5DQY A;  4NAX A;  4V2M A;  1WWJ A;  3FZ5 A;  1EV4 A;  4Z7X A;  4F2I A;  1BQ7 A;  2FWG A;  3UBL A;  1NHY A;  2G0F A;  2O8V B;  1AIU A;  3EE2 A;  3R2Q A;  1XW5 A;  2C3N A;  1ERU A;  20GS A;  1TRS A;  4N0Z A;  4D73 A;  2VL9 A;  2P0G A;  4PX1 A;  1O7U A;  5CRH A;  4DSQ A;  2HLS A;  3RPP A;  4ZIJ A;  2DJJ A;  1QK8 A;  3G7J A;  2OE0 A;  3PR8 A;  5DAK A;  2PWJ A;  3C7M A;  3EUR A;  4MH2 A;  3LXZ A;  3KMO A;  1S3A A;  5EY6 A;  1ILO A;  4EDZ A;  2FNO A;  2V41 A;  1M99 A;  1X5E A;  2PUK C;  3VFI A;  1SJZ A;  2FLS A;  1TK8 B;  4K2D A;  2NVL A;  4NPB A;  2RUE A;  3IAS 2;  2H72 A;  2FY6 A;  1O73 A;  2NPB A;  2WCI A;  1X9S B;  5EPF A;  1GSS A;  3RPN A;  2BMX A;  5HFI A;  2RM5 A;  3TKP A;  3FEU A;  4I2U A;  3Q18 A;  1GL8 A;  2EIR A;  4PNG A;  3TKS C;  3UAP A;  5ECP B;  4MLY A;  3BOA A;  2VCW A;  3E3E A;  1B4Q A;  3GX8 A;  2N5A A;  2H01 A;  4WR5 A;  3TJF A;  1Z3E A;  2AHE A;  1SK2 A;  3TB2 A;  1H75 A;  2B1L A;  1A0R P;  2QGV A;  1TU7 A;  3EU3 A;  4CW9 A;  2F9S A;  4GRF A;  5D9T A;  1M7T A;  2H6Z A;  2X64 A;  4LL4 B;  3IR4 A;  4EC0 A;  1AXD A;  2WS2 A;  1YY7 A;  4IP6 A;  6GSV A;  1GTU A;  2NTO A;  1NSW A;  1V40 A;  4GQF A;  1QQ2 A;  5JWQ B;  3HD5 A;  4ZBB A;  3GMF A;  3TGZ A;  3VWU A;  1THO A;  4KE3 A;  1SEN A;  1XCC A;  3VK9 A;  5HR1 A;  12GS A;  2IWT A;  1ERW A;  2H70 A;  4PUA A;  1SKS B;  1V57 A;  2IIY A;  2AAW A;  2X8H A;  3GA4 A;  1T8E B;  3ZL5 A;  2JU5 A;  3FY7 A;  3VLN A;  1C72 A;  3CSJ A;  13GS A;  5B7C A;  3D5J A;  1GNW A;  3GUR A;  3ZYW A;  3IC4 A;  3EC3 A;  3US3 A;  4KUN A;  3UEM A;  3UVH A;  2E7P A;  4TR1 A;  2MYG A;  3E0U A;  3GH6 A;  4BVY A;  2GSQ A;  4NHW A;  3F6F A;  5ECH B;  2VL2 A;  2JAC A;  3IBH A;  2IMD A;  1T00 A;  2IME A;  2P5R A;  4ECC A;  1XWG A;  2YV7 A;  3L9U A;  3IXR A;  4V2N A;  1KTE A;  5G5F A;  2NDO A;  2C0G A;  2IPA A;  2YAN A;  4HZ2 A;  2ALB A;  5H5Q A;  7GSS A;  4P3Y B;  2H0H A;  2H71 A;  1TTZ A;  1CQG A;  1XVQ A;  2FWE A;  3GUS A;  1JZW A;  2LRC A;  1B8X A;  1WE0 A;  2E0Q A;  2LS5 A;  1AW9 A;  4IS0 A;  1TRV A;  1A24 A;  3ERG A;  3DD3 A;  4QQ7 A;  2XPE A;  1XIY A;  2LNS A;  2FA8 A;  2HT9 A;  1K3O A;  5FHI A;  4FYB A;  2YJ7 A;  2F3M A;  2DC5 A;  3ZML A;  2AB6 A;  2ON5 A;  1LU4 A;  1UC7 A;  4IW9 A;  3D4M A;  5DAL B;  2FHE A;  3WGX A;  2HZE B;  2B5X A;  2V6O A;  4IEL A;  4ID0 A;  4XS4 A;  2V6K A;  3HDC A;  1OKD A;  4F03 A;  2CX4 A;  5LNK e;  2ZUP A;  2IL3 A;  3C1S A;  3KCM A;  4I97 A;  2N5B A;  1PRX A;  2L5O A;  2QC7 A;  2GSS A;  1OC9 A;  3TKR A;  3MSZ A;  5D8I A;  3DXB A;  3IA1 A;  1SJI A;  1HD2 A;  3KZQ A;  2C3Q A;  2GGT A;  1AQV A;  1GLP A;  2H1G A;  1AQX A;  2I3Y A;  3BD2 A;  2ZCT A;  2MMN A;  1TRW A;  4MJC A;  3FKF A;  4WF4 A;  4ZB6 A;  2VLT A;  3HJM A;  4PQI A;  3L0H A;  2H8L A;  2YCD A;  2H6X A;  1SK1 A;  3EMP A;  4TXO B;  1R4W A;  3H79 A;  2OKA A;  3KD0 A;  1PN9 A;  3WT2 A;  2NBS A;  3JCM L;  1GSE A;  1A8L A;  1G7O A;  2GZY A;  1MD3 A;  1AAZ A;  2L4Q A;  4JR4 A;  4RI7 A;  1TOF A;  3QFB C;  4L5L A;  1K0M A;  2YNX A;  5AN1 A;  4IJI A;  3HKR A;  4MPG A;  2VAF A;  1EP8 A;  1F6M C;  1ON4 A;  2GVP A;  2H0I A;  4OMV A;  4MF6 A;  3CSH A;  4GXZ A;  4K7O A;  3C1R A;  1UVZ A;  5IO2 A;  3TRX A;  4ZL8 A;  1DE2 A;  5DBQ A;  2YOI A;  3DGQ A;  4WXT A;  4X1U A;  4N30 A;  1URM A;  5GAN D;  4OD7 A;  1FB6 A;  4MF5 A;  2IJY A;  4BA7 A;  5IPH A;  3EMX A;  1VF1 A;  1B9X C;  2XC2 A;  3KH7 A;  4BWS A;  1S3D A;  3LFL A;  2AJQ B;  2OA7 A;  4Q5R A;  1WMJ A;  2OE3 A;  4EUY A;  1GTB A;  3UL3 A;  3CRU A;  4F0B A;  1SD9 A;  1YEP A;  1EEM A;  1KEB A;  1FB0 A;  2YV9 A;  4NWY A;  1EOG A;  2A2R A;  3QR6 A;  5CRE A;  2H1B A;  5IQY A;  3A3T A;  4BWQ A;  1B4P A;  2HRF A;  3ZVJ D;  5F8B A;  1GUH A;  3ZLP A;  1OAZ A;  3ZRE A;  2PMT A;  3WGD A;  3M3M A;  4X43 A;  3QAV A;  3NIV A;  4NV2 A;  3UJ1 A;  1PX6 A;  3J7Y b;  4YH2 A;  4YAP A;  2V1M A;  2GZP A;  2C0F A;  2MMO A;  2DJK A;  1TJD A;  3D6I A;  5EL8 A;  3U5R E;  3W8S A;  5DJL A;  1JZO A;  2CZ3 A;  5B6M A;  1HNC A;  1X9W B;  3F9U A;  3KTB A;  3UBK A;  5KN3 A;  5ENU A;  2DJ2 A;  2VUP A;  3F0I A;  5D93 A;  4PQ1 A;  4RQR A;  1T7P B;  5F07 A;  1GSU A;  2FD3 A;  4O92 A;  1XVW A;  2M46 A;  3I6A A;  4GTU A;  3LXT A;  2VCT A;  1TW9 A;  1ZYQ B;  3CMI A;  3TKS E;  5DCH A;  3GFK A;  1TP9 A;  3GL3 A;  1FO5 A;  3H93 A;  2MBS A;  5HR2 A;  2PN8 A;  4PUR A;  4POM A;  2CAI A;  5A5K A;  2LRN A;  2N5F A;  16GS A;  3DVX A;  4Q5N A;  5IMV A;  2GSR A;  4ZIL A;  4OWY A;  4DSS B;  1DSB A;  3GRX A;  1FW1 A;  4OO4 A;  5INY A;  5B6N A;  4KX4 A;  1E6B A;  3GYK A;  3MNG A;  3QD9 A;  3IK7 A;  4GST A;  3C8E A;  3GKM A;  2RUF A;  2ON7 A;  3KEB A;  3HCZ A;  5EVO A;  1YDK A;  2CA8 A;  3FHK A;  4FO5 A;  3SWL A;  6GSW A;  4MK3 A;  3TRP A;  1BJX A;  2RM6 A;  2IFQ B;  1MDI A;  1SJ6 A;  1JZR A;  4ECB A;  1K3L A;  4G10 A;  2LJA A;  3EYT A;  4I2T A;  3DYR A;  2K6V A;  4KSM A;  3HVV A;  5CNW A;  3LGC A;  3RHC A;  3F8U A;  2C0D A;  2PVO C;  1BX9 A;  4MJB A;  3HA9 A;  1QUW A;  3EU4 A;  2IMI A;  3W8J A;  3F63 A;  3ZFB A;  4J2F A;  1OE8 A;  2HSH A;  2VL2 C;  3A2X A;  2H6Y A;  2VM1 A;  3L4N A;  2FWF A;  1S3C A;  2L59 A;  2L5L A;  3HVX A;  4IKH A;  1ZMA A;  1QXH A;  2VLU A;  4EE0 A;  4K0N A;  4K1F A;  2LQQ A;  5GST A;  4XHM A;  2DIY A;  1QFN A;  1VGL A;  2IMF A;  3CRT A;  5HR0 A;  3G7I A;  2AYT A;  3FW2 A;  3IE3 A;  4L8E A;  1TKD B;  4EKZ A;  1YEX A;  2H1D A;  3P2A A;  2AV4 A;  2HZF A;  3M8N A;  2MZC A;  3APS A;  1DUG A;  3DEX A;  5J41 A;  2LQO A;  5ECN B;  3FK8 A;  3GST A;  3P90 A;  1U88 A;  3GSS A;  1F3A