4NV5A

C50a mutant of synechococcus vkor, c2 crystal form (dehydrated)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
266
structure length
259
Chain Sequence
RHSRLILAILAGLGSLLTAYLTYTKLTEQPAAGGCDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPDLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPLEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords VKORC1/thioredoxin domain protein
publication title Structures of an intramembrane vitamin K epoxide reductase homolog reveal control mechanisms for electron transfer.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 80
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4nv5A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nv5A02
17GSA 4I97A 5FT3A 3A2XA 3EYTA 4EUYA 3KEBA 2NDOA 2CZ3A 3ZIVA 3C73A 1AQXA 5LD0A 2VIMA 1UN2A 1GSQA 1M2DA 5G5FA 4OMVA 2E2GA 4XS1A 1AIUA 5AN1A 4TXOA 2VAFA 5IPHA 2FHEA 1V40A 3QCPA 2AHEA 1TRWA 3IRAA 4MH2A 1TRVA 5JWRB 1FVJA 2VCXA 3ZRDA 1H75A 3FHKA 2PGTA 1ILOA 3N5OA 3BOAA 1K0BA 2G2QA 1YEPA 2L6CA 2KP2A 5IOXA 4NHZA 4KCEA 1SL2B 3ERFA 3W8JA 5B6NA 4ILFA 1TOFA 4NMUA 5KN3A 2VD0A 4JR6A 2JU5A 3APOA 3BD2A 1VF2A 3M1GA 1K3YA 1YZXA 3I6AA 3KP8A 4GTUA 5B8BA 3CMIA 1K3LA 1TKDB 1XVQA 5J4UA 1G6WA 1Z3EA 2VCVA 3TJBA 2V32A 1TI1A 1XWGA 5D73A 2GSSA 2V41A 1XW5A 2VCTA 3F6DA 3GKMA 3L9VA 5AGYA 1PKZA 1SKWB 3SWLA 4KAEA 3L9UA 3Q18A 1I9DA 4XS4B 1EP8A 1VGLA 3KZQA 4GSSA 1OYJA 2YP6A 4K1FA 3EMXA 4V2NA 1GL8A 1EWXA 2P31A 4L8EA 2MBSA 1AXDA 3O6TA 1VF4A 3M3MA 3D22A 4LL4B 2M46A 3UVHA 2VL2C 3GKXA 3K8NA 1S3AA 1NM3A 4WEYA 3EURA 4HDEA 2GTUA 2VCWA 3MDKA 3LG6A 2CV4A 3ERWA 2D2ZA 1DBYA 3PINA 4O7HA 3ME8A 3E9JB 3GTUB 1GWCA 4ZBDA 1XBSA 2GSTA 3TJJA 1MTCA 1KEBA 1B4QA 1QQ2A 3VI7A 4TR4A 3LXZA 3FR6A 5DBQA 3FZ5A 2VD1A 1GUMA 2H19A 3DGQA 5ECSA 1WIKA 4N0VA 2JSZA 3D4MA 3TUEA 3GHAA 1MDKA 1R5AA 2KP1A 4P3YB 1QUWA 4BA7A 2XPDA 3VWXA 2X99A 3O76A 5J41A 2X64A 5A4WA 3S9FA 4Z7XA 5EPFA 10GSA 1FO5A 2LEGA 4K7NA 3DD3A 1X5EA 3IXRA 2OJLA 2C0DA 2EIOA 3EU4A 3ZFLA 1G7OA 3IK7A 3O3TA 2H1GA 2VOCA 2RUFA 2DJ0A 4NPBA 3A3TA 2C80A 4MJEA 2NPBA 4XTSA 2F51A 2FY6A 5EY6A 3CTFA 5J5NA 4LA1A 2CA8A 5HR0A 2JZTA 5G31A 1UC7A 3UIWA 4I8BA 1U88A 4ISDA 1XZOA 1C72A 3ZVJA 5GAPD 1PQNA 4GF0A 1X9WB 1X5DA 1OKTA 4BVYA 4YQVA 3DIEA 6GSSA 1A0FA 4IJIA 5ECMB 4MF7A 3NIVA 3GNJA 5ABRA 4MLYA 1ST9A 2HRNA 4BWQA 1XIYA 2E7PA 2FD3A 4EXJA 2HI7A 4CW9A 2FA8A 2IWTA 4PUAA 5AISA 4HZ2A 3HHVA 2WDUA 1M99A 3CTGA 3E0UA 4IKHA 3U6VA 3GKNA 4I2TA 3VWUA 1U3IA 1I5GA 3UBKA 4OO4A 3M9KA 1XPVA 4H86A 1PX6A 4KW6A 5F07A 2JADA 2MYGA 2B5XA 1OC9B 4G19A 4PNFA 4F82A 4V1Ag 4NV2A 4PUFC 4K7IA 3ZZXA 4YAVA 1SENA 3CXGA 4TVEA 2E0QA 3HY2A 3GL3A 1GTUA 5C04A 3LXTA 3QAWA 2HZEA 1OE8A 3KXOA 3H8QA 2O8VB 4EDYA 4HZ4A 3HJMA 2IFQB 4ZILA 4JZQA 5ECPB 2M80A 3UMAA 4EKZA 4MCUA 2B5EA 4KDYA 1GRXA 2BTOT 2GT6A 4PNGA 2FWGA 1GUHA 4IELA 2A2RA 2V6OA 2QGVA 1XWAA 1BYEA 2LSTA 3EWLA 3F3QA 4HOJA 1OKDA 1BAYA 3TDGA 2EIRA 3DWVA 1SJIA 1K0NA 1Z6MA 3HD5A 5IMCA 2N5FA 2VLVA 1Z9HA 4KB3A 6GSWA 2H74A 5EVOA 2PWJA 2RIIA 4EF0A 5CREA 2YNXA 6GSTA 4TW5A 2PERA 1M2AA 1B9XC 3G9BA 1V57A 2H73A 3VLNA 1X0RA 5FHIA 1GUKA 1XOBA 2YJHA 3FZAA 4WR4A 3LSZA 1A23A 4F9ZA 20GSA 2RLIA 1ZYEA 16GSA 2R6KA 5D9TA 4I5QA 4TR1B 2O89A 5ENUA 2OACA 5D93A 2REMA 3C7MA 2HZFA 3CYNA 1SKRB 1GSSA 5IMAA 4KCAA 1ABAA 4MH3A 4E8HA 2R4VA 4ZL9A 2L6DA 3RPPA 1F2EA 3TKSE 3QD9A 2H6ZA 2ZUPA 5HFGA 5IMZA 3EC3A 3ZIJA 4GCIA 5IOWA 1EP7A 4HJ2A 3RHCA 1V58A 5DJMA 2JACA 4Q5QA 4OWYA 4MDCA 3ZLPA 3P90A 1TRUA 1YQ1A 3DXBA 1WE0A 1KTEA 4WR5A 4AJ8A 5DAKA 4XHMA 5HR1A 2BMXA 1R7HA 1SL0B 3WYWA 1BEDA 1HNCA 2WFCA 1FVKA 1PL1A 1TI3A 1A2LA 2VM2A 2ZCTA 5H5SA 4F2IA 3MAKA 3EU3A 3IOSA 1XVWA 1TJDA 4FYUA 2C1YA 5GAND 1ERWA 1USBA 4K9ZA 4PURA 4HS1A 1K0DA 2VL2A 5G30A 2VL3A 3P8WA 4WF4A 4Q5RA 2EC4A 1JFUA 3FZ4A 2DBCA 3IAS2 1XWKA 4MABA 5KN1A 2ZNMA 4ZIJA 5ECOB 4X1UA 1SU9A 3WD6A 1V98A 3M9JA 1QXHA 4MZCA 3H93A 5DQSA 2O7KA 2L57A 4JRRA 3FRCA 2IMFA 1CQHA 1PD21 3A2VA 4ECCA 1WJKA 1HYUA 2VO4A 1ZGNA 2H8LA 2DJJA 4V2MA 4NV5A 1SJ6A 3Q19A 2VCQA 3RPNA 1WPIA 2R3XA 2HRFA 1ZZYA 5ECHB 2CVBA 2YPMA 4AGSA 4KSMA 1YEXA 2B7KA 4K7OA 1GTIA 4EO3A 4IGJA 2H0GA 1FW1A 3TGZA 3GRXA 3VWVA 3I69A 5LNKe 1A2MA 1FOVA 4ACSA 3HVXA 2R5GA 3UARA 5IO2A 1GTBA 3QR6A 2YCDA 2I1UA 3ZTLA 4ZB8A 3GL5A 3M0FA 6GSUA 1AC1A 3P7XA 2QKEA 2GZZA 2VUPA 2QC7A 2HXKA 2I81A 2A2SA 2LV3A 5D96A 1GTAA 2ON7A 4JU5A 1B48A 2EIQA 5ECRB 2GDRA 2YWMA 4JEDA 1GLQA 1PKWA 5A4UA 5IPGA 3KTBA 2FUG2 2DMLA 1TXXA 1JZDA 4BPYA 4XS6A 4WXTA 4LLRA 2CT6A 4N30A 5DALB 3FKFA 5G2ZA 2AB6A 5JCUA 13GSA 3HJOA 2WJUA 4FH8A 3DMLA 3QAGA 4DVCA 4HEA2 2DJ3A 3HA9A 3WT2A 1AQWA 4MK3A 3TKQA 1Z6NA 3UJ1A 3KTLA 3WGDA 1K0CA 3FW2A 1UA5A 3GN3A 1NHYA 2N5BA 3HVVA 4PGTA 1YJ6A 1JHBA 3W8SA 2P0GA 2YWIA 3KH7A 2OBKA 1OE7A 1SK1A 2FLSA 3GX0A 2YANA 1TDIA 4E8EA 3TKRA 3UEMA 5IMFA 4KX4A 3RDWA 1MDIA 3CSJA 3I43A 1ON4A 2DJ1A 1O7UA 1TU8A 1HNAA 3LWAA 4N10A 3KIJA 1FB0A 4ML1A 2ON5A 5G5EA 3ED3A 1SJZA 4GLTA 5IMVA 3F4SA 2LRTA 3MSZA 2AYTA 2R37A 1SD8A 1FHEA 1ERTA 4GQCA 3TRQA 5D9XA 4ZL8A 4OCEA 5ID2B 1EV4A 1TK5B 4QL9A 1Z5YE 1EZKA 2LRNA 6GSXA 2CAQA 1RK4A 1EOHA 3U5RE 4X0XA 1O8XA 3V1WA 1AAZA 1K0AA 3TOTA 1AW9A 3WGXA 4K2DA 4JE1A 2L4QA 4MJBA 4LMVA 5COHA 2WZ9A 2H0IA 4V2LA 9GSSA 3F6FA 3N9JA 3ME7A 1TP9A 4I2UA 4EVMA 5B8AA 5CRGA 4F0CA 4IBPA 3TRXA 5J9BA 2DSAA 3HDCA 5AIVA 4KA0A 3ZREA 1XXUA 1Y6EA 2HE3A 3DEXA 1F9MA 2Z9SA 1BG5A 2TIRA 2IL3A 4MJCA 1VRSD 3CSHA 2XBIA 2WGRA 4O92A 2C4JA 4ZB6A 2H76A 4D73B 3UL3A 2P5QA 2NTOA 2F3MA 1UVZA 3HZ8A 2HYXA 3LYKA 2GSRA 4XS4A 2HT9A 5DQYA 1TK8B 1PMTA 1R26A 1NW2A 3F63A 3ERGA 5A4VA 4KH7A 4NXIA 1SK2A 4DSSB 1YY7A 5FWGA 4KNDA 4K6XA 4O32A 3TJKA 3GYKA 3PH9A 1BX9A 4HQSA 2MMOA 3HKRA 4ZBAA 4MPFA 5LCZA 4N11A 2RM6A 3GTUA 2B1KA 2JSYA 3IA1A 2HFDA 3HJPA 3F0IA 2R2JA 5KEJA 2VLTA 2C3TA 1WP0A 4GWRA 2CQ9A 1OVNA 4KGIA 3NZNA 3IPZA 2LJKA 3E3EA 1X9MB 4WBJA 5CRHA 1FB6A 5HR3A 3UAPA 3VURA 5F0GA 4LL1B 4POMA 3GSSA 3VWWA 2JZRA 4GRFA 2OADA 2LNSA 1NHOA 2MBTA 4FIWA 1DUGA 1K3OA 2P5RA 1T8EB 4TKYA 2LQOA 2H75A 4AF2A 2ES7A 2H6XA 2GZYA 2AUVA 4YAPA 4OCFA 2HLSA 3TKSA 2B3SA 2IMKA 1XCCA 1YF1A 3GURA 1BQ7A 3M8NA 2IN3A 2F8FA 1EV9A 3GH9A 5DDLA 2HSHA 1SD9A 1LBKA 5EL8A 1EOGA 2C3QA 4ULXA 3H79A 1QK8A 2B5YA 4OO5A 4G9HA 5J3RA 2DC5A 2F9SA 5JWOB 4OFNA 5A5KA 2H30A 3DKSA 1NSWA 2DIYA 3L4NA 1ZMAA 3VI5A 4CHSA 2K6VA 3BBYA 2TRXA 2KHPA 3R2QA 2H72A 5HFIA 4LMWA 2IMIA 2H6YA 2CZ2A 2HSYA 1U87A 2XHFA 3DYRA 1O6JA 1AUCA 3D21A 3D6IA 4EC0A 2OKAA 2CVKA 1EGRA 4TXOB 1GNWA 1OC9A 3Q74A 1T00A 2V1MA 1THOA 1ML6A 2GQKA 4OFTA 1XOAA 5DCGA 1J9BA 3JCML 3L78A 4HQZA 1X9SB 4TRXA 6GSVA 3CSIA 1DSBA 2IJYA 3TKPA 1A0RP 3GFKA 1JLVA 3ZL5A 1TRSA 5ECIB 2IFQA 3KM6A 3CRUA 5G1KA 4Q5NA 3FY7A 3IR4A 7GSSA 1TU7A 5ECKB 1ERVA 1EGOA 8GSSA 5DCHA 5L71A 4J2FA 5IMDA 3APSA 4IHUA 1XW9A 3FR3A 4HJMA 5IM9A 3J7Yk 5ECQB 1X5CA 18GSA 3MNGA 4CDOA 2XC2A 4KE3A 4TR0A 4N0ZA 1A8YA 1B4PA 3TRPA 1HNBA 4JBBA 4K0NA 1G0TA 2PVQA 2B1LA 2B7JA 2LS5A 1SL1B 4BWSA 4J57E 2PMTA 4PQ1A 3EINA 1M9AA 4ECJA 3W6GA 2IPAA 3NOFA 3P2AA 4EE0A 3KH9A 5JCWA 5F05A 1F37A 4BVXA 2IMEA 5F8BA 4YQMA 1OC3A 1Z7PA 1BJXA 1O73A 11GSA 4TR1A 1G7EA 1JLWA 1RW1A 3LJRA 2LJRA 3UVTA 1VF1A 1A2JA 3TKSC 1HQOA 4NWYA 3GKKA 4WKWA 4MF6A 5F06A 3KGKA 2I4AA 3KJYA 2PBJA 4ECIA 1K0MA 5GSSA 4IJ3A 4MP4A 2M72A 4GSTA 1T4YA 2MMAA 4DSRA 3F8UA 1ZL9A 2H1BA 2OE3A 4NHWA 1RQMA 3GA4A 1J0FA 3TJGA 2TRCP 3UOMA 2K9FA 2KLXA 3LORA 5ELGA 3PR8A 3CRTA 3QPMA 2I9HA 2RM5A 2I3YA 1OAZA 1EEJA 1B9YC 1QFNA 4HU7A 4IP6A 2L5LA 2G0FA 3C71A 1YDKA 2YWOA 3BCKA 3ZMLA 2OE0A 1T7PB 