A;  5KN0 A;  2O85 A;  5KN1 A;  2H75 A;  5DDL A;  2V2G A;  4XRD A;  3D0Z A;  4KDU A;  5GZZ B;  5IMD A;  3QPM A;  1K0A A;  4IP1 A;  5A4V A;  4MJA A;  1A2J A;  2R3X A;  2HE3 A;  3EWL A;  3HXS A;  4FYC A;  3W6G A;  2YWM A;  5ECL B;  5E4W A;  2QSI A;  1GSQ A;  1SU9 A;  1O81 A;  1K3Y A;  1RK4 A;  3TKS A;  1SK0 A;  1O8W A;  1GH2 A;  2FCH A;  1AC1 A;  3NOF A;  2BTO T;  4KH7 A;  4TR4 A;  5ID2 A;  1SKR B;  2C3T A;  4CDO A;  1BAY A;  1E2Y A;  1WPI A;  2K18 A;  1FVK A;  3HYP A;  1GSY A;  1Z6N A;  1NHO A;  1JHB A;  2H73 A;  1BYE A;  4Q5Q A;  1O8X A;  2GS3 A;  1N8J A;  4YQU A;  4TN8 A;  4HZ4 A;  4AJ7 A;  1J0F A;  4PNF A;  4JBB A;  3EVI A;  1K0C A;  3GTU A;  4F9Z A;  5IOX A;  1Z9H A;  2WDU A;  4ZXG A;  4AGS A;  4ZBA A;  1Z7R A;  3C73 A;  2D2Z A;  4G19 A;  4XRA A;  1XWK A;  2C0E A;  2GZZ A;  2TRX A;  4YQV A;  1WJK A;  4GSN A;  3L9V A;  3I9V 2;  1RW1 A;  3QMX A;  1SL0 B;  5L71 A;  3EIN A;  1Y25 A;  2F51 A;  2A2S A;  5JCG A;  4N10 A;  1MDK A;  2P31 A;  2WUL A;  5IOW A;  2EC4 A;  1PL1 A;  1MDJ A;  3OR5 A;  2H19 A;  1H4O A;  4IQ1 A;  2VCV A;  4PUF C;  5ECO B;  4IGJ A;  3ZVJ A;  4KDY A;  1U3I A;  1T3B A;  1GUK A;  5IMC A;  4TRX A;  2B7K A;  2WRT A;  4I8B A;  4IN0 A;  5D9X A;  3UVT A;  3J7Y k;  3ISO A;  2EIQ A;  3D21 A;  3APQ A;  2LUS A;  1A8Y A;  5H5R A;  3K8N A;  4QL7 A;  1NM3 A;  3L78 A;  1V9W A;  4LLR A;  2WFC A;  3MAK A;  10GS A;  2LTK A;  3MWH A;  1USB A;  4K9Z A;  3F4T A;  1PL2 A;  2FGX A;  3IV4 A;  3P7X A;  2AUV A;  4V2L A;  1Q98 A;  1YF1 A;  2L4C A;  2QKE A;  4QL9 A;  3KXO A;  2GQK A;  4KCA A;  1FHE A;  4NHZ A;  1F9M A;  1HNB A;  2FWH A;  4OFT A;  4OCE A;  3QDN A;  1J08 A;  1OC8 A;  2KUC A;  2H30 A;  3APO A;  4IBP A;  3FRC A;  1TK5 B;  4K0G A;  6GSU A;  2FUG 2;  2JZS A;  18GS A;  3GNJ A;  5CRW A;  4MZB A;  3N9J A;  3FYG A;  4HJ2 A;  3KTL A;  4X0X A;  4DEJ A;  1DBY A;  4HU7 A;  3F3R A;  2F8F A;  3P8W A;  5HR3 A;  3VI7 A;  1NW2 A;  3GKX A;  1U87 A;  4G9H A;  4NMU A;  3QFA C;  1OE7 A;  4IQA A;  4L0U A;  1K0B A;  2DJ0 A;  2OAD A;  1F3B A;  1A0F A;  4MA9 A;  4MCU A;  3O6T A;  3KP9 A;  3GTU B;  4TR3 A;  3LG6 A;  4LA1 A;  4OO5 A;  5ECK B;  5CRG A;  4EF0 A;  1VF3 A;  4BL7 A;  3CYN A;  1XOA A;  3KGK A;  1IYI A;  3CTG A;  6GST A;  4KW6 A;  5HQP A;  5F05 A;  3LYP A;  1EGO A;  5ELG A;  4CHS A;  4WET A;  1M9A A;  3LSZ A;  1R7H A;  2VD0 A;  4OCF A;  1EV9 A;  2RLI A;  5ID2 B;  3LOR A;  3CBU A;  4ECJ A;  1LJR A;  2CAQ A;  3IOS A;  2YJH A;  1G7E A;  4KB3 A;  1G6Y A;  4EXJ A;  2GST A;  1V58 A;  4ISD A;  3QCP A;  5ECI B;  1XPV A;  1OYJ A;  1FAA A;  2L6D A;  4HEA 2;  2DSA A;  2H74 A;  5CRD A;  5J5N A;  2VLV A;  1ZL9 A;  4HJM A;  1B48 A;  1B9Y C;  3UAR A;  1JLW A;  2OBI A;  3TOU A;  1XW9 A;  2EIO A;  5DQS A;  3FZ9 A;  3PIN A;  2E2M A;  4L0W A;  5GSS A;  1PQN A;  3IRA A;  3RHB A;  5IPG A;  2JL4 A;  3GIX A;  5ECR B;  4MZC A;  4WF5 A;  2PPT A;  5E59 A;  3IHQ A;  1YF0 A;  2VCX A;  2YWI A;  14GS A;  4FH8 A;  5ECS A;  2LJR A;  1X5D A;  1Y6E A;  5G2Z A;  2LEG A;  2PBJ A;  4HOJ A;  3ZFL A;  3DIE A;  2XBI A;  2HFD A;  5FT3 A;  2M80 A;  4WKW A;  1O6J A;  4TKY A;  4POL A;  1T4Z A;  3U6V A;  2JSY A;  2CVK A;  2I81 A;  3H1N A;  4E8H A;  9GSS A;  1BG5 A;  5IM9 A;  2TRC P;  5IMA A;  4MF7 A;  2JZT A;  2LJK A;  5ECQ B;  3CXG A;  5COH A;  1ML6 A;  3HJO A;  2YN1 A;  1M2D A;  2RII A;  1YKC A;  4JU5 A;  3A2V A;  1TU8 A;  3WT1 A;  1TK0 B;  3ZIJ A;  1WP0 A;  5G31 A;  2OE1 A;  2H76 A;  1FG4 A;  2C4J A;  1SD8 A;  4XS6 A;  3UMA A;  4POB A;  2XBQ A;  3GX0 A;  4ZBD A;  3LYK A;  3TJJ A;  2IFQ A;  5C04 A;  1X5C A;  3FR3 A;  4OFN A;  4GSS A;  3FZ4 A;  2DJ3 A;  4JED A;  1YZX A;  4J56 E;  1GSD A;  2KHP A;  4ML6 A;  5DJM A;  4HUA A;  3UOM A;  4ECI A;  1PD2 1;  4EDY A;  3DKS A;  3ZIT A;  1XXU A;  3ZZX A;  1TI1 A;  1Z6M A;  4HI7 A;  2ZNM A;  2O89 A;  1F37 A;  17GS A;  3LWA A;  1ST9 A;  4XCS A;  4MAB A;  4DSS A;  3IDV A;  2VO4 A;  2GT5 A;  3AY8 A;  3S9F A;  2LST A;  4AJ8 A;  3LJR A;  3HVS A;  3Q74 A;  1KBN A;  3DRN A;  3O3T A;  2H66 A;  4TOP A;  4DVC A;  3I69 A;  4PGT A;  3BBY A;  3RDW A;  1EEJ A;  3ZIV A;  4E8E A;  1GP1 A;  4PXO A;  5D9V A;  3VI5 A;  4HS1 A;  2YWN A;  4LMW A;  3H8Q A;  4O7H A;  2LRT A;  1OKT A;  2MBT A;  4MMM A;  4EO3 A;  5JWR B;  1PGT A;  2C8U A;  5A4U A;  3HY2 A;  4BPY A;  1TDI A;  5DCG A;  4RUV A;  3CTF A;  5CAX A;  19GS A;  1GLQ A;  2K9F A;  1N2A A;  2DLX A;  2A4V A;  5HFK A;  1JFU A;  4ZB8 A;  1TXX A;  4WEY A;  4BVX A;  5A4W A;  2VIM A;  2F8A A;  4EVM A;  4JRR A;  4KCE A;  3VWX A;  4WBR D;  4MP4 A;  5KN2 A;  4ZL7 A;  1G6W A;  4POK A;  2KP2 A;  1FOV A;  2DBC A;  3M1G A;  4MZW A;  2X99 A;  3ME7 A;  3TOT A;  3FR9 A;  1R5P A;  1QGV A;  3VPT A;  2FA4 A;  1ZGN A;  1CQH A;  4PQH A;  2IN3 A;  1MTC A;  1XOB A;  4HDE A;  1UA5 A;  22GS A;  4XTS A;  1ERT A;  4GLT A;  2X8G A;  2PER A;  2CQ9 A;  1G0T A;  3KH9 A;  5FWG A;  1XW6 A;  5D73 A;  2LKU A;  4TVE A;  4NXI A;  4L5O A;  3QAW A;  4N0V A;  2L6C A;  2YPM A;  2GQL A;  5IMF A;  3GV1 A;  1AQW A;  2Z9S A;  4AJ6 A;  3BCK A;  1PMT A;  4XS1 A;  3NZN A;  2I9H A;  3G7Y A;  2GDR A;  3BCI A;  3RAZ A;  4V1A g;  1J9B A;  3TUE A;  1TI3 A;  2VCZ A;  4FIW A;  1R5A A;  4KND A;  1ZOF A;  3RBT A;  3VWW A;  2B3S A;  1IYH A;  1GTI A;  5HFG A;  8GSS A;  1GNE A;  2VOC A;  5AIV A;  1VF4 A;  3ZRD A;  1WIK A;  1DE1 A;  1XZO A;  4EL1 A;  3D22 A;  3M9K A;  5GAP D;  1R26 A;  2VD1 A;  1ACV A;  4K7N A;  3ERW A;  1Q4J A;  4KDX A;  4I5Q A;  3KMN A;  6GSS A;  1GSF A;  1SL2 B;  4GCI A;  4H86 A;  2VCQ A;  3GHA A;  4K6X A;  4J57 E;  2J9H A;  2V32 A;  1O85 A;  4GQC A;  1VF2 A;  2B5Y A;  3GN3 A;  2LV3 A;  4JZQ A;  1ABA A;  3KIJ A;  4TXO A;  2VL3 A;  5IO0 A;  2DMM A;  3A2W A;  2I4A A;  5H5S A;  4KAE A;  4LL1 B;  1EOH A;  3GH9 A;  1U3A A;  3IK9 A;  4JE1 A;  3KJY A;  1OC9 B;  1MEK A;  1WRY A;  4O32 A;  3HHV A;  4I6X A;  4K8M A;  2GT6 A;  3E9J B;  4LMV A;  4ACS A;  4IVF A;  1YJ6 A;  1A2L A;  3M9J A;  4XS4 B;  1YKA A;  2R2J A;  3TDG A;  2PGT A;  2HZE A;  1XBS A;  2O87 A;  1EWX A;  3CSI A;  5DAL A;  1M2A A;  4KGI A;  1M2B A;  2TIR A;  4KSO A;  3VPQ A;  1GTA A;  2B1K A;  2HI7 A;  1HNA A;  2H0G A;  3Q6O A;  5CYY A;  3L9S A;  1M9B A;  3A5W A;  2MMZ A;  1X0R A;  1VRS D;  1GRX A;  4N11 A;  3I43 A;  3DWV A;  2JZR A;  3VWV A;  4JR6 A;  1YQ1 A;  4ZB9 A;  2C80 A;  4WR4 A;  2G2Q A;  3TJK A;  2GQM A;  3VUR A;  1PSQ A;  2CV4 A;  2OJL A;  4MDC A;  4NV5 A;  3MDK A;  3TRQ A;  4IJ3 A;  4V1A p;  3HJP A;  4XIH A;  1GUM A;  1ZZY A;  4TW5 A;  3QOU A;  2WB9 A;  2KOK A;  4YAV A;  1TRU A;  2GLR A;  4HQZ A;  3ERF A;  1A2M A;  1JZD A;  3UIW A;  1ZCP A;  2JSZ A;  2YP6 A;  5G5E A;  1PX7 A;  2J23 A;  1T1V A;  2R4V A;  4K7I A;  4MH3 A;  3Q19 A;  5ELA A;  4TR1 B;  4ML1 A;  1SYX A;  1PA3 A;  2DJ1 A;  2WGR A;  4ZL9 A;  1U6T A;  1HYU A;  3D4T A;  2B6M A;  4YQM A;  5JCU A;  2DIZ A;  5B8A A;  3WGE A;  5D96 A;  1WOU A;  3LEF A;  1F2E A;  4WBJ A;  4TXV A;  3WD6 A;  3ME8 A;  1ERV A;  2VM2 A;  3F4R A;  5CO3 A;  3TKQ A;  4HU9 A;  5J9C A;  5CP1 A;  4IHU A;  1A23 A;  2C1Y A;  1AUC A;  2CVD A;  4GF0 A;  4MJE A;  3F3Q A;  2K8V A;  2B5E A;  1LBK A;  2JAD A;  1MD4 A;  2WJU A;  2OAC A;  1K0N A;  2K8S A;  2H1A A;  5AIS A;  3F6D A;  2LNT A;  4GWR A;  4ULX A;  3O76 A;  1OVN A;  1I9D A;  3TCO A;  4RI6 A;  2IMK A;  2ES7 A;  3TJG A;  2M72 A;  3IPZ A;  2XPD A;  3GL5 A; 
#chains in the Genus database with same CATH topology
 2KLX A;  4KA0 A;  3PH9 A;  4ILF A;  3ED3 A;  2HNL A;  3LQ7 A;  4OFM A;  3FNB A;  1THX A;  4HEA 1;  3N5O A;  4YZD A;  1XWC A;  3HZ8 A;  5LD0 A;  1RQM A;  5J3R A;  2CZ2 A;  2YZU A;  3FZA A;  4O5R A;  5G1K A;  5DVB A;  4TR0 A;  2BJX A;  2KP1 A;  2HSY A;  2L57 A;  2HYX A;  2HXK A;  1UN2 A;  1U5K A;  4MPF A;  5F0G A;  1T4Y A;  1V98 A;  5G1L A;  1JLV A;  4YZC A;  4DWL A;  5J4U A;  5LCZ A;  4Z7H A;  4F0C A;  3DVW A;  1Z7P A;  1W89 A;  1SL1 B;  3VA9 A;  4FQU A;  1EP7 A;  1W4V A;  2MMA A;  2A2D A;  3TJB A;  6GSY A;  2R37 A;  1KNG A;  4AF2 A;  3ZMK A;  1Z5Y E;  2I1U A;  5D9W A;  5F06 A;  2HRN A;  4FYU A;  2CX3 A;  1XFL A;  2R0C A;  1S3R A;  1V2A A;  3DML A;  2YZH A;  1M0U A;  5AIX A;  5B8B A;  1K0O A;  3SBC A;  3H4K A;  1SKW B;  3M0F A;  2B7J A;  3KM6 A;  2X8C A;  5DAK B;  2PU9 C;  5JCW A;  11GS A;  3PGT A;  1FVJ A;  5IMZ A;  2E2G A;  4Z2T A;  1BED A;  2PVQ A;  4D73 B;  6GSX A;  5KEJ A;  2CT6 A;  1EGR A;  4BIK A;  3KP8 A;  2YWO A;  3DA3 A;  4G2E A;  3IAM 2;  2R5G A;  3QAG A;  1HQO A;  4Q5F A;  3C71 A;  5J9B A;  2RIO A;  3WYW A;  2XTQ A;  2O7K A;  2R6K A;  1GWC A;  2REM A;  1QMV A;  1SYR A;  3GKN A;  5G30 A;  1EZK A;  4HQS A;  3V1W A;  1X9M B;  3BJ5 A;  5ECM B;  5JWO B;  5AGY A;  1I5G A;  3ZTL A;  4O1P A;  5C00 A;  1PKW A;  4F82 A;  1GUL A;  2GTU A;  4DSR A;  2DML A;  2WZ9 A;  3FR6 A;  1XWA A;  5IIZ A;  3F4S A;  3GKK A;  5ABR A;  3HZ4 A;  2OBK A;  1K0D A;  2P5Q A;  1ZYE A;  2XHF A;  3G9B A;  1PKZ A;  1XWB A;  1OC3 A;  2CVB A;  4RQX A;  5DQY A;  4NAX A;  4V2M A;  1WWJ A;  3FZ5 A;  3UIT A;  1EV4 A;  4Z7X A;  4F2I A;  1BQ7 A;  2FWG A;  3UBL A;  1NHY A;  2G0F A;  2O8V B;  1AIU A;  3DA4 A;  3EE2 A;  3R2Q A;  1XW5 A;  2C3N A;  3IHG A;  1ERU A;  20GS A;  1TRS A;  4N0Z A;  4D73 A;  2VL9 A;  2P0G A;  4PX1 A;  1O7U A;  5CRH A;  4DSQ A;  2HLS A;  3RPP A;  4ZIJ A;  2DJJ A;  1QK8 A;  3G7J A;  2OE0 A;  3PR8 A;  5KOW A;  5DAK A;  2PWJ A;  3C7M A;  3EUR A;  4MH2 A;  3F4M A;  3LXZ A;  3KMO A;  4MNN A;  1S3A A;  5EY6 A;  1ILO A;  4EDZ A;  2FNO A;  2V41 A;  1M99 A;  1X5E A;  2PUK C;  3VFI A;  1SJZ A;  1FOH A;  2FLS A;  1TK8 B;  4K2D A;  2NVL A;  4NPB A;  2RUE A;  3IAS 2;  2H72 A;  2FY6 A;  1O73 A;  3PPU A;  2NPB A;  2WCI A;  1X9S B;  5EPF A;  2QGM A;  1GSS A;  3RPN A;  2BMX A;  5HFI A;  2RM5 A;  3TKP A;  3FEU A;  4I2U A;  3Q18 A;  1GL8 A;  2EIR A;  4PNG A;  3TKS C;  3UAP A;  5ECP B;  4MLY A;  3BOA A;  2VCW A;  3E3E A;  1B4Q A;  3GX8 A;  2N5A A;  2H01 A;  4WR5 A;  3TJF A;  1Z3E A;  2AHE A;  1SK2 A;  3TB2 A;  1H75 A;  2B1L A;  1A0R P;  2QGV A;  4ICY A;  1TU7 A;  3EU3 A;  4CW9 A;  2F9S A;  4GRF A;  5D9T A;  1M7T A;  2H6Z A;  2X64 A;  4LL4 B;  3IR4 A;  4EC0 A;  4G0I A;  1AXD A;  4GXT A;  2WS2 A;  1YY7 A;  4IP6 A;  6GSV A;  1GTU A;  5KOX A;  2NTO A;  1NSW A;  1V40 A;  4GQF A;  1QQ2 A;  5JWQ B;  3HD5 A;  4ZBB A;  3GMF A;  2HSM A;  3TGZ A;  3VWU A;  1THO A;  4KE3 A;  1SEN A;  1XCC A;  3VK9 A;  5HR1 A;  12GS A;  2IWT A;  1ERW A;  2H70 A;  4PUA A;  1SKS B;  3I9V 1;  1V57 A;  2IIY A;  2AAW A;  2X8H A;  3GA4 A;  1T8E B;  3ZL5 A;  2JU5 A;  3FY7 A;  3VLN A;  1C72 A;  3CSJ A;  13GS A;  5B7C A;  3D5J A;  1GNW A;  3GUR A;  3ZYW A;  3IC4 A;  3EC3 A;  2YFB A;  3US3 A;  4KUN A;  3UEM A;  3CQF A;  3UVH A;  2JBW A;  2E7P A;  4TR1 A;  2MYG A;  3E0U A;  3GH6 A;  4BVY A;  2GSQ A;  4NHW A;  3F6F A;  5ECH B;  2VL2 A;  2JAC A;  3IBH A;  2IMD A;  1T00 A;  2IME A;  1PN0 A;  2P5R A;  4ECC A;  1XWG A;  2YV7 A;  3L9U A;  3IXR A;  4V2N A;  1KTE A;  5G5F A;  2NDO A;  2C0G A;  2IPA A;  2X4A A;  2YAN A;  4HZ2 A;  2ALB A;  5H5Q A;  7GSS A;  4P3Y B;  2H0H A;  2H71 A;  1TTZ A;  1CQG A;  1XVQ A;  2FWE A;  3GUS A;  1JZW A;  