2IIYA 5DJLA 2RUEA 3KP9A 2WULA 5CRWA 2H0HA 2JL4A 2C0GA 3IV4A 3WGEA 2VM1A 2C3NA 3RAZA 5G1LA 4G10A 3EMPA 3QFBC 1HD2A 3FYGA 1ZYQB 2F8AA 1JZRA 1IYIA 1J08A 5IO0A 3IK9A 2H70A 2GT5A 1K0OA 1U6TA 3Q6OA 2GZPA 19GSA 4X43A 1SYXA 1TTZA 4YQUA 1GSEA 1QGVA 4IW9A 3C1SA 1MD3A 4HU9A 5C00A 5KN0A 1WMJA 2DLXA 2YZUA 4RQRA 2FWEA 4GSNA 2XBQA 4L0WA 4WBRD 1VF3A 3IE3A 2GQLA 2X8HA 4MJAA 1YF0A 5D9VA 3FEUA 2L59A 4J56E 4XRAA 2MMNA 2DIZA 4AJ7A 4FYBA 4MMMA 4BL7A 2X8CA 5H5QA 1PA3A 2HZEB 4IP1A 22GSA 2AV4A 2YN1A 2ALBA 1H4OA 2YZHA 3OR5A 2C0FA 1GH2A 2E2MA 5ELAA 1Q4JA 5CYYA 3GV1A 2OE1A 2XPEA 1F3AA 4PXOA 1S3DA 3RBTA 2GQMA 1ZCPA 2H66A 3LYPA 4PQHA 2YV7A 4JR4A 1GNEA 1SKSB 5IIZA 2VLUA 1XFLA 3DRNA 5DALA 3C1RA 3PGTA 3I9V2 1GSUA 3L9SA 2V6KA 1GSYA 3LQ7A 5ECLB 4MPGA 1V9WA 2L4CA 4FO5A 3QOUA 4ZB9A 1N8JA 2JZSA 1GSDA 5D9WA 2HNLA 1DE2A 1T3BA 2CX4A 4L0UA 5KN2A 1F3BA 2WRTA 2BJXA 4TXVA 1Z7RA 4L5LA 4IQAA 1N2AA 3VPTA 1WRYA 4F03A 4KDUA 2J9HA 2OBIA 4XRDA 3MWHA 3D4TA 2X8GA 2YWNA 3GIXA 2V2GA 2B6MA 3F4TA 1TK0B 4TR3A 5CO3A 3TOUA 2LNTA 5CAXA 4RI7A 3CBUA 3ZVJD 5B6MA 5B7CA 4ZL7A 4EL1A 3KD0A 3QFAC 2DJ2A 2N5AA 4IVFA 4PX1A 3TCOA 1MEKA 3HXSA 4XCSA 1PGTA 3RHBA 3F9UA 1W89A 4POBA 1XWBA 1MD4A 3KMNA 3ZITA 1JZOA 3GH6A 3J7Yb 1AQVA 4OFMA 5ID2A 1M9BA 2WB9A 3D5JA 4KDXA 5DAKB 4POKA 2DMMA 1O81A 1M7TA 4AJ6A 2WS2A 1MDJA 3L0HA 3ZFBA 4O5RA 4FYCA 1EEMA 2O87A 3IBHA 2O85A 1THXA 1G6YA 1M2BA 1O8WA 3TJFA 2GS3A 3QDNA 3VPQA 3WT1A 4RI6A 4ECBA 4IN0A 2GSQA 3GUSA 2LUSA 1PL2A 1W4VA 1E2YA 5HR2A 2YOIA 1WWJA 4Q5FA 4L5OA 2AJQB 1R4WA 4EDZA 1JZWA 5INYA 14GSA 1V2AA 4QQ7A 3C8EA 3F3RA 3A5WA 2H1AA 1A24A 4IQ1A 12GSA 3GX8A 2OA7A 3HYPA 2NBSA 1XW6A 2MMZA 5E59A 3LFLA 3F4RA 3BJ5A 3QAVA 4V1Ap 1SK0A 2LRCA 2LTKA 3IC4A 2YV9A 1R5PA 1KBNA 3A2WA 3G7JA 4XIHA 5ECNB 2C0EA 2WCIA 3US3A 3UBLA 4TN8A 2H71A 4D73A 1PRXA 1M0UA 1CQGA 4MF5A 1XWCA 2NVLA 3ISOA 1LU4A 1Q98A 2L5OA 5DVBA 3ZMKA 4RUVA 4MZWA 5CRDA 5HFKA 1ZOFA 3H4KA 3GMFA 3ZYWA 1T1VA 4GXZA 3VK9A 1FAAA 4DSQA 2FNOA 2PN8A 3KCMA 2DJKA 2CX3A 4DSSA 4YH2A 3EVIA 3AY8A 1GP1A 2GLRA 2K8VA 3IDVA 2PU9C 4IS0A 1B8XA 1IYHA 2KUCA 1U3AA 4TOPA 2PPTA 1DE1A 2KOKA 1QMVA 2C8UA 2VCZA 5E4WA 3LGCA 3LEFA 4RQXA 1LJRA 5IQYA 5GSTA 1YKCA 1O85A 2FA4A 2H01A 1GSFA 1OC8A 1Y25A 4ML6A 4HUAA 4DEJA 1KNGA 2FWFA 2K8SA 4POLA 1ACVA 4WF5A 3EE2A 3G7IA 2FGXA 4NAXA 2QSIA 1T4ZA 6GSYA 2CAIA 2PVOC 2AAWA 5JCGA 3APQA 4KSOA 5CNWA 1F6MC 4OD7A 3TB2A 2MZCA 1PX7A 4GQFA 2A4VA 4K0GA 4HI7A 1ERUA 3HZ4A 2CVDA 2FCHA 5JWQB 3SBCA 5J9CA 1SYRA 4K8MA 3HVSA 1GULA 5GZZB 3IHQA 4I6XA 3HCZA 5D8IA 5H5RA 3FR9A 2LQQA 2GVPA 2J23A 2H1DA 4MZBA 3QMXA 1A8LA 2LJAA 1URMA 3FZ9A 1FG4A 3D0ZA 3BCIA 3G7YA 1GLPA 4PQIA 2IMDA 5HQPA 1PSQA 4QL7A 2YJ7A 4G2EA 1PN9A 3GSTA 1E6BA 1TW9A 2FWHA 4ZBBA 4F0BA 1S3CA 5CP1A 4KUNA 3DVXA 2PUKC 1YKAA 4ZXGA 2VL9A 3KMOA 5AIXA 3VFIA 3DVWA 2LKUA 3H1NA 2GGTA 3FK8A 4MA9A 2K18A 4ID0A 1WOUA 3IAM2 4WETA
chains in the Genus database with same CATH superfamily
17GSA 4I97A 5FT3A 3A2XA 3EYTA 3I9V1 4EUYA 3KEBA 2NDOA 2CZ3A 3ZIVA 3C73A 1AQXA 5LD0A 2VIMA 1UN2A 1GSQA 1M2DA 5G5FA 4OMVA 2E2GA 4XS1A 1AIUA 5AN1A 4TXOA 2VAFA 5IPHA 2FHEA 1V40A 3QCPA 2AHEA 1TRWA 3IRAA 4MH2A 1TRVA 5JWRB 1FVJA 2VCXA 3ZRDA 1H75A 3FHKA 2PGTA 2V1CC 1ILOA 3N5OA 3BOAA 1K0BA 2G2QA 1YEPA 2L6CA 2KKMA 2KP2A 5IOXA 4NHZA 3VA9A 4KCEA 1SL2B 3ERFA 3W8JA 5B6NA 4ILFA 3AJFA 1TOFA 4NMUA 5KN3A 2VD0A 4JR6A 2JU5A 3APOA 3BD2A 1VF2A 3M1GA 1K3YA 1YZXA 4Z7GA 3I6AA 3KP8A 4GTUA 5B8BA 3CMIA 1K3LA 1TKDB 1XVQA 5J4UA 1G6WA 1Z3EA 2VCVA 3TJBA 2V32A 1TI1A 3R3EA 1XWGA 5D73A 2GSSA 2V41A 1XW5A 2VCTA 3F6DA 3GKMA 3L9VA 4O1PA 5AGYA 1PKZA 1SKWB 3SWLA 3HVNA 4KAEA 3L9UA 3Q18A 1I9DA 4XS4B 1EP8A 1VGLA 3KZQA 4GSSA 1OYJA 2YP6A 3FVVA 4K1FA 3DO9A 3EMXA 4V2NA 1GL8A 1EWXA 2P31A 4L8EA 1ZYPA 1AXDA 3O6TA 2MBSA 1VF4A 3M3MA 3D22A 4LL4B 2M46A 3UVHA 2VL2C 3GKXA 3K8NA 1S3AA 1NM3A 4WEYA 3EURA 4HDEA 2GTUA 2VCWA 3MDKA 3LG6A 2CV4A 3ERWA 2D2ZA 1DBYA 3PINA 4G0KA 4O7HA 3ME8A 3E9JB 3GTUB 1GWCA 4ZBDA 1XBSA 2GSTA 3TJJA 1MTCA 1KEBA 1B4QA 2A2CA 1QQ2A 3VI7A 4TR4A 3LXZA 3FR6A 5DBQA 3FZ5A 2VD1A 1GUMA 2H19A 3DGQA 5ECSA 1WIKA 4N0VA 2JSZA 1W3SA 2RADA 3D4MA 3TUEA 3GHAA 1MDKA 1R5AA 2KP1A 4P3YB 1QUWA 4BA7A 2XPDA 3VWXA 2X99A 3O76A 5J41A 2X64A 5A4WA 3S9FA 4Z7XA 5EPFA 10GSA 1FO5A 2LEGA 4K7NA 3DD3A 1X5EA 3IXRA 2OJLA 2C0DA 2EIOA 3EU4A 3ZFLA 1G7OA 3IK7A 3O3TA 2H1GA 2VOCA 2RUFA 2DJ0A 4CY6A 4K5SA 3A3TA 4NPBA 2C80A 4MJEA 2NPBA 4XTSA 2F51A 2FY6A 3CQFA 2JAEA 5EY6A 3CTFA 5J5NA 4LA1A 2CA8A 5HR0A 2JZTA 5G31A 1UC7A 3DA4A 3UIWA 4I8BA 2HGKA 1U88A 4ISDA 1XZOA 1C72A 3ZVJA 5GAPD 1PQNA 4GF0A 1X9WB 1X5DA 2XTRA 1OKTA 4BVYA 4YQVA 3DIEA 6GSSA 1A0FA 4IJIA 5ECMB 4MF7A 3NIVA 3GNJA 5ABRA 4MLYA 1ST9A 2HRNA 4BWQA 1XIYA 2E7PA 2FD3A 4EXJA 2HI7A 4CW9A 2FA8A 2IWTA 4PUAA 5AISA 4HZ2A 2P22B 3HHVA 2WDUA 1M99A 3CTGA 3E0UA 4IKHA 3U6VA 3GKNA 4I2TA 3VWUA 1U3IA 1I5GA 3UBKA 4OO4A 4Q9VA 3M9KA 1XPVA 4H86A 4YKGA 1PX6A 4KW6A 5F07A 2JADA 2MYGA 2B5XA 2V6EA 1OC9B 4G19A 4PNFA 4F82A 2BL7A 4V1Ag 4NV2A 4PUFC 4K7IA 3ZZXA 4YAVA 1SENA 2R0CA 3CXGA 4TVEA 2E0QA 2QGMA 3HY2A 3GL3A 1GTUA 5C04A 4CY8A 3LXTA 3QAWA 2HZEA 1OE8A 3KXOA 3H8QA 2O8VB 4EDYA 4HZ4A 3HJMA 2IFQB 4ZILA 4JZQA 2QSBA 5ECPB 2M80A 3UMAA 4EKZA 4MCUA 2B5EA 4KDYA 1GRXA 2BTOT 4KF9A 2GT6A 4PNGA 2FWGA 1GUHA 4IELA 2A2RA 2V6OA 2QGVA 1XWAA 1BYEA 2LSTA 3EWLA 3F3QA 4HOJA 1OKDA 1BAYA 3TDGA 2EIRA 2IP6A 3DWVA 3HD5A 1SJIA 1K0NA 1Z6MA 5IMCA 2N5FA 2VLVA 1Z9HA 4KB3A 6GSWA 2H74A 5EVOA 2PWJA 2RIIA 4EF0A 5CREA 2YNXA 6GSTA 4TW5A 2PERA 1M2AA 1B9XC 3G9BA 1V57A 2H73A 3VLNA 1X0RA 5FHIA 1GUKA 1XOBA 2YJHA 3FZAA 4WR4A 3LSZA 1A23A 3EPTA 4F9ZA 3L0IA 4BVXB 20GSA 2RLIA 1ZYEA 16GSA 2R6KA 5D9TA 4I5QA 4TR1B 2O89A 5ENUA 2OACA 5D93A 2REMA 3C7MA 2HZFA 3CYNA 1SKRB 1GSSA 5IMAA 4KCAA 1ABAA 4MH3A 4E8HA 2R4VA 4ZL9A 2L6DA 3RPPA 1F2EA 3TKSE 3QD9A 2H6ZA 3IC8A 2ZUPA 5HFGA 5IMZA 3EC3A 3ZIJA 4GCIA 5IOWA 1EP7A 4HJ2A 3RHCA 1V58A 4OAVB 5DJMA 2JACA 4Q5QA 4OWYA 4MDCA 3ZLPA 4GXTA 3P90A 1TRUA 3LJ1A 1YQ1A 3DXBA 1WE0A 1KTEA 4WR5A 4AJ8A 5DAKA 4XHMA 5HR1A 2BMXA 1R7HA 1SL0B 3WYWA 1BEDA 1HNCA 2WFCA 1FVKA 1PL1A 1TI3A 1A2LA 2VM2A 2ZCTA 5H5SA 4F2IA 3MAKA 3EU3A 3IOSA 1XVWA 1TJDA 4FYUA 2C1YA 5GAND 1ERWA 1USBA 4K9ZA 4HS1A 4PURA 1K0DA 2VL2A 5G30A 2VL3A 3P8WA 4WF4A 4Q5RA 2EC4A 1JFUA 3FZ4A 2DBCA 3IAS2 1XWKA 4MABA 5KN1A 2ZNMA 4ZIJA 5ECOB 4X1UA 1SU9A 3WD6A 1V98A 3M9JA 1QXHA 4MZCA 3H93A 5DQSA 4AS3A 2O7KA 2L57A 4JRRA 3FRCA 2IMFA 1CQHA 1PD21 3A2VA 4ECCA 1WJKA 1HYUA 2VO4A 1ZGNA 2H8LA 2DJJA 4V2MA 4NV5A 1SJ6A 3Q19A 2VCQA 3RPNA 1WPIA 4Z2UA 2R3XA 2HRFA 1ZZYA 2YFAA 2GSCA 5ECHB 2CVBA 2YPMA 4AGSA 4KSMA 1YEXA 2B7KA 4K7OA 1GTIA 4EO3A 4IGJA 2H0GA 1FW1A 3TGZA 3GRXA 3VWVA 3I69A 5LNKe 1A2MA 3DA3A 1FOVA 4ACSA 2ZRRA 3HVXA 2R5GA 4BL7B 3LJ2A 3UARA 5IO2A 1GTBA 3QR6A 2YCDA 2I1UA 4O5UA 3ZTLA 4ZB8A 3GL5A 3M0FA 2XTQA 6GSUA 4PL4A 1AC1A 3P7XA 2QKEA 2GZZA 2VUPA 2QC7A 2HXKA 2I81A 2A2SA 2LV3A 5D96A 1GTAA 2ON7A 4JU5A 1B48A 2EIQA 5ECRB 1SJ8A 2GDRA 2YWMA 4JEDA 2QA1A 1GLQA 3F4MA 1PKWA 5A4UA 2L1LB 5IPGA 3KTBA 2FUG2 2DMLA 4Z2TA 1TXXA 1JZDA 4BPYA 4XS6A 4WXTA 4LLRA 2CT6A 1JQOA 4N30A 5DALB 3FKFA 5G2ZA 2AB6A 5JCUA 13GSA 3HJOA 2WJUA 4FH8A 3DMLA 3QAGA 4DVCA 4HEA2 2DJ3A 3HA9A 3WT2A 1AQWA 4MK3A 3TKQA 1Z6NA 3UJ1A 3KTLA 3WGDA 1K0CA 3FW2A 1UA5A 3GN3A 1NHYA 2N5BA 3HVVA 4PGTA 1YJ6A 4JCVE 1JHBA 3W8SA 2ETDA 2P0GA 3LW9A 2YWIA 3KH7A 2OBKA 3MIXA 1OE7A 2JB1A 1SK1A 2FLSA 3GX0A 2YANA 1TDIA 4E8EA 3TKRA 3UEMA 5IMFA 4KX4A 3RDWA 1MDIA 3CSJA 3I43A 1ON4A 2DJ1A 1O7UA 1TU8A 1HNAA 3LWAA 4N10A 3KIJA 1FB0A 4ML1A 2ON5A 5G5EA 