2LRC A;  1B8X A;  1WE0 A;  2E0Q A;  2LS5 A;  1AW9 A;  4IS0 A;  1TRV A;  1A24 A;  3ERG A;  2DKH A;  3DD3 A;  4QQ7 A;  2A4H A;  2XPE A;  1XIY A;  2LNS A;  2FA8 A;  2HT9 A;  1K3O A;  5FHI A;  4FYB A;  2YJ7 A;  2F3M A;  2DC5 A;  3ZML A;  2AB6 A;  2ON5 A;  1LU4 A;  1UC7 A;  4IW9 A;  3D4M A;  5DAL B;  2FHE A;  3WGX A;  2HZE B;  2B5X A;  2V6O A;  4IEL A;  4ID0 A;  4XS4 A;  3R3E A;  2V6K A;  3HDC A;  2K19 A;  1OKD A;  4F03 A;  2CX4 A;  5LNK e;  2ZUP A;  2IL3 A;  3C1S A;  3KCM A;  4I97 A;  2N5B A;  1PRX A;  2L5O A;  2QC7 A;  2GSS A;  3EPT A;  1OC9 A;  3TKR A;  2L1L B;  3MSZ A;  5D8I A;  3DXB A;  3IA1 A;  1SJI A;  1HD2 A;  3KZQ A;  2C3Q A;  2GGT A;  1AQV A;  5LNK 1;  1GLP A;  2H1G A;  1AQX A;  2I3Y A;  3BD2 A;  2ZCT A;  2MMN A;  1TRW A;  4MJC A;  3FKF A;  4WF4 A;  4ZB6 A;  2VLT A;  3HJM A;  4PQI A;  3L0H A;  5BMU A;  2H8L A;  2YCD A;  2H6X A;  1SK1 A;  3EMP A;  4TXO B;  1R4W A;  3H79 A;  2OKA A;  4K2X A;  3KD0 A;  1M3J A;  1PN9 A;  3WT2 A;  2NBS A;  3JCM L;  2MJF B;  1GSE A;  1A8L A;  1G7O A;  2GZY A;  1MD3 A;  1AAZ A;  2L4Q A;  4JR4 A;  4RI7 A;  1TOF A;  3QFB C;  4L5L A;  1K0M A;  2YNX A;  5AN1 A;  4IJI A;  3HKR A;  4MPG A;  2VAF A;  1EP8 A;  1F6M C;  1ON4 A;  2GVP A;  2IP6 A;  2H0I A;  4OMV A;  3AJF A;  4MF6 A;  3CSH A;  4GXZ A;  4K7O A;  3C1R A;  1UVZ A;  5IO2 A;  3TRX A;  4ZL8 A;  1DE2 A;  3MYD A;  5DBQ A;  2YOI A;  3DGQ A;  4WXT A;  4X1U A;  4N30 A;  1URM A;  5GAN D;  4OD7 A;  1FB6 A;  4MF5 A;  2IJY A;  4BA7 A;  5IPH A;  3EMX A;  1VF1 A;  1B9X C;  2XC2 A;  3KH7 A;  4BWS A;  1S3D A;  3LFL A;  2AJQ B;  2OA7 A;  4Q5R A;  1WMJ A;  2OE3 A;  4EUY A;  2V1C C;  1GTB A;  4G0L A;  3UL3 A;  3CRU A;  4KF9 A;  4F0B A;  1SD9 A;  1YEP A;  1EEM A;  1KEB A;  1FB0 A;  2YV9 A;  4NWY A;  1EOG A;  2A2R A;  3QR6 A;  5BRT A;  5CRE A;  2H1B A;  5IQY A;  3A3T A;  4BWQ A;  1B4P A;  2HRF A;  3ZVJ D;  5F8B A;  1GUH A;  3ZLP A;  1OAZ A;  4CY6 A;  3ZRE A;  2PMT A;  3WGD A;  3M3M A;  4X43 A;  3QAV A;  3NIV A;  4NV2 A;  3UJ1 A;  2F6M B;  1PX6 A;  3J7Y b;  4YH2 A;  4YAP A;  2V1M A;  2GZP A;  2C0F A;  2MMO A;  2DJK A;  1TJD A;  3D6I A;  5EL8 A;  3U5R E;  3W8S A;  5DJL A;  1JZO A;  3Q8D A;  2CZ3 A;  5B6M A;  1HNC A;  4BVX B;  1X9W B;  3F9U A;  3KTB A;  3UBK A;  5KN3 A;  5ENU A;  2DJ2 A;  4U6R A;  2ETD A;  2VUP A;  3F0I A;  5D93 A;  4PQ1 A;  4RQR A;  1T7P B;  5F07 A;  1GSU A;  2FD3 A;  4O92 A;  1XVW A;  2M46 A;  3I6A A;  4GTU A;  3LXT A;  2VCT A;  1TW9 A;  1ZYQ B;  3CMI A;  3TKS E;  5DCH A;  3GFK A;  3LJ1 A;  1TP9 A;  3GL3 A;  1FO5 A;  3H93 A;  2MBS A;  5HR2 A;  2PN8 A;  4PUR A;  4POM A;  2CAI A;  5A5K A;  2LRN A;  2N5F A;  16GS A;  3DVX A;  4Q5N A;  5IMV A;  4Q9V A;  2GSR A;  4ZIL A;  4OWY A;  4DSS B;  3IAM 1;  1DSB A;  3GRX A;  1FW1 A;  2R0G A;  4OO4 A;  5INY A;  5B6N A;  4KX4 A;  1E6B A;  3GYK A;  3MNG A;  3QD9 A;  3IK7 A;  4GST A;  3C8E A;  3GKM A;  2RUF A;  2ON7 A;  3KEB A;  3HCZ A;  5EVO A;  1YDK A;  2CA8 A;  3FHK A;  4FO5 A;  3SWL A;  6GSW A;  4MK3 A;  3TRP A;  1BJX A;  2RM6 A;  2IFQ B;  1MDI A;  1SJ6 A;  3IC8 A;  1JZR A;  4ECB A;  1K3L A;  4G10 A;  4Z2U A;  2LJA A;  3EYT A;  4I2T A;  3DYR A;  2K6V A;  4KSM A;  3HVV A;  5CNW A;  3LGC A;  3RHC A;  3F8U A;  2C0D A;  2PVO C;  1BX9 A;  1PFO A;  4MJB A;  3HA9 A;  1QUW A;  4YKF A;  3EU4 A;  2IMI A;  3W8J A;  3F63 A;  4J2F A;  3ZFB A;  1OE8 A;  2HSH A;  2VL2 C;  4O5Q A;  3A2X A;  2H6Y A;  2VM1 A;  3L4N A;  2FWF A;  1S3C A;  2L59 A;  2L5L A;  3HVX A;  4IKH A;  1ZMA A;  1QXH A;  2VLU A;  3JSB A;  4EE0 A;  4K0N A;  4K1F A;  2LQQ A;  5GST A;  4XHM A;  2DIY A;  1QFN A;  1VGL A;  3P23 A;  2JAE A;  2IMF A;  3CRT A;  5HR0 A;  3G7I A;  2AYT A;  3FW2 A;  3IE3 A;  4L8E A;  1TKD B;  4EKZ A;  1YEX A;  2H1D A;  3P2A A;  2AV4 A;  2HZF A;  3M8N A;  2MZC A;  2QA1 A;  3APS A;  1DUG A;  3DEX A;  5J41 A;  2LQO A;  5ECN B;  3FK8 A;  3GST A;  3P90 A;  1U88 A;  3GSS A;  1F3A A;  5KN0 A;  2O85 A;  3FVV A;  5KN1 A;  2H75 A;  5DDL A;  2V2G A;  2QSB A;  4XRD A;  3D0Z A;  4KDU A;  5GZZ B;  5IMD A;  3QPM A;  1K0A A;  4IP1 A;  5A4V A;  4AS2 A;  4MJA A;  1A2J A;  2R3X A;  2HE3 A;  3EWL A;  3HXS A;  4FYC A;  3W6G A;  2YWM A;  5ECL B;  5E4W A;  2QSI A;  1GSQ A;  1SU9 A;  1O81 A;  2QZG A;  1K3Y A;  1RK4 A;  3TKS A;  1SK0 A;  1O8W A;  1GH2 A;  2FCH A;  1AC1 A;  3NOF A;  2BTO T;  4PL5 A;  4KH7 A;  4TR4 A;  5ID2 A;  1SKR B;  2C3T A;  4CDO A;  1BAY A;  1E2Y A;  1WPI A;  2K18 A;  1FVK A;  3HYP A;  1GSY A;  1Z6N A;  1NHO A;  1JHB A;  2H73 A;  1BYE A;  4Q5Q A;  1O8X A;  5HGI A;  2GS3 A;  1N8J A;  4BL7 B;  4YQU A;  4TN8 A;  4HZ4 A;  4AJ7 A;  1J0F A;  4PNF A;  4JBB A;  3EVI A;  1K0C A;  3GTU A;  4F9Z A;  5IOX A;  1Z9H A;  2WDU A;  2QA2 A;  4JCV E;  4ZXG A;  4AGS A;  4CY8 A;  4ZBA A;  1Z7R A;  3C73 A;  2D2Z A;  4G19 A;  4XRA A;  1XWK A;  2C0E A;  2GZZ A;  2TRX A;  4YQV A;  1WJK A;  4GSN A;  3L9V A;  3I9V 2;  1RW1 A;  2ZRR A;  3QMX A;  1SL0 B;  5L71 A;  3EIN A;  4OAV B;  1Y25 A;  2F51 A;  2A2S A;  5JCG A;  4N10 A;  1MDK A;  2P31 A;  2WUL A;  5IOW A;  2EC4 A;  1PL1 A;  1MDJ A;  2A2P A;  1XG8 A;  3OR5 A;  4G75 A;  2H19 A;  1H4O A;  4IQ1 A;  2VCV A;  4PUF C;  5ECO B;  4IGJ A;  3ZVJ A;  4KDY A;  1U3I A;  1T3B A;  1GUK A;  5IMC A;  4TRX A;  2B7K A;  2WRT A;  4I8B A;  4IN0 A;  5D9X A;  3UVT A;  3J7Y k;  3ISO A;  2EIQ A;  3D21 A;  3APQ A;  2LUS A;  1A8Y A;  5H5R A;  3K8N A;  4QL7 A;  1NM3 A;  3L78 A;  1V9W A;  4LLR A;  2WFC A;  3MAK A;  10GS A;  2LTK A;  3MWH A;  1USB A;  4K9Z A;  3F4T A;  1PL2 A;  2FGX A;  3IV4 A;  3P7X A;  