3ED3A 1SJZA 4GLTA 5IMVA 1PN0A 3F4SA 2LRTA 3MSZA 2AYTA 2R37A 1SD8A 1FHEA 4EIQA 5BRTA 1ERTA 4GQCA 3TRQA 5D9XA 4ZL8A 4OCEA 5ID2B 1EV4A 1TK5B 4QL9A 1Z5YE 1EZKA 2LRNA 6GSXA 2CAQA 1RK4A 1EOHA 3U5RE 4X0XA 1O8XA 3V1WA 1AAZA 1K0AA 3TOTA 2FEFA 2X4AA 1AW9A 3WGXA 4PL3A 4K2DA 4JE1A 2L4QA 4MJBA 3PPUA 4LMVA 5COHA 2WZ9A 2H0IA 4V2LA 9GSSA 3F6FA 3N9JA 3ME7A 1TP9A 4I2UA 4EVMA 5B8AA 5CRGA 4F0CA 4IBPA 3TRXA 5J9BA 2DSAA 3HDCA 5AIVA 4KA0A 3ZREA 4K5RA 1XXUA 2R0PA 1Y6EA 2HE3A 3DEXA 1F9MA 2Z9SA 1BG5A 2TIRA 2IL3A 4MJCA 1VRSD 2DKIA 3CSHA 2XBIA 2WGRA 4O92A 2C4JA 4O5QA 4ZB6A 2JB2A 2H76A 4D73B 3UL3A 2P5QA 2NTOA 2F3MA 1UVZA 4Z7HA 3JSBA 3HZ8A 2HYXA 3LYKA 2GSRA 4XS4A 2HT9A 5DQYA 2QA2A 1TK8B 1PMTA 1R26A 1NW2A 3F63A 3ERGA 5A4VA 4KH7A 4NXIA 1SK2A 4DSSB 3UITA 1YY7A 5FWGA 4KNDA 4K6XA 4O32A 3TJKA 4Z2RA 4YZCA 3GYKA 3PH9A 1BX9A 2F6MB 4HQSA 1M3JA 2MMOA 3HKRA 4ZBAA 2BL8A 4MPFA 5LCZA 4N11A 2RM6A 3GTUA 2B1KA 2JSYA 3IA1A 2HFDA 3FMWA 3HJPA 3F0IA 2R2JA 5KEJA 2VLTA 2C3TA 1WP0A 4GWRA 2CQ9A 1OVNA 4KGIA 3NZNA 3IPZA 2LJKA 4FQUA 3E3EA 1X9MB 4WBJA 5CRHA 1FB6A 5HR3A 3UAPA 3VURA 5F0GA 4LL1B 4POMA 2RLDA 3GSSA 3VWWA 2JZRA 4G0LA 3P23A 4GRFA 2OADA 3IAM1 2LNSA 1NHOA 2MBTA 4FIWA 1DUGA 2UZ8A 1K3OA 2P5RA 1T8EB 4TKYA 4DWLA 2LQOA 2H75A 4AF2A 2ES7A 2H6XA 2GZYA 2AUVA 2XMXA 4YAPA 4OCFA 2HLSA 3TKSA 2B3SA 2IMKA 1XCCA 1YF1A 3GURA 1BQ7A 3M8NA 2IN3A 2F8FA 1EV9A 3GH9A 5DDLA 2HSHA 1SD9A 1LBKA 5EL8A 1EOGA 2C3QA 4ULXA 3H79A 1QK8A 2B5YA 4OO5A 4G9HA 5J3RA 4USSA 2DC5A 2F9SA 5JWOB 2FUG1 4OFNA 5A5KA 2H30A 3DKSA 1NSWA 2DIYA 3L4NA 1ZMAA 3VI5A 4CHSA 2K6VA 3BBYA 2DKHA 2TRXA 4G75A 2KHPA 3R2QA 4K2XA 2H72A 5HFIA 4LMWA 2IMIA 2H6YA 2CZ2A 2HSYA 1U87A 2XHFA 3DYRA 1O6JA 1AUCA 3D21A 3D6IA 4HSCX 4EC0A 2OKAA 4HEA1 2CVKA 1EGRA 4TXOB 1GNWA 1OC9A 2HSMA 3Q74A 5KOXA 1T00A 2V1MA 1THOA 1ML6A 2GQKA 4OFTA 1XOAA 5DCGA 1J9BA 1S3RA 3JCML 3L78A 4HQZA 1X9SB 4TRXA 6GSVA 3CSIA 2F66B 1DSBA 2IJYA 3TKPA 1A0RP 3GFKA 1JLVA 3ZL5A 1TRSA 5ECIB 2IFQA 3KM6A 3CRUA 4PTSA 5G1KA 4Q5NA 3FY7A 3IR4A 7GSSA 1TU7A 5ECKB 1ERVA 1EGOA 8GSSA 5DCHA 5L71A 4J2FA 5IMDA 3APSA 4IHUA 1XW9A 3FR3A 4X4JA 4HJMA 5IM9A 3J7Yk 5ECQB 1X5CA 18GSA 3MNGA 4CDOA 2XC2A 4KE3A 4TR0A 4N0ZA 1A8YA 1B4PA 3TRPA 1HNBA 4JBBA 4K0NA 1G0TA 2PVQA 2B1LA 2B7JA 2LS5A 1SL1B 4BWSA 4J57E 2PMTA 4PQ1A 3EINA 1M9AA 4ECJA 3W6GA 2IPAA 3NOFA 3P2AA 4EE0A 3KH9A 5JCWA 5KOWA 2QZGA 5F05A 1F37A 4BVXA 2IMEA 5F8BA 4YQMA 1OC3A 1Z7PA 1BJXA 1O73A 11GSA 4TR1A 1G7EA 1JLWA 4O1OA 4HFVA 1RW1A 3LJRA 2LJRA 3UVTA 1VF1A 1A2JA 2E8GA 3TKSC 1TDPA 1HQOA 4NWYA 3GKKA 4WKWA 4MF6A 5F06A 1M3IA 3KGKA 2I4AA 3KJYA 2PBJA 4ECIA 1K0MA 5GSSA 4IJ3A 4MP4A 2M72A 4GSTA 1T4YA 2MMAA 4DSRA 3F8UA 1ZL9A 2H1BA 2OE3A 4NHWA 1RQMA 3GA4A 1J0FA 3TJGA 2TRCP 3UOMA 2K9FA 2KLXA 3LORA 5ELGA 3PR8A 3CRTA 2K19A 2I9HA 3QPMA 2RM5A 2I3YA 1OAZA 1EEJA 1B9YC 1QFNA 4HU7A 4IP6A 2L5LA 2G0FA 4YZ9A 4A5PA 3C71A 1YDKA 2ZW3A 2YWOA 2MJFB 4AS2A 2JBWA 3BCKA 3ZMLA 3FBVA 2OE0A 1T7PB 2YFBA 2IIYA 5DJLA 2RUEA 2A4HA 3KP9A 2WULA 5CRWA 2H0HA 2JL4A 2C0GA 3IV4A 3WGEA 2VM1A 2C3NA 3RAZA 5G1LA 4G10A 3EMPA 3QFBC 1HD2A 3FYGA 1ZYQB 2F8AA 1JZRA 1IYIA 1J08A 4BVYB 5IO0A 3IK9A 2H70A 2GT5A 1K0OA 1U6TA 3Q6OA 2GZPA 19GSA 4X43A 1SYXA 1TTZA 4YQUA 1GSEA 1QGVA 1PFOA 4IW9A 3C1SA 1MD3A 4HU9A 5C00A 5KN0A 1WMJA 2DLXA 2YZUA 4RQRA 2FWEA 4GSNA 2XBQA 4L0WA 4WBRD 1VF3A 3IE3A 2GQLA 2X8HA 4MJAA 1YF0A 5D9VA 3FEUA 2L59A 4J56E 3Q8DA 4XRAA 2MMNA 2DIZA 4AJ7A 4FYBA 4MMMA 4BL7A 2X8CA 5H5QA 1PA3A 2HZEB 4IP1A 22GSA 2AV4A 2YN1A 2ALBA 2JB3A 1H4OA 2YZHA 3OR5A 2C0FA 1GH2A 2E2MA 5ELAA 1Q4JA 5CYYA 3GV1A 2OE1A 5LNK1 2XPEA 1F3AA 4PXOA 1S3DA 3RBTA 2GQMA 1ZCPA 2H66A 3LYPA 4PQHA 2YV7A 4JR4A 1GNEA 1SKSB 5IIZA 2VLUA 1XFLA 3DRNA 5DALA 3C1RA 3PGTA 3I9V2 1GSUA 3L9SA 2V6KA 1GSYA 5BMUA 3LQ7A 5ECLB 4MPGA 3MYDA 1V9WA 2L4CA 4FO5A 3QOUA 4ZB9A 1N8JA 2JZSA 1GSDA 5D9WA 2HNLA 1DE2A 1T3BA 2CX4A 4L0UA 5KN2A 1F3BA 2WRTA 2BJXA 4TXVA 1Z7RA 2HRKA 4L5LA 4IQAA 1N2AA 3VPTA 1WRYA 4ICYA 3IHGA 4F03A 4KDUA 2J9HA 2OBIA 4XRDA 3MWHA 4OAUC 2X8GA 3D4TA 2YWNA 3GIXA 2V2GA 2B6MA 3F4TA 1TK0B 4TR3A 5CO3A 3TOUA 2LNTA 5CAXA 4RI7A 3LJ0A 3CBUA 3ZVJD 4PL5A 3IAS1 5B6MA 5B7CA 3A5IA 4ZL7A 4EL1A 3KD0A 3QFAC 2DJ2A 2N5AA 4IVFA 4PX1A 3TCOA 1MEKA 3HXSA 4XCSA 1PGTA 3RHBA 3F9UA 1W89A 4POBA 1XWBA 1MD4A 3KMNA 3ZITA 1JZOA 3GH6A 3J7Yb 1AQVA 4OFMA 5ID2A 1M9BA 2WB9A 3D5JA 4KDXA 5DAKB 4POKA 2DMMA 1O81A 1M7TA 1YO7A 4AJ6A 2WS2A 1MDJA 3L0HA 3ZFBA 4O5RA 4FYCA 1EEMA 2O87A 3IBHA 4BIKA 2O85A 1THXA 1G6YA 1M2BA 1O8WA 3TJFA 2GS3A 3QDNA 3VPQA 3WT1A 4RI6A 4ECBA 4IN0A 2GSQA 3GUSA 2LUSA 1PL2A 1W4VA 1E2YA 5HR2A 2YOIA 1WWJA 4Q5FA 4L5OA 2AJQB 1R4WA 4EDZA 1JZWA 5INYA 14GSA 1V2AA 4QQ7A 3C8EA 3F3RA 3A5WA 2H1AA 1A24A 4IQ1A 4U6RA 12GSA 3GX8A 2OA7A 3HYPA 2NBSA 1XW6A 2MMZA 5E59A 3LFLA 3F4RA 3BJ5A 3QAVA 4V1Ap 1SK0A 2X49A 4I1TA 2LRCA 2LTKA 3IC4A 2YV9A 1R5PA 1KBNA 3A2WA 3G7JA 4XIHA 4G0IA 2CAZB 2C0EA 2WCIA 5ECNB 3US3A 3UBLA 4TN8A 2H71A 4D73A 1PRXA 1M0UA 1CQGA 4MF5A 1XWCA 2NVLA 3ISOA 1LU4A 1Q98A 2L5OA 5DVBA 4MNNA 3ZMKA 4RUVA 4MZWA 5CRDA 5HFKA 1ZOFA 3H4KA 3GMFA 3ZYWA 1T1VA 4GXZA 3VK9A 1FAAA 4DSQA 2FNOA 2PN8A 3KCMA 2DJKA 5HGIA 2RIOA 2CX3A 4DSSA 4YH2A 4G76A 3EVIA 3AY8A 1GP1A 2GLRA 2K8VA 3IDVA 2PU9C 4IS0A 1B8XA 1IYHA 2KUCA 1U3AA 4EIPA 4TOPA 2PPTA 2A2PA 1DE1A 2KOKA 1QMVA 2C8UA 2R0GA 2VCZA 3FNBA 5E4WA 3LGCA 3LEFA 4RQXA 1LJRA 5IQYA 5GSTA 1YKCA 1O85A 1XG8A 2FA4A 1U5KA 2H01A 1GSFA 1OC8A 1Y25A 4ML6A 4HUAA 4DEJA 1KNGA 2FWFA 2K8SA 4POLA 1ACVA 4WF5A 3EE2A 3G7IA 2FGXA 4NAXA 2QSIA 1T4ZA 6GSYA 2CAIA 2PVOC 2AAWA 5JCGA 3APQA 1FOHA 4KSOA 5CNWA 1F6MC 4OD7A 3TB2A 2MZCA 1PX7A 4GQFA 2A4VA 4K0GA 4HI7A 1ERUA 3HZ4A 2CVDA 2FCHA 5JWQB 3SBCA 5J9CA 1SYRA 4K8MA 3HVSA 1GULA 5GZZB 3IHQA 4I6XA 2A2DA 3HCZA 5D8IA 5H5RA 3FR9A 2LQQA 2GVPA 2J23A 2H1DA 4MZBA 3QMXA 1ZYNA 2HRAA 1A8LA 2LJAA 1URMA 3FZ9A 3SDJA 4YZDA 1FG4A 3D0ZA 3BCIA 3G7YA 1GLPA 4PQIA 2IMDA 5HQPA 1PSQA 4QL7A 2YJ7A 4G2EA 1PN9A 3GSTA 1E6BA 1TW9A 2FWHA 4ZBBA 4F0BA 1S3CA 4YKFA 5CP1A 4KUNA 3DVXA 2PUKC 1YKAA 4ZXGA 2VL9A 3KMOA 5AIXA 3B55A 3VFIA 3DVWA 2LKUA 2FU2A 3H1NA 2GGTA 3FK8A 4MA9A 2K18A 4ID0A 1WOUA 3IAM2 4WETA
chains in the Genus database with same CATH topology
17GSA 4I97A 5FT3A 3A2XA 3EYTA 3I9V1 4EUYA 3KEBA 2NDOA 2CZ3A 3ZIVA 3C73A 1AQXA 5LD0A 2VIMA 1UN2A 1GSQA 1M2DA 5G5FA 4OMVA 2E2GA 4XS1A 1AIUA 5AN1A 4TXOA 2VAFA 5IPHA 2FHEA 1V40A 3QCPA 2AHEA 1TRWA 3IRAA 4MH2A 1TRVA 5JWRB 1FVJA 2VCXA 3ZRDA 1H75A 3FHKA 2PGTA 2V1CC 1ILOA 3N5OA 3BOAA 1K0BA 2G2QA 1YEPA 2L6CA 2KKMA 2KP2A 5IOXA 4NHZA 3VA9A 4KCEA 1SL2B 3ERFA 3W8JA 5B6NA 4ILFA 3AJFA 1TOFA 4NMUA 5KN3A 2VD0A 4JR6A 2JU5A 3APOA 3BD2A 1VF2A 3M1GA 1K3YA 1YZXA 4Z7GA 3I6AA 3KP8A 4GTUA 5B8BA 3CMIA 1K3LA 1TKDB 1XVQA 5J4UA 1G6WA 1Z3EA 2VCVA 3TJBA 2V32A 1TI1A 3R3EA 1XWGA 5D73A 2GSSA 2V41A 1XW5A 2VCTA 3F6DA 3GKMA 3L9VA 4O1PA 5AGYA 1PKZA 1SKWB 3SWLA 4KAEA 3L9UA 3Q18A 1I9DA 4XS4B 1EP8A 1VGLA 3KZQA 4GSSA 1OYJA 2YP6A 4K1FA 3DO9A 3EMXA 4V2NA 1GL8A 1EWXA 2P31A 4L8EA 1ZYPA 1AXDA 3O6TA 2MBSA 1VF4A 3M3MA 3D22A 4LL4B 2M46A 3UVHA 2VL2C 3GKXA 3K8NA 1S3AA 1NM3A 4WEYA 3EURA 4HDEA 2GTUA 2VCWA 3MDKA 3LG6A 2CV4A 3ERWA 2D2ZA 1DBYA 3PINA 4G0KA 4O7HA 3ME8A 3E9JB 3GTUB 1GWCA 4ZBDA 1XBSA 2GSTA 3TJJA 1MTCA 1KEBA 1B4QA 2A2CA 1QQ2A 3VI7A 4TR4A 3LXZA 3FR6A 5DBQA 3FZ5A 2VD1A 1GUMA 2H19A 3DGQA 5ECSA 1WIKA 4N0VA 2JSZA 1W3SA 3D4MA 3TUEA 3GHAA 1MDKA 1R5AA 2KP1A 4P3YB 1QUWA 4BA7A 2XPDA 3VWXA 2X99A 3O76A 5J41A 2X64A 5A4WA 3S9FA 4Z7XA 5EPFA 10GSA 1FO5A 2LEGA 4K7NA 3DD3A 1X5EA 3IXRA 2OJLA 2C0DA 2EIOA 3EU4A 3ZFLA 1G7OA 3IK7A 3O3TA 2H1GA 2VOCA 2RUFA 2DJ0A 4CY6A 4K5SA 3A3TA 4NPBA 2C80A 4MJEA 2NPBA 4XTSA 2F51A 2FY6A 5EY6A 2JAEA 3CTFA 5J5NA 4LA1A 2CA8A 5HR0A 2JZTA 5G31A 1UC7A 3DA4A 3UIWA 4I8BA 1U88A 4ISDA 1XZOA 1C72A 3ZVJA 5GAPD 1PQNA 4GF0A 1X9WB 1X5DA 2XTRA 1OKTA 4BVYA 4YQVA 3DIEA 6GSSA 1A0FA 4IJIA 5ECMB 4MF7A 3NIVA 3GNJA 5ABRA 4MLYA 1ST9A 2HRNA 4BWQA 1XIYA 2E7PA 2FD3A 4EXJA 2HI7A 4CW9A 2FA8A 2IWTA 4PUAA 5AISA 4HZ2A 2P22B 3HHVA 2WDUA 1M99A 3CTGA 3E0UA 4IKHA 3U6VA 3GKNA 4I2TA 3VWUA 1U3IA 1I5GA 3UBKA 4OO4A 4Q9VA 3M9KA 1XPVA 4H86A 4YKGA 1PX6A 4KW6A 5F07A 2JADA 2MYGA 2B5XA 2V6EA 1OC9B 4G19A 4PNFA 4F82A 4V1Ag 4NV2A 4PUFC 4K7IA 3ZZXA 4YAVA 1SENA 2R0CA 3CXGA 4TVEA 2E0QA 3HY2A 3GL3A 1GTUA 5C04A 4CY8A 3LXTA 3QAWA 2HZEA 1OE8A 3KXOA 3H8QA 2O8VB 4EDYA 4HZ4A 3HJMA 2IFQB 4ZILA 4JZQA 5ECPB 2M80A 3UMAA 4EKZA 4MCUA 2B5EA 4KDYA 1GRXA 2BTOT 4KF9A 2GT6A 4PNGA 2FWGA 1GUHA 4IELA 2A2RA 2V6OA 2QGVA 1XWAA 1BYEA 2LSTA 3EWLA 3F3QA 4HOJA 1OKDA 1BAYA 3TDGA 2EIRA 2IP6A 3DWVA 3HD5A 1SJIA 1K0NA 1Z6MA 5IMCA 2N5FA 2VLVA 1Z9HA 4KB3A 6GSWA 2H74A 5EVOA 2PWJA 2RIIA 4EF0A 5CREA 2YNXA 6GSTA 4TW5A 2PERA 1M2AA 1B9XC 3G9BA 1V57A 2H73A 3VLNA 1X0RA 5FHIA 1GUKA 1XOBA 2YJHA 3FZAA 4WR4A 3LSZA 1A23A 3EPTA 4F9ZA 3L0IA 4BVXB 20GSA 2RLIA 1ZYEA 16GSA 2R6KA 5D9TA 4I5QA 4TR1B 2O89A 5ENUA 2OACA 5D93A 2REMA 3C7MA 2HZFA 3CYNA 1SKRB 1GSSA 5IMAA 4KCAA 1ABAA 4MH3A 4E8HA 2R4VA 4ZL9A 2L6DA 3RPPA 1F2EA 3TKSE 3QD9A 2H6ZA 3IC8A 2ZUPA 5HFGA 5IMZA 3EC3A 3ZIJA 4GCIA 5IOWA 1EP7A 4HJ2A 3RHCA 1V58A 4OAVB 5DJMA 2JACA 4Q5QA 4OWYA 4MDCA 3ZLPA 4GXTA 3P90A 1TRUA 3LJ1A 1YQ1A 3DXBA 1WE0A 1KTEA 4WR5A 4AJ8A 5DAKA 4XHMA 5HR1A 2BMXA 1R7HA 1SL0B 3WYWA 1BEDA 1HNCA 2WFCA 1FVKA 1PL1A 1TI3A 1A2LA 2VM2A 2ZCTA 5H5SA 4F2IA 3MAKA 3EU3A 3IOSA 1XVWA 1TJDA 4FYUA 2C1YA 5GAND 1ERWA 1USBA 4K9ZA 4PURA 4HS1A 1K0DA 2VL2A 5G30A 2VL3A 3P8WA 4WF4A 4Q5RA 2EC4A 1JFUA 3FZ4A 2DBCA 3IAS2 1XWKA 4MABA 5KN1A 2ZNMA 4ZIJA 5ECOB 4X1UA 1SU9A 3WD6A 1V98A 3M9JA 1QXHA 4MZCA 3H93A 5DQSA 4AS3A 2O7KA 2L57A 4JRRA 3FRCA 2IMFA 1CQHA 1PD21 3A2VA 4ECCA 1WJKA 1HYUA 2VO4A 1ZGNA 2H8LA 2DJJA 4V2MA 4NV5A 1SJ6A 3Q19A 2VCQA 3RPNA 1WPIA 4Z2UA 2R3XA 2HRFA 1ZZYA 2YFAA 5ECHB 2CVBA 2YPMA 4AGSA 4KSMA 1YEXA 2B7KA 4K7OA 1GTIA 4EO3A 4IGJA 2H0GA 1FW1A 3TGZA 3GRXA 3VWVA 3I69A 5LNKe 1A2MA 3DA3A 1FOVA 4ACSA 2ZRRA 3HVXA 2R5GA 4BL7B 3LJ2A 3UARA 5IO2A 1GTBA 3QR6A 2YCDA 2I1UA 4O5UA 3ZTLA 4ZB8A 3GL5A 3M0FA 2XTQA 6GSUA 4PL4A 1AC1A 3P7XA 2QKEA 2GZZA 2VUPA 2QC7A 2HXKA 2I81A 2A2SA 2LV3A 5D96A 1GTAA 2ON7A 4JU5A 1B48A 2EIQA 5ECRB 1SJ8A 2GDRA 2YWMA 4JEDA 2QA1A 1GLQA 3F4MA 1PKWA 5A4UA 2L1LB 5IPGA 3KTBA 2FUG2 2DMLA 4Z2TA 1TXXA 1JZDA 4BPYA 4XS6A 4WXTA 4LLRA 2CT6A 4N30A 5DALB 3FKFA 5G2ZA 2AB6A 5JCUA 13GSA 3HJOA 2WJUA 4FH8A 3DMLA 3QAGA 4DVCA 4HEA2 2DJ3A 3HA9A 3WT2A 1AQWA 4MK3A 3TKQA 1Z6NA 3UJ1A 3KTLA 3WGDA 1K0CA 3FW2A 1UA5A 3GN3A 1NHYA 2N5BA 3HVVA 4PGTA 1YJ6A 4JCVE 1JHBA 3W8SA 2P0GA 3LW9A 2YWIA 3KH7A 2OBKA 3MIXA 1OE7A 2JB1A 1SK1A 2FLSA 3GX0A 2YANA 1TDIA 4E8EA 3TKRA 3UEMA 5IMFA 4KX4A 3RDWA 1MDIA 3CSJA 3I43A 1ON4A 2DJ1A 1O7UA 1TU8A 1HNAA 3LWAA 4N10A 3KIJA 1FB0A 4ML1A 2ON5A 5G5EA 3ED3A 1SJZA 4GLTA 5IMVA 1PN0A 3F4SA 2LRTA 3MSZA 2AYTA 2R37A 1SD8A 1FHEA 4EIQA 5BRTA 1ERTA 4GQCA 3TRQA 5D9XA 4ZL8A 4OCEA 5ID2B 1EV4A 1TK5B 4QL9A 1Z5YE 1EZKA 2LRNA 6GSXA 2CAQA 1RK4A 1EOHA 3U5RE 4X0XA 1O8XA 3V1WA 1AAZA 1K0AA 3TOTA 2X4AA 1AW9A 3WGXA 4PL3A 4K2DA 4JE1A 2L4QA 4MJBA 3PPUA 4LMVA 5COHA 2WZ9A 2H0IA 4V2LA 9GSSA 3F6FA 3N9JA 3ME7A 1TP9A 4I2UA 4EVMA 5B8AA 5CRGA 4F0CA 4IBPA 3TRXA 5J9BA 2DSAA 3HDCA 5AIVA 4KA0A 3ZREA 4K5RA 1XXUA 2R0PA 1Y6EA 2HE3A 3DEXA 1F9MA 2Z9SA 1BG5A 2TIRA 2IL3A 4MJCA 1VRSD 2DKIA 3CSHA 2XBIA 2WGRA 4O92A 2C4JA 4O5QA 4ZB6A 2JB2A 2H76A 4D73B 3UL3A 2P5QA 2NTOA 2F3MA 1UVZA 4Z7HA 3JSBA 3HZ8A 2HYXA 3LYKA 2GSRA 4XS4A 2HT9A 5DQYA 2QA2A 1TK8B 1PMTA 1R26A 1NW2A 3F63A 3ERGA 5A4VA 4KH7A 4NXIA 1SK2A 4DSSB 3UITA 1YY7A 5FWGA 4KNDA 4K6XA 4O32A 3TJKA 4Z2RA 4YZCA 3GYKA 3PH9A 1BX9A 2F6MB 4HQSA 2MMOA 3HKRA 4ZBAA 4MPFA 5LCZA 4N11A 2RM6A 3GTUA 2B1KA 2JSYA 3IA1A 2HFDA 3FMWA 3HJPA 3F0IA 2R2JA 5KEJA 2VLTA 2C3TA 1WP0A 4GWRA 2CQ9A 1OVNA 4KGIA 3NZNA 3IPZA 2LJKA 4FQUA 3E3EA 1X9MB 4WBJA 5CRHA 1FB6A 5HR3A 3UAPA 3VURA 5F0GA 4LL1B 4POMA 3GSSA 3VWWA 2JZRA 4G0LA 3P23A 4GRFA 2OADA 3IAM1 2LNSA 1NHOA 2MBTA 4FIWA 1DUGA 2UZ8A 1K3OA 2P5RA 1T8EB 4TKYA 4DWLA 2LQOA 2H75A 4AF2A 2ES7A 2H6XA 2GZYA 2AUVA 2XMXA 4YAPA 4OCFA 2HLSA 3TKSA 2B3SA 2IMKA 1XCCA 1YF1A 3GURA 1BQ7A 3M8NA 2IN3A 2F8FA 1EV9A 3GH9A 5DDLA 2HSHA 1SD9A 1LBKA 5EL8A 1EOGA 2C3QA 4ULXA 3H79A 1QK8A 2B5YA 4OO5A 4G9HA 5J3RA 4USSA 2DC5A 2F9SA 5JWOB 2FUG1 4OFNA 5A5KA 2H30A 3DKSA 1NSWA 2DIYA 3L4NA 1ZMAA 3VI5A 4CHSA 2K6VA 3BBYA 2DKHA 2TRXA 4G75A 2KHPA 3R2QA 4K2XA 2H72A 5HFIA 4LMWA 2IMIA 2H6YA 2CZ2A 2HSYA 1U87A 2XHFA 3DYRA 1O6JA 1AUCA 3D21A 3D6IA 4EC0A 2OKAA 4HEA1 2CVKA 1EGRA 4TXOB 1GNWA 1OC9A 2HSMA 3Q74A 5KOXA 1T00A 2V1MA 1THOA 1ML6A 2GQKA 4OFTA 1XOAA 5DCGA 1J9BA 3JCML 3L78A 4HQZA 1X9SB 4TRXA 6GSVA 3CSIA 2F66B 1DSBA 2IJYA 3TKPA 1A0RP 3GFKA 1JLVA 3ZL5A 1TRSA 5ECIB 2IFQA 3KM6A 3CRUA 4PTSA 5G1KA 4Q5NA 3FY7A 3IR4A 7GSSA 1TU7A 5ECKB 1ERVA 1EGOA 8GSSA 5DCHA 5L71A 4J2FA 5IMDA 3APSA 4IHUA 1XW9A 3FR3A 4X4JA 4HJMA 5IM9A 3J7Yk 5ECQB 1X5CA 18GSA 3MNGA 4CDOA 2XC2A 4KE3A 4TR0A 4N0ZA 1A8YA 1B4PA 3TRPA 1HNBA 4JBBA 4K0NA 1G0TA 2PVQA 2B1LA 2B7JA 2LS5A 1SL1B 4BWSA 4J57E 2PMTA 4PQ1A 3EINA 1M9AA 4ECJA 3W6GA 2IPAA 3NOFA 3P2AA 4EE0A 3KH9A 5JCWA 5KOWA 5F05A 1F37A 4BVXA 2IMEA 5F8BA 4YQMA 1OC3A 1Z7PA 1BJXA 1O73A 11GSA 4TR1A 1G7EA 1JLWA 4O1OA 4HFVA 1RW1A 3LJRA 2LJRA 3UVTA 1VF1A 1A2JA 2E8GA 3TKSC 1HQOA 4NWYA 3GKKA 4WKWA 4MF6A 5F06A 3KGKA 2I4AA 3KJYA 2PBJA 4ECIA 1K0MA 5GSSA 4IJ3A 4MP4A 2M72A 4GSTA 1T4YA 2MMAA 4DSRA 3F8UA 1ZL9A 2H1BA 2OE3A 4NHWA 1RQMA 3GA4A 1J0FA 3TJGA 2TRCP 3UOMA 2K9FA 2KLXA 3LORA 5ELGA 3PR8A 3CRTA 2K19A 2I9HA 3QPMA 2RM5A 2I3YA 1OAZA 1EEJA 1B9YC 1QFNA 4HU7A 4IP6A 2L5LA 2G0FA 4YZ9A 4A5PA 3C71A 1YDKA 2YWOA 2MJFB 4AS2A 3BCKA 3ZMLA 3FBVA 2OE0A 1T7PB 2YFBA 2IIYA 5DJLA 2RUEA 2A4HA 3KP9A 2WULA 5CRWA 2H0HA 2JL4A 2C0GA 3IV4A 3WGEA 2VM1A 2C3NA 3RAZA 5G1LA 4G10A 3EMPA 3QFBC 1HD2A 3FYGA 1ZYQB 2F8AA 1JZRA 1IYIA 1J08A 4BVYB 5IO0A 3IK9A 2H70A 2GT5A 1K0OA 1U6TA 3Q6OA 2GZPA 19GSA 4X43A 1SYXA 1TTZA 4YQUA 1GSEA 1QGVA 4IW9A 3C1SA 1MD3A 4HU9A 5C00A 5KN0A 1WMJA 2DLXA 2YZUA 4RQRA 2FWEA 4GSNA 2XBQA 4L0WA 4WBRD 1VF3A 3IE3A 2GQLA 2X8HA 4MJAA 1YF0A 5D9VA 3FEUA 2L59A 4J56E 3Q8DA 4XRAA 2MMNA 2DIZA 4AJ7A 4FYBA 4MMMA 4BL7A 2X8CA 5H5QA 1PA3A 2HZEB 4IP1A 22GSA 2AV4A 2YN1A 2ALBA 2JB3A 1H4OA 2YZHA 3OR5A 2C0FA 1GH2A 2E2MA 5ELAA 1Q4JA 5CYYA 3GV1A 2OE1A 5LNK1 2XPEA 1F3AA 4PXOA 1S3DA 3RBTA 2GQMA 1ZCPA 2H66A 3LYPA 4PQHA 2YV7A 4JR4A 1GNEA 1SKSB 5IIZA 2VLUA 1XFLA 3DRNA 5DALA 3C1RA 3PGTA 3I9V2 1GSUA 3L9SA 2V6KA 1GSYA 5BMUA 3LQ7A 5ECLB 4MPGA 3MYDA 1V9WA 2L4CA 4FO5A 3QOUA 4ZB9A 1N8JA 2JZSA 1GSDA 5D9WA 2HNLA 1DE2A 1T3BA 2CX4A 4L0UA 5KN2A 1F3BA 2WRTA 2BJXA 4TXVA 1Z7RA 2HRKA 4L5LA 4IQAA 1N2AA 3VPTA 1WRYA 4ICYA 3IHGA 4F03A 4KDUA 2J9HA 2OBIA 4XRDA 3MWHA 4OAUC 2X8GA 3D4TA 2YWNA 3GIXA 2V2GA 2B6MA 3F4TA 1TK0B 4TR3A 5CO3A 3TOUA 2LNTA 5CAXA 4RI7A 3LJ0A 3CBUA 3ZVJD 4PL5A 3IAS1 5B6MA 5B7CA 3A5IA 4ZL7A 4EL1A 3KD0A 3QFAC 2DJ2A 2N5AA 4IVFA 4PX1A 3TCOA 1MEKA 3HXSA 4XCSA 1PGTA 3RHBA 3F9UA 1W89A 4POBA 1XWBA 1MD4A 3KMNA 3ZITA 1JZOA 3GH6A 3J7Yb 1AQVA 4OFMA 5ID2A 1M9BA 2WB9A 3D5JA 4KDXA 5DAKB 4POKA 2DMMA 1O81A 1M7TA 1YO7A 4AJ6A 2WS2A 1MDJA 3L0HA 3ZFBA 4O5RA 4FYCA 1EEMA 