2AUV A;  4V2L A;  1Q98 A;  1ZYP A;  1YF1 A;  2L4C A;  2QKE A;  4QL9 A;  3KXO A;  2GQK A;  4KCA A;  1FHE A;  4NHZ A;  1F9M A;  1HNB A;  2FWH A;  4OFT A;  4OCE A;  3QDN A;  1J08 A;  1OC8 A;  2KUC A;  2H30 A;  3APO A;  4IBP A;  3FRC A;  1TK5 B;  4K0G A;  6GSU A;  2FUG 2;  2JZS A;  18GS A;  3GNJ A;  5CRW A;  4MZB A;  3N9J A;  3FYG A;  4HJ2 A;  3KTL A;  4X0X A;  3B55 A;  4DEJ A;  1DBY A;  2F66 B;  4HU7 A;  3F3R A;  2F8F A;  3P8W A;  5HR3 A;  3VI7 A;  1NW2 A;  3GKX A;  1U87 A;  4G9H A;  4NMU A;  3QFA C;  1YO7 A;  1OE7 A;  4IQA A;  4L0U A;  1K0B A;  2DJ0 A;  2OAD A;  1F3B A;  4X4J A;  1A0F A;  4MA9 A;  4MCU A;  3O6T A;  3KP9 A;  3GTU B;  4A5P A;  4TR3 A;  3LG6 A;  4LA1 A;  4OO5 A;  5ECK B;  5CRG A;  4EF0 A;  1VF3 A;  4BL7 A;  3CYN A;  1XOA A;  3KGK A;  1IYI A;  3CTG A;  4Z2R A;  6GST A;  4KW6 A;  5HQP A;  5F05 A;  3LYP A;  1EGO A;  5ELG A;  4CHS A;  4WET A;  2X49 A;  1M9A A;  3LSZ A;  1R7H A;  2VD0 A;  4OCF A;  1EV9 A;  2RLI A;  3LJ0 A;  3LOR A;  5ID2 B;  3CBU A;  4ECJ A;  1LJR A;  2CAQ A;  2BL8 A;  3IOS A;  2YJH A;  1G7E A;  4KB3 A;  1G6Y A;  4EXJ A;  2GST A;  1V58 A;  4ISD A;  3QCP A;  4K5R A;  5ECI B;  1XPV A;  3LW9 A;  1OYJ A;  1FAA A;  2L6D A;  2FU2 A;  4HEA 2;  2DSA A;  2ZW3 A;  2H74 A;  5CRD A;  5J5N A;  2VLV A;  1ZL9 A;  4HJM A;  1B48 A;  1B9Y C;  3UAR A;  1JLW A;  2OBI A;  3TOU A;  1XW9 A;  2EIO A;  5DQS A;  3FZ9 A;  3PIN A;  2E2M A;  4L0W A;  5GSS A;  1PQN A;  3IRA A;  3RHB A;  5IPG A;  2JL4 A;  3GIX A;  5ECR B;  4MZC A;  4WF5 A;  2PPT A;  5E59 A;  3IHQ A;  1YF0 A;  2VCX A;  2YWI A;  14GS A;  4FH8 A;  5ECS A;  2LJR A;  2KKM A;  1X5D A;  4G0K A;  1Y6E A;  5G2Z A;  2LEG A;  2PBJ A;  4HOJ A;  3ZFL A;  3DIE A;  2XBI A;  2HFD A;  5FT3 A;  2FEF A;  2M80 A;  4O5U A;  4WKW A;  1O6J A;  4TKY A;  4POL A;  1T4Z A;  3U6V A;  2JSY A;  1SJ8 A;  3SDJ A;  2CVK A;  2I81 A;  3H1N A;  4E8H A;  9GSS A;  1BG5 A;  5IM9 A;  2TRC P;  5IMA A;  4HSC X;  4MF7 A;  2JZT A;  2LJK A;  5ECQ B;  3CXG A;  5COH A;  1ML6 A;  2HRA A;  3HJO A;  2YN1 A;  1M2D A;  2RII A;  1YKC A;  4JU5 A;  3A2V A;  1TU8 A;  3WT1 A;  1TK0 B;  4AS3 A;  2JB2 A;  4G76 A;  3ZIJ A;  1WP0 A;  5G31 A;  2OE1 A;  4YKG A;  2H76 A;  1FG4 A;  2C4J A;  1SD8 A;  4XS6 A;  3UMA A;  4POB A;  2XBQ A;  3GX0 A;  4ZBD A;  3LYK A;  3TJJ A;  2IFQ A;  5C04 A;  1X5C A;  3FR3 A;  4OFN A;  4GSS A;  3FZ4 A;  2DJ3 A;  4JED A;  1YZX A;  4J56 E;  1GSD A;  2KHP A;  4ML6 A;  5DJM A;  4HUA A;  3UOM A;  4ECI A;  1PD2 1;  4EDY A;  3DKS A;  3ZIT A;  1XXU A;  3ZZX A;  1TI1 A;  1Z6M A;  4HI7 A;  2ZNM A;  3L0I A;  2O89 A;  1F37 A;  17GS A;  3LWA A;  1ST9 A;  4XCS A;  4MAB A;  4DSS A;  3IDV A;  2VO4 A;  2GT5 A;  3AY8 A;  3S9F A;  2LST A;  4AJ8 A;  3LJR A;  3HVS A;  3Q74 A;  1KBN A;  3DRN A;  3O3T A;  2RAD A;  2H66 A;  4TOP A;  4DVC A;  3I69 A;  4PGT A;  3BBY A;  3RDW A;  1EEJ A;  1W3S A;  3ZIV A;  4E8E A;  1GP1 A;  4PXO A;  5D9V A;  3VI5 A;  4HS1 A;  2YWN A;  4LMW A;  3H8Q A;  4O7H A;  2GSC A;  2LRT A;  1OKT A;  2UZ8 A;  2MBT A;  4MMM A;  4EO3 A;  5JWR B;  1PGT A;  2C8U A;  5A4U A;  3HY2 A;  4BPY A;  1TDI A;  5DCG A;  4RUV A;  3CTF A;  5CAX A;  19GS A;  1GLQ A;  2K9F A;  1N2A A;  2DLX A;  2A4V A;  5HFK A;  1JFU A;  2R0P A;  4ZB8 A;  1TXX A;  4WEY A;  4BVX A;  5A4W A;  2VIM A;  2F8A A;  4EVM A;  4JRR A;  4KCE A;  3VWX A;  4WBR D;  1JQO A;  4MP4 A;  5KN2 A;  4ZL7 A;  2A2C A;  4PL3 A;  1G6W A;  4POK A;  2KP2 A;  1FOV A;  2DBC A;  3M1G A;  4MZW A;  2X99 A;  3ME7 A;  3TOT A;  2E8G A;  3FR9 A;  1R5P A;  1QGV A;  3VPT A;  2FA4 A;  1ZGN A;  1CQH A;  4PQH A;  2IN3 A;  1MTC A;  1XOB A;  4HDE A;  4USS A;  4K5S A;  1UA5 A;  2HGK A;  22GS A;  4XTS A;  1ERT A;  2DKI A;  4GLT A;  2X8G A;  2PER A;  2CQ9 A;  1G0T A;  3KH9 A;  5FWG A;  1XW6 A;  5D73 A;  2LKU A;  4TVE A;  4I1T A;  4NXI A;  4L5O A;  3QAW A;  4N0V A;  2L6C A;  2YPM A;  2GQL A;  2XMX A;  5IMF A;  3GV1 A;  1AQW A;  2Z9S A;  4AJ6 A;  3BCK A;  1PMT A;  3LJ2 A;  4XS1 A;  3NZN A;  2I9H A;  3G7Y A;  2GDR A;  3BCI A;  3RAZ A;  4V1A g;  2BL7 A;  1J9B A;  3FMW A;  3TUE A;  1TI3 A;  2VCZ A;  4FIW A;  1R5A A;  4KND A;  1ZOF A;  3RBT A;  3VWW A;  2B3S A;  1IYH A;  3MIX A;  1GTI A;  5HFG A;  8GSS A;  3FBV A;  1GNE A;  1TDP A;  2VOC A;  5AIV A;  1VF4 A;  3ZRD A;  1WIK A;  1DE1 A;  1XZO A;  4EL1 A;  3D22 A;  3M9K A;  5GAP D;  1R26 A;  2VD1 A;  1ACV A;  4K7N A;  3ERW A;  4YZ9 A;  1Q4J A;  4KDX A;  4I5Q A;  2RLD A;  3KMN A;  6GSS A;  1GSF A;  1SL2 B;  4GCI A;  4H86 A;  2VCQ A;  3GHA A;  4K6X A;  4J57 E;  2J9H A;  2V32 A;  1O85 A;  4GQC A;  1VF2 A;  2B5Y A;  3GN3 A;  2YFA A;  2LV3 A;  4JZQ A;  1ABA A;  3KIJ A;  4TXO A;  2VL3 A;  5IO0 A;  2DMM A;  3A2W A;  2I4A A;  5H5S A;  4KAE A;  4LL1 B;  3A5I A;  1EOH A;  3GH9 A;  1U3A A;  3IK9 A;  4JE1 A;  3KJY A;  4EIP A;  1OC9 B;  1MEK A;  1WRY A;  4O32 A;  3HHV A;  4I6X A;  4K8M A;  2GT6 A;  3E9J B;  2CAZ B;  4LMV A;  4ACS A;  4IVF A;  1YJ6 A;  1A2L A;  3M9J A;  4XS4 B;  1YKA A;  2R2J A;  2PGT A;  3CSI A;  2HZE A;  1XBS A;  2O87 A;  1EWX A;  3TDG A;  5DAL A;  1M3I A;  1M2A A;  4KGI A;  1M2B A;  2TIR A;  4KSO A;  3VPQ A;  1GTA A;  2JB1 A;  2B1K A;  2HI7 A;  1HNA A;  2H0G A;  3Q6O A;  4Z7G A;  5CYY A;  3L9S A;  1M9B A;  3A5W A;  2MMZ A;  1X0R A;  1VRS D;  3HVN A;  1GRX A;  4N11 A;  3I43 A;  3DWV A;  2JZR A;  3DO9 A;  4JR6 A;  3VWV A;  3IAS 1;  1YQ1 A;  4OAU C;  4ZB9 A;  2C80 A;  4WR4 A;  2G2Q A;  4PTS A;  3TJK A;  2GQM A;  3VUR A;  1PSQ A;  2CV4 A;  2OJL A;  2P22 B;  4MDC A;  4NV5 A;  3MDK A;  3TRQ A;  4IJ3 A;  4V1A