2O87A 3IBHA 2O85A 1THXA 1G6YA 1M2BA 1O8WA 3TJFA 2GS3A 3QDNA 3VPQA 3WT1A 4RI6A 4ECBA 4IN0A 2GSQA 3GUSA 2LUSA 1PL2A 1W4VA 1E2YA 5HR2A 2YOIA 1WWJA 4Q5FA 4L5OA 2AJQB 1R4WA 4EDZA 1JZWA 5INYA 14GSA 1V2AA 4QQ7A 3C8EA 3F3RA 3A5WA 2H1AA 1A24A 4IQ1A 4U6RA 12GSA 3GX8A 2OA7A 3HYPA 2NBSA 1XW6A 2MMZA 5E59A 3LFLA 3F4RA 3BJ5A 3QAVA 4V1Ap 1SK0A 2X49A 4I1TA 2LRCA 2LTKA 3IC4A 2YV9A 1R5PA 1KBNA 3A2WA 3G7JA 4XIHA 4G0IA 2CAZB 2C0EA 2WCIA 5ECNB 3US3A 3UBLA 4TN8A 2H71A 4D73A 1PRXA 1M0UA 1CQGA 4MF5A 1XWCA 2NVLA 3ISOA 1LU4A 1Q98A 2L5OA 5DVBA 4MNNA 3ZMKA 4RUVA 4MZWA 5CRDA 5HFKA 1ZOFA 3H4KA 3GMFA 3ZYWA 1T1VA 4GXZA 3VK9A 1FAAA 4DSQA 2FNOA 2PN8A 3KCMA 2DJKA 5HGIA 2RIOA 2CX3A 4DSSA 4YH2A 4G76A 3EVIA 3AY8A 1GP1A 2GLRA 2K8VA 3IDVA 2PU9C 4IS0A 1B8XA 1IYHA 2KUCA 1U3AA 4EIPA 4TOPA 2PPTA 2A2PA 1DE1A 2KOKA 1QMVA 2C8UA 2R0GA 2VCZA 5E4WA 3LGCA 3LEFA 4RQXA 1LJRA 5IQYA 5GSTA 1YKCA 1O85A 2FA4A 1U5KA 2H01A 1GSFA 1OC8A 1Y25A 4ML6A 4HUAA 4DEJA 1KNGA 2FWFA 2K8SA 4POLA 1ACVA 4WF5A 3EE2A 3G7IA 2FGXA 4NAXA 2QSIA 1T4ZA 6GSYA 2CAIA 2PVOC 2AAWA 5JCGA 3APQA 1FOHA 4KSOA 5CNWA 1F6MC 4OD7A 3TB2A 2MZCA 1PX7A 4GQFA 2A4VA 4K0GA 4HI7A 1ERUA 3HZ4A 2CVDA 2FCHA 5JWQB 3SBCA 5J9CA 1SYRA 4K8MA 3HVSA 1GULA 5GZZB 3IHQA 4I6XA 2A2DA 3HCZA 5D8IA 5H5RA 3FR9A 2LQQA 2GVPA 2J23A 2H1DA 4MZBA 3QMXA 1ZYNA 2HRAA 1A8LA 2LJAA 1URMA 3FZ9A 3SDJA 4YZDA 1FG4A 3D0ZA 3BCIA 3G7YA 1GLPA 4PQIA 2IMDA 5HQPA 1PSQA 4QL7A 2YJ7A 4G2EA 1PN9A 3GSTA 1E6BA 1TW9A 2FWHA 4ZBBA 4F0BA 1S3CA 4YKFA 5CP1A 4KUNA 3DVXA 2PUKC 1YKAA 4ZXGA 2VL9A 3KMOA 5AIXA 3VFIA 3DVWA 2LKUA 3H1NA 2GGTA 3FK8A 4MA9A 2K18A 4ID0A 1WOUA 3IAM2 4WETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 17GS A;  4I97 A;  5FT3 A;  3A2X A;  3EYT A;  4EUY A;  3KEB A;  2NDO A;  2CZ3 A;  3ZIV A;  3C73 A;  1AQX A;  5LD0 A;  2VIM A;  1UN2 A;  1GSQ A;  1M2D A;  5G5F A;  4OMV A;  2E2G A;  4XS1 A;  1AIU A;  5AN1 A;  4TXO A;  2VAF A;  5IPH A;  2FHE A;  1V40 A;  3QCP A;  2AHE A;  1TRW A;  3IRA A;  4MH2 A;  1TRV A;  5JWR B;  1FVJ A;  2VCX A;  3ZRD A;  1H75 A;  3FHK A;  2PGT A;  1ILO A;  3N5O A;  3BOA A;  1K0B A;  2G2Q A;  1YEP A;  2L6C A;  2KP2 A;  5IOX A;  4NHZ A;  4KCE A;  1SL2 B;  3ERF A;  3W8J A;  5B6N A;  4ILF A;  1TOF A;  4NMU A;  5KN3 A;  2VD0 A;  4JR6 A;  2JU5 A;  3APO A;  3BD2 A;  1VF2 A;  3M1G A;  1K3Y A;  1YZX A;  3I6A A;  3KP8 A;  4GTU A;  5B8B A;  3CMI A;  1K3L A;  1TKD B;  1XVQ A;  5J4U A;  1G6W A;  1Z3E A;  2VCV A;  3TJB A;  2V32 A;  1TI1 A;  1XWG A;  5D73 A;  2GSS A;  2V41 A;  1XW5 A;  2VCT A;  3F6D A;  3GKM A;  3L9V A;  5AGY A;  1PKZ A;  1SKW B;  3SWL A;  4KAE A;  3L9U A;  3Q18 A;  1I9D A;  4XS4 B;  1EP8 A;  1VGL A;  3KZQ A;  4GSS A;  1OYJ A;  2YP6 A;  4K1F A;  3EMX A;  4V2N A;  1GL8 A;  1EWX A;  2P31 A;  4L8E A;  2MBS A;  1AXD A;  3O6T A;  1VF4 A;  3M3M A;  3D22 A;  4LL4 B;  2M46 A;  3UVH A;  2VL2 C;  3GKX A;  3K8N A;  1S3A A;  1NM3 A;  4WEY A;  3EUR A;  4HDE A;  2GTU A;  2VCW A;  3MDK A;  3LG6 A;  2CV4 A;  3ERW A;  2D2Z A;  1DBY A;  3PIN A;  4O7H A;  3ME8 A;  3E9J B;  3GTU B;  1GWC A;  4ZBD A;  1XBS A;  2GST A;  3TJJ A;  1MTC A;  1KEB A;  1B4Q A;  1QQ2 A;  3VI7 A;  4TR4 A;  3LXZ A;  3FR6 A;  5DBQ A;  3FZ5 A;  2VD1 A;  1GUM A;  2H19 A;  3DGQ A;  5ECS A;  1WIK A;  4N0V A;  2JSZ A;  3D4M A;  3TUE A;  3GHA A;  1MDK A;  1R5A A;  2KP1 A;  4P3Y B;  1QUW A;  4BA7 A;  2XPD A;  3VWX A;  2X99 A;  3O76 A;  5J41 A;  2X64 A;  5A4W A;  3S9F A;  4Z7X A;  5EPF A;  10GS A;  1FO5 A;  2LEG A;  4K7N A;  3DD3 A;  1X5E A;  3IXR A;  2OJL A;  2C0D A;  2EIO A;  3EU4 A;  3ZFL A;  1G7O A;  3IK7 A;  3O3T A;  2H1G A;  2VOC A;  2RUF A;  2DJ0 A;  4NPB A;  3A3T A;  2C80 A;  4MJE A;  2NPB A;  4XTS A;  2F51 A;  2FY6 A;  5EY6 A;  3CTF A;  5J5N A;  4LA1 A;  2CA8 A;  5HR0 A;  2JZT A;  5G31 A;  1UC7 A;  3UIW A;  4I8B A;  1U88 A;  4ISD A;  1XZO A;  1C72 A;  3ZVJ A;  5GAP D;  1PQN A;  4GF0 A;  1X9W B;  1X5D A;  1OKT A;  4BVY A;  4YQV A;  3DIE A;  6GSS A;  1A0F A;  4IJI A;  5ECM B;  4MF7 A;  3NIV A;  3GNJ A;  5ABR A;  4MLY A;  1ST9 A;  2HRN A;  4BWQ A;  1XIY A;  2E7P A;  2FD3 A;  4EXJ A;  2HI7 A;  4CW9 A;  2FA8 A;  2IWT A;  4PUA A;  5AIS A;  4HZ2 A;  3HHV A;  2WDU A;  1M99 A;  3CTG A;  3E0U A;  4IKH A;  3U6V A;  3GKN A;  4I2T A;  3VWU A;  1U3I A;  1I5G A;  3UBK A;  4OO4 A;  3M9K A;  1XPV A;  4H86 A;  1PX6 A;  4KW6 A;  5F07 A;  2JAD A;  2MYG A;  2B5X A;  1OC9 B;  4G19 A;  4PNF A;  4F82 A;  4V1A g;  4NV2 A;  4PUF C;  4K7I A;  3ZZX A;  4YAV A;  1SEN A;  3CXG A;  4TVE A;  2E0Q A;  3HY2 A;  3GL3 A;  1GTU A;  5C04 A;  3LXT A;  3QAW A;  2HZE A;  1OE8 A;  3KXO A;  3H8Q A;  2O8V B;  4EDY A;  4HZ4 A;  3HJM A;  2IFQ B;  4ZIL A;  4JZQ A;  5ECP B;  2M80 A;  3UMA A;  4EKZ A;  4MCU A;  2B5E A;  4KDY A;  1GRX A;  2BTO T;  2GT6 A;  4PNG A;  2FWG A;  1GUH A;  4IEL A;  2A2R A;  2V6O A;  2QGV A;  1XWA A;  1BYE A;  2LST A;  3EWL A;  3F3Q A;  4HOJ A;  1OKD A;  1BAY A;  3TDG A;  2EIR A;  3DWV A;  1SJI A;  1K0N A;  1Z6M A;  3HD5 A;  5IMC A;  2N5F A;  2VLV A;  1Z9H A;  4KB3 A;  6GSW A;  2H74 A;  5EVO A;  2PWJ A;  2RII A;  4EF0 A;  5CRE A;  2YNX A;  6GST A;  4TW5 A;  2PER A;  1M2A A;  1B9X C;  3G9B A;  1V57 A;  2H73 A;  3VLN A;  1X0R A;  5FHI A;  1GUK A;  1XOB A;  2YJH A;  3FZA A;  4WR4 A;  3LSZ A;  1A23 A;  4F9Z A;  20GS A;  2RLI A;  1ZYE A;  16GS A;  2R6K A;  5D9T A;  4I5Q A;  4TR1 B;  2O89 A;  5ENU A;  2OAC A;  5D93 A;  2REM A;  3C7M A;  2HZF A;  3CYN A;  1SKR B;  1GSS A;  5IMA A;  4KCA A;  1ABA A;  4MH3 A;  4E8H A;  2R4V A;  4ZL9 A;  2L6D A;  3RPP A;  1F2E A;  3TKS E;  3QD9 A;  2H6Z A;  2ZUP A;  5HFG A;  5IMZ A;  3EC3 A;  3ZIJ A;  4GCI A;  5IOW A;  1EP7 A;  4HJ2 A;  3RHC A;  1V58 A;  5DJM A;  2JAC A;  4Q5Q A;  4OWY A;  4MDC A;  3ZLP A;  3P90 A;  1TRU A;  1YQ1 A;  3DXB A;  1WE0 A;  1KTE A;  4WR5 A;  4AJ8 A;  5DAK A;  4XHM A;  5HR1 A;  2BMX A;  1R7H A;  1SL0 B;  3WYW A;  1BED A;  1HNC A;  2WFC A;  1FVK A;  1PL1 A;  1TI3 A;  1A2L A;  2VM2 A;  2ZCT A;  5H5S A;  4F2I A;  3MAK A;  3EU3 A;  3IOS A;  1XVW A;  1TJD A;  4FYU A;  2C1Y A;  5GAN D;  1ERW A;  1USB A;  4K9Z A;  4PUR A;  4HS1 A;  1K0D A;  2VL2 A;  5G30 A;  2VL3 A;  3P8W A;  4WF4 A;  4Q5R A;  2EC4 A;  1JFU A;  3FZ4 A;  2DBC A;  3IAS 2;  1XWK A;  4MAB A;  5KN1 A;  2ZNM A;  4ZIJ A;  5ECO B;  4X1U A;  1SU9 A;  3WD6 A;  1V98 A;  3M9J A;  1QXH A;  4MZC A;  3H93 A;  5DQS A;  2O7K A;  2L57 A;  4JRR A;  3FRC A;  2IMF A;  1CQH A;  1PD2 1;  3A2V A;  4ECC A;  1WJK A;  1HYU A;  2VO4 A;  1ZGN A;  2H8L A;  2DJJ A;  4V2M A;  4NV5 A;  1SJ6 A;  3Q19 A;  2VCQ A;  3RPN A;  1WPI A;  2R3X A;  2HRF A;  1ZZY A;  5ECH B;  2CVB A;  2YPM A;  4AGS A;  4KSM A;  1YEX A;  2B7K A;  4K7O A;  1GTI A;  4EO3 A;  4IGJ A;  2H0G A;  1FW1 A;  3TGZ A;  3GRX A;  3VWV A;  3I69 A;  5LNK e;  1A2M A;  1FOV A;  4ACS A;  3HVX A;  2R5G A;  3UAR A;  5IO2 A;  1GTB A;  3QR6 A;  2YCD A;  2I1U A;  3ZTL A;  4ZB8 A;  3GL5 A;  3M0F A;  6GSU A;  1AC1 A;  3P7X A;  2QKE A;  2GZZ A;  2VUP A;  2QC7 A;  2HXK A;  2I81 A;  2A2S A;  2LV3 A;  5D96 A;  1GTA A;  2ON7 A;  4JU5 A;  1B48 A;  2EIQ A;  5ECR B;  2GDR A;  2YWM A;  4JED A;  1GLQ A;  1PKW A;  5A4U A;  5IPG A;  3KTB A;  2FUG 2;  2DML A;  1TXX A;  1JZD A;  4BPY A;  4XS6 A;  4WXT A;  4LLR A;  2CT6 A;  4N30 A;  5DAL B;  3FKF A;  5G2Z A;  2AB6 A;  5JCU A;  13GS A;  3HJO A;  2WJU A;  4FH8 A;  3DML A;  3QAG A;  4DVC A;  4HEA 2;  2DJ3 A;  3HA9 A;  3WT2 A;  1AQW A;  4MK3 A;  3TKQ A;  1Z6N A;  3UJ1 A;  3KTL A;  3WGD A;  1K0C A;  3FW2 A;  1UA5 A;  3GN3 A;  1NHY A;  2N5B A;  3HVV A;  4PGT A;  1YJ6 A;  1JHB A;  3W8S A;  2P0G A;  2YWI A;  3KH7 A;  2OBK A;  1OE7 A;  1SK1 A;  2FLS A;  3GX0 A;  2YAN A;  1TDI A;  4E8E A;  3TKR A;  3UEM A;  5IMF A;  4KX4 A;  3RDW A;  1MDI A;  3CSJ A;  3I43 A;  1ON4 A;  2DJ1 A;  1O7U A;  1TU8 A;  1HNA A;  3LWA A;  4N10 A;  3KIJ A;  1FB0 A;  4ML1 A;  2ON5 A;  5G5E A;  3ED3 A;  1SJZ A;  4GLT A;  5IMV A;  3F4S A;  2LRT A;  3MSZ A;  2AYT A;  2R37 A;  1SD8 A;  1FHE A;  1ERT A;  4GQC A;  3TRQ A;  5D9X A;  4ZL8 A;  4OCE A;  5ID2 B;  1EV4 A;  1TK5 B;  4QL9 A;  1Z5Y E;  1EZK A;  2LRN A;  6GSX A;  2CAQ A;  1RK4 A;  1EOH A;  3U5R E;  4X0X A;  1O8X A;  3V1W A;  1AAZ A;  1K0A A;  3TOT A;  1AW9 A;  3WGX A;  4K2D A;  4JE1 A;  2L4Q A;  4MJB A;  4LMV A;  5COH A;  2WZ9 A;  2H0I A;  4V2L A;  9GSS A;  3F6F A;  3N9J A;  3ME7 A;  1TP9 A;  4I2U A;  4EVM A;  5B8A A;  5CRG A;  4F0C A;  4IBP A;  3TRX A;  5J9B A;  2DSA A;  3HDC A;  5AIV A;  4KA0 A;  3ZRE A;  1XXU A;  1Y6E A;  2HE3 A;  3DEX A;  1F9M A;  2Z9S A;  1BG5 A;  2TIR A;  2IL3 A;  4MJC A;  1VRS D;  3CSH A;  2XBI A;  2WGR A;  4O92 A;  2C4J A;  4ZB6 A;  2H76 A;  4D73 B;  3UL3 A;  2P5Q A;  2NTO A;  2F3M A;  1UVZ A;  3HZ8 A;  2HYX A;  3LYK A;  2GSR A;  4XS4 A;  2HT9 A;  5DQY A;  1TK8 B;  1PMT A;  1R26 A;  1NW2 A;  3F63 A;  3ERG A;  5A4V A;  4KH7 A;  4NXI A;  1SK2 A;  4DSS B;  1YY7 A;  5FWG A;  4KND A;  4K6X A;  4O32 A;  3TJK A;  3GYK A;  3PH9 A;  1BX9 A;  4HQS A;  2MMO A;  3HKR A;  4ZBA A;  4MPF A;  5LCZ A;  4N11 A;  2RM6 A;  3GTU A;  2B1K A;  2JSY A;  3IA1 A;  2HFD A;  3HJP A;  3F0I A;  2R2J A;  5KEJ A;  2VLT A;  2C3T A;  1WP0 A;  4GWR A;  2CQ9 A;  1OVN A;  4KGI A;  3NZN A;  3IPZ A;  2LJK A;  3E3E A;  1X9M B;  4WBJ A;  5CRH A;  1FB6 A;  5HR3 A;  3UAP A;  3VUR A;  5F0G A;  4LL1 B;  4POM A;  3GSS A;  3VWW A;  2JZR A;  4GRF A;  2OAD A;  2LNS A;  1NHO A;  2MBT A;  4FIW A;  1DUG A;  1K3O A;  2P5R A;  1T8E B;  4TKY A;  2LQO A;  2H75 A;  4AF2 A;  2ES7 A;  2H6X A;  2GZY A;  2AUV A;  4YAP A;  4OCF A;  2HLS A;  3TKS A;  2B3S A;  2IMK A;  1XCC A;  1YF1 A;  3GUR A;  1BQ7 A;  3M8N A;  2IN3 A;  2F8F A;  1EV9 A;  3GH9 A;  5DDL A;  2HSH A;  1SD9 A;  1LBK A;  5EL8 A;  1EOG A;  2C3Q A;  4ULX A;  3H79 A;  1QK8 A;  2B5Y A;  4OO5 A;  4G9H A;  5J3R A;  2DC5 A;  2F9S A;  5JWO B;  4OFN A;  5A5K A;  2H30 A;  3DKS A;  1NSW A;  2DIY A;  3L4N A;  1ZMA A;  3VI5 A;  4CHS A;  2K6V A;  3BBY A;  2TRX A;  2KHP A;  3R2Q A;  2H72 A;  5HFI A;  4LMW A;  2IMI A;  2H6Y A;  2CZ2 A;  2HSY A;  1U87 A;  2XHF A;  3DYR A;  1O6J A;  1AUC A;  3D21 A;  3D6I A;  4EC0 A;  2OKA A;  2CVK A;  1EGR A;  4TXO B;  1GNW A;  1OC9 A;  3Q74 A;  1T00 A;  2V1M A;  1THO A;  1ML6 A;  2GQK A;  4OFT A;  1XOA A;  5DCG A;  1J9B A;  3JCM L;  3L78 A;  4HQZ A;  1X9S B;  4TRX A;  6GSV A;  3CSI A;  1DSB A;  2IJY A;  3TKP A;  1A0R P;  3GFK A;  1JLV A;  3ZL5 A;  1TRS A;  5ECI B;  2IFQ A;  3KM6 A;  3CRU A;  5G1K A;  4Q5N A;  3FY7 A;  3IR4 A;  7GSS A;  1TU7 A;  5ECK B;  1ERV A;  1EGO A;  8GSS A;  5DCH A;  5L71 A;  4J2F A;  5IMD A;  3APS A;  4IHU A;  1XW9 A;  3FR3 A;  4HJM A;  5IM9 A;  3J7Y k;  5ECQ B;  1X5C A;  18GS A;  3MNG A;  4CDO A;  2XC2 A;  4KE3 A;  4TR0 A;  4N0Z A;  1A8Y A;  1B4P A;  3TRP A;  1HNB A;  4JBB A;  4K0N A;  1G0T A;  2PVQ A;  2B1L A;  2B7J A;  2LS5 A;  1SL1 B;  4BWS A;  4J57 E;  2PMT A;  4PQ1 A;  3EIN A;  1M9A A;  4ECJ A;  3W6G A;  2IPA A;  3NOF A;  3P2A A;  4EE0 A;  3KH9 A;  5JCW A;  5F05 A;  1F37 A;  4BVX A;  2IME A;  5F8B A;  4YQM A;  1OC3 A;  1Z7P A;  1BJX A;  1O73 A;  11GS A;  4TR1 A;  1G7E A;  1JLW A;  1RW1 A;  3LJR A;  2LJR A;  3UVT A;  1VF1 A;  1A2J A;  3TKS C;  1HQO A;  4NWY A;  3GKK A;  4WKW A;  4MF6 A;  5F06 A;  3KGK A;  2I4A A;  3KJY A;  2PBJ A;  4ECI A;  1K0M A;  5GSS A;  4IJ3 A;  4MP4 A;  2M72 A;  4GST A;  1T4Y A;  2MMA A;  4DSR A;  3F8U A;  1ZL9 A;  2H1B A;  2OE3 A;  4NHW A;  1RQM A;  3GA4 A;  1J0F A;  3TJG A;  2TRC P;  3UOM A;  2K9F A;  2KLX A;  3LOR A;  5ELG A;  3PR8 A;  3CRT A;  3QPM A;  2I9H A;  2RM5 A;  2I3Y A;  1OAZ A;  1EEJ A;  1B9Y C;  1QFN A;  4HU7 A;  4IP6 A;  2L5L A;  2G0F A;  3C71 A;  1YDK A;  2YWO A;  3BCK A;  3ZML A;  2OE0 A;  1T7P B;  2IIY A;  5DJL A;  2RUE A;  3KP9 A;  2WUL A;  5CRW A;  2H0H A;  2JL4 A;  2C0G A;  3IV4 A;  3WGE A;  2VM1 A;  2C3N A;  3RAZ A;  5G1L A;  4G10 A;  3EMP A;  3QFB C;  1HD2 A;  3FYG A;  1ZYQ B;  2F8A A;  1JZR A;  1IYI A;  1J08 A;  5IO0 A;  3IK9 A;  2H70 A;  2GT5 A;  1K0O A;  1U6T A;  3Q6O A;  2GZP A;  19GS A;  4X43 A;  1SYX A;  1TTZ A;  4YQU A;  1GSE A;  1QGV A;  4IW9 A;  3C1S A;  1MD3 A;  4HU9 A;  5C00 A;  5KN0 A;  1WMJ A;  2DLX A;  2YZU A;  4RQR A;  2FWE A;  4GSN A;  2XBQ A;  4L0W A;  4WBR D;  1VF3 A;  3IE3 A;  2GQL A;  2X8H A;  4MJA A;  1YF0 A;  5D9V A;  3FEU A;  2L59 A;  4J56 E;  4XRA A;  2MMN A;  2DIZ A;  4AJ7 A;  4FYB A;  4MMM A;  4BL7 A;  2X8C A;  5H5Q A;  1PA3 A;  2HZE B;  4IP1 A;  22GS A;  2AV4 A;  2YN1 A;  2ALB A;  1H4O A;  2YZH A;  3OR5 A;  2C0F A;  1GH2 A;  2E2M A;  5ELA A;  1Q4J A;  5CYY A;  3GV1 A;  2OE1 A;  2XPE A;  1F3A A;  4PXO A;  1S3D A;  3RBT A;  2GQM A;  1ZCP A;  2H66 A;  3LYP A;  4PQH A;  2YV7 A;  4JR4 A;  1GNE A;  1SKS B;  5IIZ A;  2VLU A;  1XFL A;  3DRN A;  5DAL A;  3C1R A;  3PGT A;  3I9V 2;  1GSU A;  3L9S A;  2V6K A;  1GSY A;  3LQ7 A;  5ECL B;  4MPG A;  1V9W A;  2L4C A;  4FO5 A;  3QOU A;  4ZB9 A;  1N8J A;  2JZS A;  1GSD A;  5D9W A;  2HNL A;  1DE2 A;  1T3B A;  2CX4 A;  4L0U A;  5KN2 A;  1F3B A;  2WRT A;  2BJX A;  4TXV A;  1Z7R A;  4L5L A;  4IQA A;  1N2A A;  3VPT A;  1WRY A;  4F03 A;  4KDU A;  2J9H A;  2OBI A;  4XRD A;  3MWH A;  3D4T A;  2X8G A;  2YWN A;  3GIX A;  2V2G A;  2B6M A;  3F4T A;  1TK0 B;  4TR3 A;  5CO3 A;  3TOU A;  2LNT A;  5CAX A;  4RI7 A;  3CBU A;  3ZVJ D;  5B6M A;  5B7C A;  4ZL7 A;  4EL1 A;  3KD0 A;  3QFA C;  2DJ2 A;  2N5A A;  4IVF A;  4PX1 A;  3TCO A;  1MEK A;  3HXS A;  4XCS A;  1PGT A;  3RHB A;  3F9U A;  1W89 A;  4POB A;  1XWB A;  1MD4 A;  3KMN A;  3ZIT A;  1JZO A;  3GH6 A;  3J7Y b;  1AQV A;  4OFM A;  5ID2 A;  1M9B A;  2WB9 A;  3D5J A;  4KDX A;  5DAK B;  4POK A;  2DMM A;  1O81 A;  1M7T A;  4AJ6 A;  2WS2 A;  1MDJ A;  3L0H A;  3ZFB A;  4O5R A;  4FYC A;  1EEM A;  2O87 A;  3IBH A;  2O85 A;  1THX A;  1G6Y A;  1M2B A;  1O8W A;  3TJF A;  2GS3 A;  3QDN A;  3VPQ A;  3WT1 A;  4RI6 A;  4ECB A;  4IN0 A;  2GSQ A;  3GUS A;  2LUS A;  1PL2 A;  1W4V A;  1E2Y A;  5HR2 A;  2YOI A;  1WWJ A;  4Q5F A;  4L5O A;  2AJQ B;  1R4W A;  4EDZ A;  1JZW A;  5INY A;  14GS A;  1V2A A;  4QQ7 A;  3C8E A;  3F3R A;  3A5W A;  2H1A A;  1A24 A;  4IQ1 A;  12GS A;  3GX8 A;  2OA7 A;  3HYP A;  2NBS A;  1XW6 A;  2MMZ A;  5E59 A;  3LFL A;  3F4R A;  3BJ5 A;  3QAV A;  4V1A p;  1SK0 A;  2LRC A;  2LTK A;  3IC4 A;  2YV9 A;  1R5P A;  1KBN A;  3A2W A;  3G7J A;  4XIH A;  5ECN B;  2C0E A;  2WCI A;  3US3 A;  3UBL A;  4TN8 A;  2H71 A;  4D73 A;  1PRX A;  1M0U A;  1CQG A;  4MF5 A;  1XWC A;  2NVL A;  3ISO A;  1LU4 A;  1Q98 A;  2L5O A;  5DVB A;  3ZMK A;  4RUV A;  4MZW A;  5CRD A;  5HFK A;  1ZOF A;  3H4K A;  3GMF A;  3ZYW A;  1T1V A;  4GXZ A;  3VK9 A;  1FAA A;  4DSQ A;  2FNO A;  2PN8 A;  3KCM A;  2DJK A;  2CX3 A;  4DSS A;  4YH2 A;  3EVI A;  3AY8 A;  1GP1 A;  2GLR A;  2K8V A;  3IDV A;  2PU9 C;  4IS0 A;  1B8X A;  1IYH A;  2KUC A;  1U3A A;  4TOP A;  2PPT A;  1DE1 A;  2KOK A;  1QMV A;  2C8U A;  2VCZ A;  5E4W A;  3LGC A;  3LEF A;  4RQX A;  1LJR A;  5IQY A;  5GST A;  1YKC A;  1O85 A;  2FA4 A;  2H01 A;  1GSF A;  1OC8 A;  1Y25 A;  4ML6 A;  4HUA A;  4DEJ A;  1KNG A;  2FWF A;  2K8S A;  4POL A;  1ACV A;  4WF5 A;  3EE2 A;  3G7I A;  2FGX A;  4NAX A;  2QSI A;  1T4Z A;  6GSY A;  2CAI A;  2PVO C;  2AAW A;  5JCG A;  3APQ A;  4KSO A;  5CNW A;  1F6M C;  4OD7 A;  3TB2 A;  2MZC A;  1PX7 A;  4GQF A;  2A4V A;  4K0G A;  4HI7 A;  1ERU A;  3HZ4 A;  2CVD A;  2FCH A;  5JWQ B;  3SBC A;  5J9C A;  1SYR A;  4K8M A;  3HVS A;  1GUL A;  5GZZ B;  3IHQ A;  4I6X A;  3HCZ A;  5D8I A;  5H5R A;  3FR9 A;  2LQQ A;  2GVP A;  2J23 A;  2H1D A;  4MZB A;  3QMX A;  1A8L A;  2LJA A;  1URM A;  3FZ9 A;  1FG4 A;  3D0Z A;  3BCI A;  3G7Y A;  1GLP A;  4PQI A;  2IMD A;  5HQP A;  1PSQ A;  4QL7 A;  2YJ7 A;  4G2E A;  1PN9 A;  3GST A;  1E6B A;  1TW9 A;  2FWH A;  4ZBB A;  4F0B A;  1S3C A;  5CP1 A;  4KUN A;  3DVX A;  2PUK C;  1YKA A;  4ZXG A;  2VL9 A;  3KMO A;  5AIX A;  3VFI A;  3DVW A;  2LKU A;  3H1N A;  2GGT A;  3FK8 A;  4MA9 A;  2K18 A;  4ID0 A;  1WOU A;  3IAM 2;  4WET A; 