p;  3HJP A;  4XIH A;  1GUM A;  1ZZY A;  4TW5 A;  3QOU A;  2WB9 A;  2V6E A;  2KOK A;  4YAV A;  1TRU A;  2XTR A;  2GLR A;  4HQZ A;  3ERF A;  1A2M A;  1JZD A;  3UIW A;  1ZCP A;  2JSZ A;  2YP6 A;  5G5E A;  4EIQ A;  1PX7 A;  2J23 A;  1T1V A;  2R4V A;  4BVY B;  4HFV A;  4K7I A;  4MH3 A;  3Q19 A;  5ELA A;  4TR1 B;  4ML1 A;  1SYX A;  1PA3 A;  2DJ1 A;  2WGR A;  4ZL9 A;  1U6T A;  2FUG 1;  1HYU A;  3D4T A;  2B6M A;  4YQM A;  5JCU A;  2DIZ A;  5B8A A;  3WGE A;  5D96 A;  1WOU A;  3LEF A;  1F2E A;  4WBJ A;  4TXV A;  3WD6 A;  4PL4 A;  3ME8 A;  1ERV A;  2VM2 A;  3F4R A;  5CO3 A;  3TKQ A;  4HU9 A;  5J9C A;  5CP1 A;  1ZYN A;  4IHU A;  1A23 A;  2C1Y A;  1AUC A;  2CVD A;  4GF0 A;  4MJE A;  3F3Q A;  2K8V A;  2JB3 A;  2B5E A;  1LBK A;  2JAD A;  1MD4 A;  2WJU A;  2OAC A;  1K0N A;  2K8S A;  2H1A A;  5AIS A;  3F6D A;  2LNT A;  4GWR A;  4ULX A;  3O76 A;  1OVN A;  4O1O A;  1I9D A;  3TCO A;  4RI6 A;  2IMK A;  2ES7 A;  3TJG A;  2M72 A;  3IPZ A;  2XPD A;  2HRK A;  3GL5 A; 
#chains in the Genus database with same CATH homology
 2KLX A;  4KA0 A;  3PH9 A;  4ILF A;  3ED3 A;  2HNL A;  3LQ7 A;  4OFM A;  1THX A;  4HEA 1;  3N5O A;  4YZD A;  1XWC A;  3HZ8 A;  5LD0 A;  1RQM A;  5J3R A;  2CZ2 A;  2YZU A;  3FZA A;  4O5R A;  5G1K A;  5DVB A;  4TR0 A;  2BJX A;  2KP1 A;  2HSY A;  2L57 A;  2HYX A;  2HXK A;  1UN2 A;  1U5K A;  4MPF A;  5F0G A;  1T4Y A;  1V98 A;  5G1L A;  1JLV A;  4YZC A;  4DWL A;  5J4U A;  5LCZ A;  4Z7H A;  4F0C A;  3DVW A;  1Z7P A;  1W89 A;  1SL1 B;  3VA9 A;  4FQU A;  1EP7 A;  1W4V A;  2MMA A;  2A2D A;  3TJB A;  6GSY A;  2R37 A;  1KNG A;  4AF2 A;  3ZMK A;  1Z5Y E;  2I1U A;  5D9W A;  5F06 A;  2HRN A;  4FYU A;  2CX3 A;  1XFL A;  2R0C A;  1V2A A;  3DML A;  2YZH A;  1M0U A;  5AIX A;  5B8B A;  1K0O A;  3SBC A;  3H4K A;  1SKW B;  3M0F A;  2B7J A;  3KM6 A;  2X8C A;  5DAK B;  2PU9 C;  5JCW A;  11GS A;  3PGT A;  1FVJ A;  5IMZ A;  2E2G A;  4Z2T A;  1BED A;  2PVQ A;  4D73 B;  6GSX A;  5KEJ A;  2CT6 A;  1EGR A;  3KP8 A;  2YWO A;  3DA3 A;  4G2E A;  3IAM 2;  2R5G A;  3QAG A;  1HQO A;  4Q5F A;  3C71 A;  5J9B A;  2RIO A;  3WYW A;  2XTQ A;  2O7K A;  2R6K A;  1GWC A;  2REM A;  1QMV A;  1SYR A;  3GKN A;  5G30 A;  1EZK A;  4HQS A;  3V1W A;  1X9M B;  3BJ5 A;  5ECM B;  5JWO B;  5AGY A;  1I5G A;  3ZTL A;  4O1P A;  5C00 A;  1PKW A;  4F82 A;  1GUL A;  2GTU A;  4DSR A;  2DML A;  2WZ9 A;  3FR6 A;  1XWA A;  5IIZ A;  3F4S A;  3GKK A;  5ABR A;  3HZ4 A;  2OBK A;  1K0D A;  2P5Q A;  1ZYE A;  2XHF A;  3G9B A;  1PKZ A;  1XWB A;  1OC3 A;  2CVB A;  4RQX A;  5DQY A;  4NAX A;  4V2M A;  1WWJ A;  3FZ5 A;  3UIT A;  1EV4 A;  4Z7X A;  4F2I A;  1BQ7 A;  2FWG A;  3UBL A;  1NHY A;  2G0F A;  2O8V B;  1AIU A;  3DA4 A;  3EE2 A;  3R2Q A;  1XW5 A;  2C3N A;  3IHG A;  1ERU A;  20GS A;  1TRS A;  4N0Z A;  4D73 A;  2VL9 A;  2P0G A;  4PX1 A;  1O7U A;  5CRH A;  4DSQ A;  2HLS A;  3RPP A;  4ZIJ A;  2DJJ A;  1QK8 A;  3G7J A;  2OE0 A;  3PR8 A;  5KOW A;  5DAK A;  2PWJ A;  3C7M A;  3EUR A;  4MH2 A;  3F4M A;  3LXZ A;  3KMO A;  4MNN A;  1S3A A;  5EY6 A;  1ILO A;  4EDZ A;  2FNO A;  2V41 A;  1M99 A;  1X5E A;  2PUK C;  3VFI A;  1SJZ A;  1FOH A;  2FLS A;  1TK8 B;  4K2D A;  2NVL A;  4NPB A;  2RUE A;  3IAS 2;  2H72 A;  2FY6 A;  1O73 A;  3PPU A;  2NPB A;  2WCI A;  1X9S B;  5EPF A;  1GSS A;  3RPN A;  2BMX A;  5HFI A;  2RM5 A;  3TKP A;  3FEU A;  4I2U A;  3Q18 A;  1GL8 A;  2EIR A;  4PNG A;  3TKS C;  3UAP A;  5ECP B;  4MLY A;  3BOA A;  2VCW A;  3E3E A;  1B4Q A;  3GX8 A;  2N5A A;  2H01 A;  4WR5 A;  3TJF A;  1Z3E A;  2AHE A;  1SK2 A;  3TB2 A;  1H75 A;  2B1L A;  1A0R P;  2QGV A;  4ICY A;  1TU7 A;  3EU3 A;  4CW9 A;  2F9S A;  4GRF A;  5D9T A;  1M7T A;  2H6Z A;  2X64 A;  4LL4 B;  3IR4 A;  4EC0 A;  4G0I A;  1AXD A;  4GXT A;  2WS2 A;  1YY7 A;  4IP6 A;  6GSV A;  1GTU A;  5KOX A;  2NTO A;  1NSW A;  1V40 A;  4GQF A;  1QQ2 A;  5JWQ B;  3HD5 A;  4ZBB A;  3GMF A;  2HSM A;  3TGZ A;  3VWU A;  1THO A;  4KE3 A;  1SEN A;  1XCC A;  3VK9 A;  5HR1 A;  12GS A;  2IWT A;  1ERW A;  2H70 A;  4PUA A;  1SKS B;  3I9V 1;  1V57 A;  2IIY A;  2AAW A;  2X8H A;  3GA4 A;  1T8E B;  3ZL5 A;  2JU5 A;  3FY7 A;  3VLN A;  1C72 A;  3CSJ A;  13GS A;  5B7C A;  3D5J A;  1GNW A;  3GUR A;  3ZYW A;  3IC4 A;  3EC3 A;  2YFB A;  3US3 A;  4KUN A;  3UEM A;  3UVH A;  2E7P A;  4TR1 A;  2MYG A;  3E0U A;  3GH6 A;  4BVY A;  2GSQ A;  4NHW A;  3F6F A;  5ECH B;  2VL2 A;  2JAC A;  3IBH A;  2IMD A;  1T00 A;  2IME A;  1PN0 A;  2P5R A;  4ECC A;  1XWG A;  2YV7 A;  3L9U A;  3IXR A;  4V2N A;  1KTE A;  5G5F A;  2NDO A;  2C0G A;  2IPA A;  2X4A A;  2YAN A;  4HZ2 A;  2ALB A;  5H5Q A;  7GSS A;  4P3Y B;  2H0H A;  2H71 A;  1TTZ A;  1CQG A;  1XVQ A;  2FWE A;  3GUS A;  1JZW A;  2LRC A;  1B8X A;  1WE0 A;  2E0Q A;  2LS5 A;  1AW9 A;  4IS0 A;  1TRV A;  1A24 A;  3ERG A;  2DKH A;  3DD3 A;  4QQ7 A;  2A4H A;  2XPE A;  1XIY A;  2LNS A;  2FA8 A;  2HT9 A;  1K3O A;  5FHI A;  4FYB A;  2YJ7 A;  2F3M A;  2DC5 A;  3ZML A;  2AB6 A;  2ON5 A;  1LU4 A;  1UC7 A;  4IW9 A;  3D4M A;  5DAL B;  2FHE A;  3WGX A;  2HZE B;  2B5X A;  2V6O A;  4IEL A;  4ID0 A;  4XS4 A;  3R3E A;  2V6K A;  3HDC A;  2K19 A;  1OKD A;  4F03 A;  2CX4 A;  5LNK e;  2ZUP A;  2IL3 A;  3C1S A;  3KCM A;  4I97 A;  2N5B A;  1PRX A;  2L5O A;  2QC7 A;  2GSS A;  3EPT A;  1OC9 A;  3TKR A;  2L1L B;  3MSZ A;  5D8I A;  3DXB A;  3IA1 A;  1SJI A;  1HD2 A;  3KZQ A;  2C3Q A;  2GGT A;  1AQV A;  5LNK 1;  1GLP A;  2H1G A;  1AQX A;  2I3Y A;  3BD2 A;  2ZCT A;  2MMN A;  1TRW A;  4MJC A;  3FKF A;  4WF4 A;  4ZB6 A;  2VLT A;  3HJM A;  4PQI A;  3L0H A;  