#chains in the Genus database with same CATH topology
 17GS A;  4I97 A;  5FT3 A;  3A2X A;  3EYT A;  3I9V 1;  4EUY A;  3KEB A;  2NDO A;  2CZ3 A;  3ZIV A;  3C73 A;  1AQX A;  5LD0 A;  2VIM A;  1UN2 A;  1GSQ A;  1M2D A;  5G5F A;  4OMV A;  2E2G A;  4XS1 A;  1AIU A;  5AN1 A;  4TXO A;  2VAF A;  5IPH A;  2FHE A;  1V40 A;  3QCP A;  2AHE A;  1TRW A;  3IRA A;  4MH2 A;  1TRV A;  5JWR B;  1FVJ A;  2VCX A;  3ZRD A;  1H75 A;  3FHK A;  2PGT A;  2V1C C;  1ILO A;  3N5O A;  3BOA A;  1K0B A;  2G2Q A;  1YEP A;  2L6C A;  2KKM A;  2KP2 A;  5IOX A;  4NHZ A;  3VA9 A;  4KCE A;  1SL2 B;  3ERF A;  3W8J A;  5B6N A;  4ILF A;  3AJF A;  1TOF A;  4NMU A;  5KN3 A;  2VD0 A;  4JR6 A;  2JU5 A;  3APO A;  3BD2 A;  1VF2 A;  3M1G A;  1K3Y A;  1YZX A;  4Z7G A;  3I6A A;  3KP8 A;  4GTU A;  5B8B A;  3CMI A;  1K3L A;  1TKD B;  1XVQ A;  5J4U A;  1G6W A;  1Z3E A;  2VCV A;  3TJB A;  2V32 A;  1TI1 A;  3R3E A;  1XWG A;  5D73 A;  2GSS A;  2V41 A;  1XW5 A;  2VCT A;  3F6D A;  3GKM A;  3L9V A;  4O1P A;  5AGY A;  1PKZ A;  1SKW B;  3SWL A;  3HVN A;  4KAE A;  3L9U A;  3Q18 A;  1I9D A;  4XS4 B;  1EP8 A;  1VGL A;  3KZQ A;  4GSS A;  1OYJ A;  2YP6 A;  3FVV A;  4K1F A;  3DO9 A;  3EMX A;  4V2N A;  1GL8 A;  1EWX A;  2P31 A;  4L8E A;  1ZYP A;  1AXD A;  3O6T A;  2MBS A;  1VF4 A;  3M3M A;  3D22 A;  4LL4 B;  2M46 A;  3UVH A;  2VL2 C;  3GKX A;  3K8N A;  1S3A A;  1NM3 A;  4WEY A;  3EUR A;  4HDE A;  2GTU A;  2VCW A;  3MDK A;  3LG6 A;  2CV4 A;  3ERW A;  2D2Z A;  1DBY A;  3PIN A;  4G0K A;  4O7H A;  3ME8 A;  3E9J B;  3GTU B;  1GWC A;  4ZBD A;  1XBS A;  2GST A;  3TJJ A;  1MTC A;  1KEB A;  1B4Q A;  2A2C A;  1QQ2 A;  3VI7 A;  4TR4 A;  3LXZ A;  3FR6 A;  5DBQ A;  3FZ5 A;  2VD1 A;  1GUM A;  2H19 A;  3DGQ A;  5ECS A;  1WIK A;  4N0V A;  2JSZ A;  1W3S A;  2RAD A;  3D4M A;  3TUE A;  3GHA A;  1MDK A;  1R5A A;  2KP1 A;  4P3Y B;  1QUW A;  4BA7 A;  2XPD A;  3VWX A;  2X99 A;  3O76 A;  5J41 A;  2X64 A;  5A4W A;  3S9F A;  4Z7X A;  5EPF A;  10GS A;  1FO5 A;  2LEG A;  4K7N A;  3DD3 A;  1X5E A;  3IXR A;  2OJL A;  2C0D A;  2EIO A;  3EU4 A;  3ZFL A;  1G7O A;  3IK7 A;  3O3T A;  2H1G A;  2VOC A;  2RUF A;  2DJ0 A;  4CY6 A;  4K5S A;  3A3T A;  4NPB A;  2C80 A;  4MJE A;  2NPB A;  4XTS A;  2F51 A;  2FY6 A;  3CQF A;  2JAE A;  5EY6 A;  3CTF A;  5J5N A;  4LA1 A;  2CA8 A;  5HR0 A;  2JZT A;  5G31 A;  1UC7 A;  3DA4 A;  3UIW A;  4I8B A;  2HGK A;  1U88 A;  4ISD A;  1XZO A;  1C72 A;  3ZVJ A;  5GAP D;  1PQN A;  4GF0 A;  1X9W B;  1X5D A;  2XTR A;  1OKT A;  4BVY A;  4YQV A;  3DIE A;  6GSS A;  1A0F A;  4IJI A;  5ECM B;  4MF7 A;  3NIV A;  3GNJ A;  5ABR A;  4MLY A;  1ST9 A;  2HRN A;  4BWQ A;  1XIY A;  2E7P A;  2FD3 A;  4EXJ A;  2HI7 A;  4CW9 A;  2FA8 A;  2IWT A;  4PUA A;  5AIS A;  4HZ2 A;  2P22 B;  3HHV A;  2WDU A;  1M99 A;  3CTG A;  3E0U A;  4IKH A;  3U6V A;  3GKN A;  4I2T A;  3VWU A;  1U3I A;  1I5G A;  3UBK A;  4OO4 A;  4Q9V A;  3M9K A;  1XPV A;  4H86 A;  4YKG A;  1PX6 A;  4KW6 A;  5F07 A;  2JAD A;  2MYG A;  2B5X A;  2V6E A;  1OC9 B;  4G19 A;  4PNF A;  4F82 A;  2BL7 A;  4V1A g;  4NV2 A;  4PUF C;  4K7I A;  3ZZX A;  4YAV A;  1SEN A;  2R0C A;  3CXG A;  4TVE A;  2E0Q A;  2QGM A;  3HY2 A;  3GL3 A;  1GTU A;  5C04 A;  4CY8 A;  3LXT A;  3QAW A;  2HZE A;  1OE8 A;  3KXO A;  3H8Q A;  2O8V B;  4EDY A;  4HZ4 A;  3HJM A;  2IFQ B;  4ZIL A;  4JZQ A;  2QSB A;  5ECP B;  2M80 A;  3UMA A;  4EKZ A;  4MCU A;  2B5E A;  4KDY A;  1GRX A;  2BTO T;  4KF9 A;  2GT6 A;  4PNG A;  2FWG A;  1GUH A;  4IEL A;  2A2R A;  2V6O A;  2QGV A;  1XWA A;  1BYE A;  2LST A;  3EWL A;  3F3Q A;  4HOJ A;  1OKD A;  1BAY A;  3TDG A;  2EIR A;  2IP6 A;  3DWV A;  3HD5 A;  1SJI A;  1K0N A;  1Z6M A;  5IMC A;  2N5F A;  2VLV A;  1Z9H A;  4KB3 A;  6GSW A;  2H74 A;  5EVO A;  2PWJ A;  2RII A;  4EF0 A;  5CRE A;  2YNX A;  6GST A;  4TW5 A;  2PER A;  1M2A A;  1B9X C;  3G9B A;  1V57 A;  2H73 A;  3VLN A;  1X0R A;  5FHI A;  1GUK A;  1XOB A;  2YJH A;  3FZA A;  4WR4 A;  3LSZ A;  1A23 A;  3EPT A;  4F9Z A;  3L0I A;  4BVX B;  20GS A;  2RLI A;  1ZYE A;  16GS A;  2R6K A;  5D9T A;  4I5Q A;  4TR1 B;  2O89 A;  5ENU A;  2OAC A;  5D93 A;  2REM A;  3C7M A;  2HZF A;  3CYN A;  1SKR B;  1GSS A;  5IMA A;  4KCA A;  1ABA A;  4MH3 A;  4E8H A;  2R4V A;  4ZL9 A;  2L6D A;  3RPP A;  1F2E A;  3TKS E;  3QD9 A;  2H6Z A;  3IC8 A;  2ZUP A;  5HFG A;  5IMZ A;  3EC3 A;  3ZIJ A;  4GCI A;  5IOW A;  1EP7 A;  4HJ2 A;  3RHC A;  1V58 A;  4OAV B;  5DJM A;  2JAC A;  4Q5Q A;  4OWY A;  4MDC A;  3ZLP A;  4GXT A;  3P90 A;  1TRU A;  3LJ1 A;  1YQ1 A;  3DXB A;  1WE0 A;  1KTE A;  4WR5 A;  4AJ8 A;  5DAK A;  4XHM A;  5HR1 A;  2BMX A;  1R7H A;  1SL0 B;  3WYW A;  1BED A;  1HNC A;  2WFC A;  1FVK A;  1PL1 A;  1TI3 A;  1A2L A;  2VM2 A;  2ZCT A;  5H5S A;  4F2I A;  3MAK A;  3EU3 A;  3IOS A;  1XVW A;  1TJD A;  4FYU A;  2C1Y A;  5GAN D;  1ERW A;  1USB A;  4K9Z A;  4HS1 A;  4PUR A;  1K0D A;  2VL2 A;  5G30 A;  2VL3 A;  3P8W A;  4WF4 A;  4Q5R A;  2EC4 A;  1JFU A;  3FZ4 A;  2DBC A;  3IAS 2;  1XWK A;  4MAB A;  5KN1 A;  2ZNM A;  4ZIJ A;  5ECO B;  4X1U A;  1SU9 A;  3WD6 A;  1V98 A;  3M9J A;  1QXH A;  4MZC A;  3H93 A;  5DQS A;  4AS3 A;  2O7K A;  2L57 A;  4JRR A;  3FRC A;  2IMF A;  1CQH A;  1PD2 1;  3A2V A;  4ECC A;  1WJK A;  1HYU A;  2VO4 A;  1ZGN A;  2H8L A;  2DJJ A;  4V2M A;  4NV5 A;  1SJ6 A;  3Q19 A;  2VCQ A;  3RPN A;  1WPI A;  4Z2U A;  2R3X A;  2HRF A;  1ZZY A;  2YFA A;  2GSC A;  5ECH B;  2CVB A;  2YPM A;  4AGS A;  4KSM A;  1YEX A;  2B7K A;  4K7O A;  1GTI A;  4EO3 A;  4IGJ A;  2H0G A;  1FW1 A;  3TGZ A;  3GRX A;  3VWV A;  3I69 A;  5LNK e;  1A2M A;  3DA3 A;  1FOV A;  4ACS A;  2ZRR A;  3HVX A;  2R5G A;  4BL7 B;  3LJ2 A;  3UAR A;  5IO2 A;  1GTB A;  3QR6 A;  2YCD A;  2I1U A;  4O5U A;  3ZTL A;  4ZB8 A;  3GL5 A;  3M0F A;  2XTQ A;  6GSU A;  4PL4 A;  1AC1 A;  3P7X A;  2QKE A;  2GZZ A;  2VUP A;  2QC7 A;  2HXK A;  2I81 A;  2A2S A;  2LV3 A;  5D96 A;  1GTA A;  2ON7 A;  4JU5 A;  1B48 A;  2EIQ A;  5ECR B;  1SJ8 A;  2GDR A;  2YWM A;  4JED A;  2QA1 A;  1GLQ A;  3F4M A;  1PKW A;  5A4U A;  2L1L B;  5IPG A;  3KTB A;  2FUG 2;  2DML A;  4Z2T A;  1TXX A;  1JZD A;  4BPY A;  4XS6 A;  4WXT A;  4LLR A;  2CT6 A;  1JQO A;  4N30 A;  5DAL B;  3FKF A;  5G2Z A;  2AB6 A;  5JCU A;  13GS A;  3HJO A;  2WJU A;  4FH8 A;  3DML A;  3QAG A;  4DVC A;  4HEA 2;  2DJ3 A;  3HA9 