5BMU A;  2H8L A;  2YCD A;  2H6X A;  1SK1 A;  3EMP A;  4TXO B;  1R4W A;  3H79 A;  2OKA A;  4K2X A;  3KD0 A;  1PN9 A;  3WT2 A;  2NBS A;  3JCM L;  2MJF B;  1GSE A;  1A8L A;  1G7O A;  2GZY A;  1MD3 A;  1AAZ A;  2L4Q A;  4JR4 A;  4RI7 A;  1TOF A;  3QFB C;  4L5L A;  1K0M A;  2YNX A;  5AN1 A;  4IJI A;  3HKR A;  4MPG A;  2VAF A;  1EP8 A;  1F6M C;  1ON4 A;  2GVP A;  2IP6 A;  2H0I A;  4OMV A;  3AJF A;  4MF6 A;  3CSH A;  4GXZ A;  4K7O A;  3C1R A;  1UVZ A;  5IO2 A;  3TRX A;  4ZL8 A;  1DE2 A;  3MYD A;  5DBQ A;  2YOI A;  3DGQ A;  4WXT A;  4X1U A;  4N30 A;  1URM A;  5GAN D;  4OD7 A;  1FB6 A;  4MF5 A;  2IJY A;  4BA7 A;  5IPH A;  3EMX A;  1VF1 A;  1B9X C;  2XC2 A;  3KH7 A;  4BWS A;  1S3D A;  3LFL A;  2AJQ B;  2OA7 A;  4Q5R A;  1WMJ A;  2OE3 A;  4EUY A;  2V1C C;  1GTB A;  4G0L A;  3UL3 A;  3CRU A;  4KF9 A;  4F0B A;  1SD9 A;  1YEP A;  1EEM A;  1KEB A;  1FB0 A;  2YV9 A;  4NWY A;  1EOG A;  2A2R A;  3QR6 A;  5BRT A;  5CRE A;  2H1B A;  5IQY A;  3A3T A;  4BWQ A;  1B4P A;  2HRF A;  3ZVJ D;  5F8B A;  1GUH A;  3ZLP A;  1OAZ A;  4CY6 A;  3ZRE A;  2PMT A;  3WGD A;  3M3M A;  4X43 A;  3QAV A;  3NIV A;  4NV2 A;  3UJ1 A;  2F6M B;  1PX6 A;  3J7Y b;  4YH2 A;  4YAP A;  2V1M A;  2GZP A;  2C0F A;  2MMO A;  2DJK A;  1TJD A;  3D6I A;  5EL8 A;  3U5R E;  3W8S A;  5DJL A;  1JZO A;  3Q8D A;  2CZ3 A;  5B6M A;  1HNC A;  4BVX B;  1X9W B;  3F9U A;  3KTB A;  3UBK A;  5KN3 A;  5ENU A;  2DJ2 A;  4U6R A;  2VUP A;  3F0I A;  5D93 A;  4PQ1 A;  4RQR A;  1T7P B;  5F07 A;  1GSU A;  2FD3 A;  4O92 A;  1XVW A;  2M46 A;  3I6A A;  4GTU A;  3LXT A;  2VCT A;  1TW9 A;  1ZYQ B;  3CMI A;  3TKS E;  5DCH A;  3GFK A;  3LJ1 A;  1TP9 A;  3GL3 A;  1FO5 A;  3H93 A;  2MBS A;  5HR2 A;  2PN8 A;  4PUR A;  4POM A;  2CAI A;  5A5K A;  2LRN A;  2N5F A;  16GS A;  3DVX A;  4Q5N A;  5IMV A;  4Q9V A;  2GSR A;  4ZIL A;  4OWY A;  4DSS B;  3IAM 1;  1DSB A;  3GRX A;  1FW1 A;  2R0G A;  4OO4 A;  5INY A;  5B6N A;  4KX4 A;  1E6B A;  3GYK A;  3MNG A;  3QD9 A;  3IK7 A;  4GST A;  3C8E A;  3GKM A;  2RUF A;  2ON7 A;  3KEB A;  3HCZ A;  5EVO A;  1YDK A;  2CA8 A;  3FHK A;  4FO5 A;  3SWL A;  6GSW A;  4MK3 A;  3TRP A;  1BJX A;  2RM6 A;  2IFQ B;  1MDI A;  1SJ6 A;  3IC8 A;  1JZR A;  4ECB A;  1K3L A;  4G10 A;  4Z2U A;  2LJA A;  3EYT A;  4I2T A;  3DYR A;  2K6V A;  4KSM A;  3HVV A;  5CNW A;  3LGC A;  3RHC A;  3F8U A;  2C0D A;  2PVO C;  1BX9 A;  4MJB A;  3HA9 A;  1QUW A;  4YKF A;  3EU4 A;  2IMI A;  3W8J A;  3F63 A;  4J2F A;  3ZFB A;  1OE8 A;  2HSH A;  2VL2 C;  4O5Q A;  3A2X A;  2H6Y A;  2VM1 A;  3L4N A;  2FWF A;  1S3C A;  2L59 A;  2L5L A;  3HVX A;  4IKH A;  1ZMA A;  1QXH A;  2VLU A;  3JSB A;  4EE0 A;  4K0N A;  4K1F A;  2LQQ A;  5GST A;  4XHM A;  2DIY A;  1QFN A;  1VGL A;  3P23 A;  2JAE A;  2IMF A;  3CRT A;  5HR0 A;  3G7I A;  2AYT A;  3FW2 A;  3IE3 A;  4L8E A;  1TKD B;  4EKZ A;  1YEX A;  2H1D A;  3P2A A;  2AV4 A;  2HZF A;  3M8N A;  2MZC A;  2QA1 A;  3APS A;  1DUG A;  3DEX A;  5J41 A;  2LQO A;  5ECN B;  3FK8 A;  3GST A;  3P90 A;  1U88 A;  3GSS A;  1F3A A;  5KN0 A;  2O85 A;  5KN1 A;  2H75 A;  5DDL A;  2V2G A;  4XRD A;  3D0Z A;  4KDU A;  5GZZ B;  5IMD A;  3QPM A;  1K0A A;  4IP1 A;  5A4V A;  4AS2 A;  4MJA A;  1A2J A;  2R3X A;  2HE3 A;  3EWL A;  3HXS A;  4FYC A;  3W6G A;  2YWM A;  5ECL B;  5E4W A;  2QSI A;  1GSQ A;  1SU9 A;  1O81 A;  1K3Y A;  1RK4 A;  3TKS A;  1SK0 A;  1O8W A;  1GH2 A;  2FCH A;  1AC1 A;  3NOF A;  2BTO T;  4PL5 A;  4KH7 A;  4TR4 A;  5ID2 A;  1SKR B;  2C3T A;  4CDO A;  1BAY A;  1E2Y A;  1WPI A;  2K18 A;  1FVK A;  3HYP A;  1GSY A;  1Z6N A;  1NHO A;  1JHB A;  2H73 A;  1BYE A;  4Q5Q A;  1O8X A;  5HGI A;  2GS3 A;  1N8J A;  4BL7 B;  4YQU A;  4TN8 A;  4HZ4 A;  4AJ7 A;  1J0F A;  4PNF A;  4JBB A;  3EVI A;  1K0C A;  3GTU A;  4F9Z A;  5IOX A;  1Z9H A;  2WDU A;  2QA2 A;  4JCV E;  4ZXG A;  4AGS A;  4CY8 A;  4ZBA A;  1Z7R A;  3C73 A;  2D2Z A;  4G19 A;  4XRA A;  1XWK A;  2C0E A;  2GZZ A;  2TRX A;  4YQV A;  1WJK A;  4GSN A;  3L9V A;  3I9V 2;  1RW1 A;  2ZRR A;  3QMX A;  1SL0 B;  5L71 A;  3EIN A;  4OAV B;  1Y25 A;  2F51 A;  2A2S A;  5JCG A;  4N10 A;  1MDK A;  2P31 A;  2WUL A;  5IOW A;  2EC4 A;  1PL1 A;  1MDJ A;  2A2P A;  3OR5 A;  4G75 A;  2H19 A;  1H4O A;  4IQ1 A;  2VCV A;  4PUF C;  5ECO B;  4IGJ A;  3ZVJ A;  4KDY A;  1U3I A;  1T3B A;  1GUK A;  5IMC A;  4TRX A;  2B7K A;  2WRT A;  4I8B A;  4IN0 A;  5D9X A;  3UVT A;  3J7Y k;  3ISO A;  2EIQ A;  3D21 A;  3APQ A;  2LUS A;  1A8Y A;  5H5R A;  3K8N A;  4QL7 A;  1NM3 A;  3L78 A;  1V9W A;  4LLR A;  2WFC A;  3MAK A;  10GS A;  2LTK A;  3MWH A;  1USB A;  4K9Z A;  3F4T A;  1PL2 A;  2FGX A;  3IV4 A;  3P7X A;  2AUV A;  4V2L A;  1Q98 A;  1ZYP A;  1YF1 A;  2L4C A;  2QKE A;  4QL9 A;  3KXO A;  2GQK A;  4KCA A;  1FHE A;  4NHZ A;  1F9M A;  1HNB A;  2FWH A;  4OFT A;  4OCE A;  3QDN A;  1J08 A;  1OC8 A;  2KUC A;  2H30 A;  3APO A;  4IBP A;  3FRC A;  1TK5 B;  4K0G A;  6GSU A;  2FUG 2;  2JZS A;  18GS A;  3GNJ A;  5CRW A;  4MZB A;  3N9J A;  3FYG A;  4HJ2 A;  3KTL A;  4X0X A;  4DEJ A;  1DBY A;  2F66 B;  4HU7 A;  3F3R A;  2F8F A;  3P8W A;  5HR3 A;  3VI7 A;  1NW2 A;  3GKX A;  1U87 A;  4G9H A;  4NMU A;  3QFA C;  1YO7 A;  1OE7 A;  4IQA A;  4L0U A;  1K0B A;  2DJ0 A;  2OAD A;  1F3B A;  4X4J A;  1A0F A;  4MA9 A;  4MCU A;  3O6T A;  3KP9 A;  3GTU B;  4A5P A;  4TR3 A;  3LG6 A;  4LA1 A;  4OO5 A;  5ECK B;  5CRG A;  4EF0 A;  1VF3 A;  4BL7 A;  3CYN A;  1XOA A;  3KGK A;  1IYI A;  3CTG A;  4Z2R A;  6GST A;  4KW6 A;  5HQP A;  5F05 A;  3LYP A;  1EGO A;  5ELG A;  4CHS A;  4WET A;  2X49 A;  1M9A A;  3LSZ A;  1R7H A;  2VD0 A;  4OCF A;  1EV9 A;  2RLI A;  3LJ0 A;  3LOR A;  5ID2 B;  3CBU A;  4ECJ A;  1LJR A;  2CAQ A;  3IOS A;  2YJH A;  1G7E A;  4KB3 A;  1G6Y A;  4EXJ A;  2GST A;  1V58 A;  4ISD A;  3QCP A;  4K5R A;  5ECI B;  1XPV A;  3LW9 A;  1OYJ A;  1FAA A;  2L6D A;  4HEA 2;  2DSA A;  2H74 A;  5CRD A;  5J5N A;  2VLV A;  1ZL9 A;  4HJM A;  1B48 A;  1B9Y C;  3UAR A;  1JLW A;  2OBI A;  3TOU A;  1XW9 A;  2EIO A;  5DQS A;  3FZ9 A;  3PIN A;  2E2M A;  4L0W A;  5GSS A;  1PQN A;  3IRA A;  3RHB A;  5IPG A;  2JL4 A;  3GIX A;  5ECR B;  4MZC A;  4WF5 A;  2PPT A;  5E59 A;  3IHQ A;  1YF0 A;  2VCX A;  2YWI A;  14GS A;  4FH8 A;  5ECS A;  2LJR A;  2KKM A;  1X5D A;  4G0K A;  1Y6E A;  5G2Z A;  2LEG A;  2PBJ A;  4HOJ A;  3ZFL A;  3DIE A;  2XBI A;  2HFD A;  5FT3 A;  2M80 A;  4O5U A;  4WKW A;  1O6J A;  4TKY A;  4POL A;  1T4Z A;  3U6V A;  2JSY A;  1SJ8 A;  3SDJ A;  2CVK A;  2I81 A;  3H1N A;  4E8H A;  9GSS A;  1BG5 A;  5IM9 A;  2TRC P;  5IMA A;  4MF7 A;  2JZT A;  2LJK A;  5ECQ B;  3CXG A;  5COH A;  1ML6 A;  2HRA A;  3HJO A;  2YN1 A;  1M2D A;  2RII A;  1YKC A;  4JU5 A;  3A2V A;  1TU8 A;  3WT1 A;  1TK0 B;  4AS3 A;  2JB2 A;  4G76 A;  3ZIJ A;  1WP0 A;  5G31 A;  2OE1 A;  4YKG A;  2H76 A;  1FG4 A;  2C4J A;  1SD8 A;  4XS6 A;  3UMA A;  4POB A;  2XBQ A;  3GX0 A;  4ZBD A;  3LYK A;  3TJJ A;  2IFQ A;  5C04 A;  1X5C A;  3FR3 A;  4OFN A;  4GSS A;  3FZ4 A;  2DJ3 A;  4JED A;  1YZX A;  4J56 E;  1GSD A;  2KHP A;  4ML6 A;  5DJM A;  4HUA A;  3UOM A;  4ECI A;  1PD2 1;  4EDY A;  3DKS A;  3ZIT A;  1XXU A;  3ZZX A;  1TI1 A;  1Z6M A;  4HI7 A;  2ZNM A;  3L0I A;  2O89 A;  1F37 A;  17GS A;  3LWA A;  1ST9 A;  4XCS A;  4MAB A;  4DSS A;  3IDV A;  2VO4 A;  2GT5 A;  3AY8 A;  3S9F A;  2LST A;  4AJ8 A;  3LJR A;  3HVS A;  3Q74 A;  1KBN A;  3DRN A;  3O3T A;  2H66 A;  4TOP A;  4DVC A;  3I69 A;  4PGT A;  3BBY A;  3RDW A;  1EEJ A;  1W3S A;  3ZIV A;  4E8E A;  1GP1 A;  4PXO A;  5D9V A;  3VI5 A;  4HS1 A;  2YWN A;  4LMW A;  3H8Q A;  4O7H A;  2LRT A;  1OKT A;  2UZ8 A;  2MBT A;  4MMM A;  4EO3 A;  5JWR B;  1PGT A;  2C8U A;  5A4U A;  3HY2 A;  4BPY A;  1TDI A;  5DCG A;  4RUV A;  3CTF A;  5CAX A;  19GS A;  1GLQ A;  2K9F A;  1N2A A;  2DLX A;  2A4V A;  5HFK A;  1JFU A;  2R0P A;  4ZB8 A;  1TXX A;  4WEY A;  4BVX A;  5A4W A;  2VIM A;  2F8A A;  4EVM A;  4JRR A;  4KCE A;  3VWX A;  4WBR D;  4MP4 A;  5KN2 A;  4ZL7 A;  2A2C A;  4PL3 A;  1G6W A;  4POK A;  2KP2 A;  1FOV A;  2DBC A;  3M1G A;  4MZW A;  2X99 A;  3ME7 A;  3TOT A;  2E8G A;  3FR9 A;  1R5P A;  1QGV A;  3VPT A;  2FA4 A;  1ZGN A;  1CQH A;  4PQH A;  2IN3 A;  1MTC A;  1XOB A;  4HDE A;  4USS A;  4K5S A;  1UA5 A;  22GS A;  4XTS A;  1ERT A;  2DKI A;  4GLT A;  2X8G A;  2PER A;  2CQ9 A;  1G0T A;  3KH9 A;  5FWG A;  1XW6 A;  5D73 A;  2LKU A;  4TVE A;  4I1T A;  4NXI A;  4L5O A;  3QAW A;  4N0V A;  2L6C A;  2YPM A;  2GQL A;  2XMX A;  5IMF A;  3GV1 A;  1AQW A;  2Z9S A;  4AJ6 A;  3BCK A;  1PMT A;  3LJ2 A;  4XS1 A;  3NZN A;  2I9H A;  3G7Y A;  2GDR A;  3BCI A;  3RAZ A;  4V1A g;  1J9B A;  3FMW A;  3TUE A;  1TI3 A;  2VCZ A;  4FIW A;  1R5A A;  4KND A;  1ZOF A;  3RBT A;  3VWW A;  2B3S A;  1IYH A;  3MIX A;  1GTI A;  5HFG A;  8GSS A;  3FBV A;  1GNE A;  2VOC A;  5AIV A;  1VF4 A;  3ZRD A;  1WIK A;  1DE1 A;  1XZO A;  4EL1 A;  3D22 A;  3M9K A;  5GAP D;  1R26 A;  2VD1 A;  1ACV A;  4K7N A;  3ERW A;  4YZ9 A;  1Q4J A;  4KDX A;  4I5Q A;  3KMN A;  6GSS A;  1GSF A;  1SL2 B;  4GCI A;  4H86 A;  2VCQ A;  3GHA A;  4K6X A;  4J57 E;  2J9H A;  2V32 A;  1O85 A;  4GQC A;  1VF2 A;  2B5Y A;  3GN3 A;  2YFA A;  2LV3 A;  4JZQ A;  1ABA A;  3KIJ A;  4TXO A;  2VL3 A;  5IO0 A;  2DMM A;  3A2W A;  2I4A A;  5H5S A;  4KAE A;  4LL1 B;  3A5I A;  1EOH A;  3GH9 A;  1U3A A;  3IK9 A;  4JE1 A;  3KJY A;  4EIP A;  1OC9 B;  1MEK A;  1WRY A;  4O32 A;  3HHV A;  4I6X A;  4K8M A;  2GT6 A;  3E9J B;  2CAZ B;  4LMV A;  4ACS A;  4IVF A;  1YJ6 A;  1A2L A;  3M9J A;  4XS4 B;  1YKA A;  2R2J A;  2PGT A;  3CSI A;  2HZE A;  1XBS A;  2O87 A;  1EWX A;  3TDG A;  5DAL A;  1M2A A;  4KGI A;  1M2B A;  2TIR A;  4KSO A;  3VPQ A;  1GTA A;  2JB1 A;  2B1K A;  2HI7 A;  1HNA A;  2H0G A;  3Q6O A;  4Z7G A;  5CYY A;  3L9S A;  1M9B A;  3A5W A;  2MMZ A;  1X0R A;  1VRS D;  1GRX A;  4N11 A;  3I43 A;  3DWV A;  2JZR A;  3DO9 A;  4JR6 A;  3VWV A;  3IAS 1;  1YQ1 A;  4OAU C;  4ZB9 A;  2C80 A;  4WR4 A;  2G2Q A;  4PTS A;  3TJK A;  2GQM A;  3VUR A;  1PSQ A;  2CV4 A;  2OJL A;  2P22 B;  4MDC A;  4NV5 A;  3MDK A;  3TRQ A;  4IJ3 A;  4V1A p;  3HJP A;  4XIH A;  1GUM A;  1ZZY A;  4TW5 A;  3QOU A;  2WB9 A;  2V6E A;  2KOK A;  4YAV A;  1TRU A;  2XTR A;  2GLR A;  4HQZ A;  3ERF A;  1A2M A;  1JZD A;  3UIW A;  1ZCP A;  2JSZ A;  2YP6 A;  5G5E A;  4EIQ A;  1PX7 A;  2J23 A;  1T1V A;  2R4V A;  4BVY B;  4HFV A;  4K7I A;  4MH3 A;  3Q19 A;  5ELA A;  4TR1 B;  4ML1 A;  1SYX A;  1PA3 A;  2DJ1 A;  2WGR A;  4ZL9 A;  1U6T A;  2FUG 1;  1HYU A;  3D4T A;  2B6M A;  4YQM A;  5JCU A;  2DIZ A;  5B8A A;  3WGE A;  5D96 A;  1WOU A;  3LEF A;  1F2E A;  4WBJ A;  4TXV A;  3WD6 A;  4PL4 A;  3ME8 A;  1ERV A;  2VM2 A;  3F4R A;  5CO3 A;  3TKQ A;  4HU9 A;  5J9C A;  5CP1 A;  1ZYN A;  4IHU A;  1A23 A;  2C1Y A;  1AUC A;  2CVD A;  4GF0 A;  4MJE A;  3F3Q A;  2K8V A;  2JB3 A;  2B5E A;  1LBK A;  2JAD A;  1MD4 A;  2WJU A;  2OAC A;  1K0N A;  2K8S A;  2H1A A;  5AIS A;  3F6D A;  2LNT A;  4GWR A;  4ULX A;  3O76 A;  1OVN A;  4O1O A;  1I9D A;  3TCO A;  4RI6 A;  2IMK A;  2ES7 A;  3TJG A;  2M72 A;  3IPZ A;  2XPD A;  2HRK A;  3GL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...