A;  3WT2 A;  1AQW A;  4MK3 A;  3TKQ A;  1Z6N A;  3UJ1 A;  3KTL A;  3WGD A;  1K0C A;  3FW2 A;  1UA5 A;  3GN3 A;  1NHY A;  2N5B A;  3HVV A;  4PGT A;  1YJ6 A;  4JCV E;  1JHB A;  3W8S A;  2ETD A;  2P0G A;  3LW9 A;  2YWI A;  3KH7 A;  2OBK A;  3MIX A;  1OE7 A;  2JB1 A;  1SK1 A;  2FLS A;  3GX0 A;  2YAN A;  1TDI A;  4E8E A;  3TKR A;  3UEM A;  5IMF A;  4KX4 A;  3RDW A;  1MDI A;  3CSJ A;  3I43 A;  1ON4 A;  2DJ1 A;  1O7U A;  1TU8 A;  1HNA A;  3LWA A;  4N10 A;  3KIJ A;  1FB0 A;  4ML1 A;  2ON5 A;  5G5E A;  3ED3 A;  1SJZ A;  4GLT A;  5IMV A;  1PN0 A;  3F4S A;  2LRT A;  3MSZ A;  2AYT A;  2R37 A;  1SD8 A;  1FHE A;  4EIQ A;  5BRT A;  1ERT A;  4GQC A;  3TRQ A;  5D9X A;  4ZL8 A;  4OCE A;  5ID2 B;  1EV4 A;  1TK5 B;  4QL9 A;  1Z5Y E;  1EZK A;  2LRN A;  6GSX A;  2CAQ A;  1RK4 A;  1EOH A;  3U5R E;  4X0X A;  1O8X A;  3V1W A;  1AAZ A;  1K0A A;  3TOT A;  2FEF A;  2X4A A;  1AW9 A;  3WGX A;  4PL3 A;  4K2D A;  4JE1 A;  2L4Q A;  4MJB A;  3PPU A;  4LMV A;  5COH A;  2WZ9 A;  2H0I A;  4V2L A;  9GSS A;  3F6F A;  3N9J A;  3ME7 A;  1TP9 A;  4I2U A;  4EVM A;  5B8A A;  5CRG A;  4F0C A;  4IBP A;  3TRX A;  5J9B A;  2DSA A;  3HDC A;  5AIV A;  4KA0 A;  3ZRE A;  4K5R A;  1XXU A;  2R0P A;  1Y6E A;  2HE3 A;  3DEX A;  1F9M A;  2Z9S A;  1BG5 A;  2TIR A;  2IL3 A;  4MJC A;  1VRS D;  2DKI A;  3CSH A;  2XBI A;  2WGR A;  4O92 A;  2C4J A;  4O5Q A;  4ZB6 A;  2JB2 A;  2H76 A;  4D73 B;  3UL3 A;  2P5Q A;  2NTO A;  2F3M A;  1UVZ A;  4Z7H A;  3JSB A;  3HZ8 A;  2HYX A;  3LYK A;  2GSR A;  4XS4 A;  2HT9 A;  5DQY A;  2QA2 A;  1TK8 B;  1PMT A;  1R26 A;  1NW2 A;  3F63 A;  3ERG A;  5A4V A;  4KH7 A;  4NXI A;  1SK2 A;  4DSS B;  3UIT A;  1YY7 A;  5FWG A;  4KND A;  4K6X A;  4O32 A;  3TJK A;  4Z2R A;  4YZC A;  3GYK A;  3PH9 A;  1BX9 A;  2F6M B;  4HQS A;  1M3J A;  2MMO A;  3HKR A;  4ZBA A;  2BL8 A;  4MPF A;  5LCZ A;  4N11 A;  2RM6 A;  3GTU A;  2B1K A;  2JSY A;  3IA1 A;  2HFD A;  3FMW A;  3HJP A;  3F0I A;  2R2J A;  5KEJ A;  2VLT A;  2C3T A;  1WP0 A;  4GWR A;  2CQ9 A;  1OVN A;  4KGI A;  3NZN A;  3IPZ A;  2LJK A;  4FQU A;  3E3E A;  1X9M B;  4WBJ A;  5CRH A;  1FB6 A;  5HR3 A;  3UAP A;  3VUR A;  5F0G A;  4LL1 B;  4POM A;  2RLD A;  3GSS A;  3VWW A;  2JZR A;  4G0L A;  3P23 A;  4GRF A;  2OAD A;  3IAM 1;  2LNS A;  1NHO A;  2MBT A;  4FIW A;  1DUG A;  2UZ8 A;  1K3O A;  2P5R A;  1T8E B;  4TKY A;  4DWL A;  2LQO A;  2H75 A;  4AF2 A;  2ES7 A;  2H6X A;  2GZY A;  2AUV A;  2XMX A;  4YAP A;  4OCF A;  2HLS A;  3TKS A;  2B3S A;  2IMK A;  1XCC A;  1YF1 A;  3GUR A;  1BQ7 A;  3M8N A;  2IN3 A;  2F8F A;  1EV9 A;  3GH9 A;  5DDL A;  2HSH A;  1SD9 A;  1LBK A;  5EL8 A;  1EOG A;  2C3Q A;  4ULX A;  3H79 A;  1QK8 A;  2B5Y A;  4OO5 A;  4G9H A;  5J3R A;  4USS A;  2DC5 A;  2F9S A;  5JWO B;  2FUG 1;  4OFN A;  5A5K A;  2H30 A;  3DKS A;  1NSW A;  2DIY A;  3L4N A;  1ZMA A;  3VI5 A;  4CHS A;  2K6V A;  3BBY A;  2DKH A;  2TRX A;  4G75 A;  2KHP A;  3R2Q A;  4K2X A;  2H72 A;  5HFI A;  4LMW A;  2IMI A;  2H6Y A;  2CZ2 A;  2HSY A;  1U87 A;  2XHF A;  3DYR A;  1O6J A;  1AUC A;  3D21 A;  3D6I A;  4HSC X;  4EC0 A;  2OKA A;  4HEA 1;  2CVK A;  1EGR A;  4TXO B;  1GNW A;  1OC9 A;  2HSM A;  3Q74 A;  5KOX A;  1T00 A;  2V1M A;  1THO A;  1ML6 A;  2GQK A;  4OFT A;  1XOA A;  5DCG A;  1J9B A;  1S3R A;  3JCM L;  3L78 A;  4HQZ A;  1X9S B;  4TRX A;  6GSV A;  3CSI A;  2F66 B;  1DSB A;  2IJY A;  3TKP A;  1A0R P;  3GFK A;  1JLV A;  3ZL5 A;  1TRS A;  5ECI B;  2IFQ A;  3KM6 A;  3CRU A;  4PTS A;  5G1K A;  4Q5N A;  3FY7 A;  3IR4 A;  7GSS A;  1TU7 A;  5ECK B;  1ERV A;  1EGO A;  8GSS A;  5DCH A;  5L71 A;  4J2F A;  5IMD A;  3APS A;  4IHU A;  1XW9 A;  3FR3 A;  4X4J A;  4HJM A;  5IM9 A;  3J7Y k;  5ECQ B;  1X5C A;  18GS A;  3MNG A;  4CDO A;  2XC2 A;  4KE3 A;  4TR0 A;  4N0Z A;  1A8Y A;  1B4P A;  3TRP A;  1HNB A;  4JBB A;  4K0N A;  1G0T A;  2PVQ A;  2B1L A;  2B7J A;  2LS5 A;  1SL1 B;  4BWS A;  4J57 E;  2PMT A;  4PQ1 A;  3EIN A;  1M9A A;  4ECJ A;  3W6G A;  2IPA A;  3NOF A;  3P2A A;  4EE0 A;  3KH9 A;  5JCW A;  5KOW A;  2QZG A;  5F05 A;  1F37 A;  4BVX A;  2IME A;  5F8B A;  4YQM A;  1OC3 A;  1Z7P A;  1BJX A;  1O73 A;  11GS A;  4TR1 A;  1G7E A;  1JLW A;  4O1O A;  4HFV A;  1RW1 A;  3LJR A;  2LJR A;  3UVT A;  1VF1 A;  1A2J A;  2E8G A;  3TKS C;  1TDP A;  1HQO A;  4NWY A;  3GKK A;  4WKW A;  4MF6 A;  5F06 A;  1M3I A;  3KGK A;  2I4A A;  3KJY A;  2PBJ A;  4ECI A;  1K0M A;  5GSS A;  4IJ3 A;  4MP4 A;  2M72 A;  4GST A;  1T4Y A;  2MMA A;  4DSR A;  3F8U A;  1ZL9 A;  2H1B A;  2OE3 A;  4NHW A;  1RQM A;  3GA4 A;  1J0F A;  3TJG A;  2TRC P;  3UOM A;  2K9F A;  2KLX A;  3LOR A;  5ELG A;  3PR8 A;  3CRT A;  2K19 A;  2I9H A;  3QPM A;  2RM5 A;  2I3Y A;  1OAZ A;  1EEJ A;  1B9Y C;  1QFN A;  4HU7 A;  4IP6 A;  2L5L A;  2G0F A;  4YZ9 A;  4A5P A;  3C71 A;  1YDK A;  2ZW3 A;  2YWO A;  2MJF B;  4AS2 A;  2JBW A;  3BCK A;  3ZML A;  3FBV A;  2OE0 A;  1T7P B;  2YFB A;  2IIY A;  5DJL A;  2RUE A;  2A4H A;  3KP9 A;  2WUL A;  5CRW A;  2H0H A;  2JL4 A;  2C0G A;  3IV4 A;  3WGE A;  2VM1 A;  2C3N A;  3RAZ A;  5G1L A;  4G10 A;  3EMP A;  3QFB C;  1HD2 A;  3FYG A;  1ZYQ B;  2F8A A;  1JZR A;  1IYI A;  1J08 A;  4BVY B;  5IO0 A;  3IK9 A;  2H70 A;  2GT5 A;  1K0O A;  1U6T A;  3Q6O A;  2GZP A;  19GS A;  4X43 A;  1SYX A;  1TTZ A;  4YQU A;  1GSE A;  1QGV A;  1PFO A;  4IW9 A;  3C1S A;  1MD3 A;  4HU9 A;  5C00 A;  5KN0 A;  1WMJ A;  2DLX A;  2YZU A;  4RQR A;  2FWE A;  4GSN A;  2XBQ A;  4L0W A;  4WBR D;  1VF3 A;  3IE3 A;  2GQL A;  2X8H A;  4MJA A;  1YF0 A;  5D9V A;  3FEU A;  2L59 A;  4J56 E;  3Q8D A;  4XRA A;  2MMN A;  2DIZ A;  4AJ7 A;  4FYB A;  4MMM A;  4BL7 A;  2X8C A;  5H5Q A;  1PA3 A;  2HZE B;  4IP1 A;  22GS A;  2AV4 A;  2YN1 A;  2ALB A;  2JB3 A;  1H4O A;  2YZH A;  3OR5 A;  2C0F A;  1GH2 A;  2E2M A;  5ELA A;  1Q4J A;  5CYY A;  3GV1 A;  2OE1 A;  5LNK 1;  2XPE A;  1F3A A;  4PXO A;  1S3D A;  3RBT A;  2GQM A;  1ZCP A;  2H66 A;  3LYP A;  4PQH A;  2YV7 A;  4JR4 A;  1GNE A;  1SKS B;  5IIZ A;  2VLU A;  1XFL A;  3DRN A;  5DAL A;  3C1R A;  3PGT A;  3I9V 2;  1GSU A;  3L9S A;  2V6K A;  1GSY A;  5BMU A;  3LQ7 A;  5ECL B;  4MPG A;  3MYD A;  1V9W A;  2L4C A;  4FO5 A;  3QOU A;  4ZB9 A;  1N8J A;  2JZS A;  1GSD A;  5D9W A;  2HNL A;  1DE2 A;  1T3B A;  2CX4 A;  4L0U A;  5KN2 A;  1F3B A;  2WRT A;  2BJX A;  4TXV A;  1Z7R A;  2HRK A;  4L5L A;  4IQA A;  1N2A A;  3VPT A;  1WRY A;  4ICY A;  3IHG A;  4F03 A;  4KDU A;  2J9H A;  2OBI A;  4XRD A;  3MWH A;  4OAU C;  2X8G A;  3D4T A;  2YWN A;  3GIX A;  2V2G A;  2B6M A;  3F4T A;  1TK0 B;  4TR3 A;  5CO3 A;  3TOU A;  2LNT A;  5CAX A;  4RI7 A;  3LJ0 A;  3CBU A;  3ZVJ D;  4PL5 A;  3IAS 1;  5B6M A;  5B7C A;  3A5I A;  4ZL7 A;  4EL1 A;  3KD0 A;  3QFA C;  2DJ2 A;  2N5A A;  4IVF A;  4PX1 A;  3TCO A;  1MEK A;  3HXS A;  4XCS A;  1PGT A;  3RHB A;  3F9U A;  1W89 A;  4POB A;  1XWB A;  1MD4 A;  3KMN A;  3ZIT A;  1JZO A;  3GH6 A;  3J7Y b;  1AQV A;  4OFM A;  5ID2 A;  1M9B A;  2WB9 A;  3D5J A;  4KDX A;  5DAK B;  4POK A;  2DMM A;  1O81 A;  1M7T A;  1YO7 A;  4AJ6 A;  2WS2 A;  1MDJ A;  3L0H A;  3ZFB A;  4O5R A;  4FYC A;  1EEM A;  2O87 A;  3IBH A;  4BIK A;  2O85 A;  1THX A;  1G6Y A;  1M2B A;  1O8W A;  3TJF A;  2GS3 A;  3QDN A;  3VPQ A;  3WT1 A;  4RI6 A;  4ECB A;  4IN0 A;  2GSQ A;  3GUS A;  2LUS A;  1PL2 A;  1W4V A;  1E2Y A;  5HR2 A;  2YOI A;  1WWJ A;  4Q5F A;  4L5O A;  2AJQ B;  1R4W A;  4EDZ A;  1JZW A;  5INY A;  14GS A;  1V2A A;  4QQ7 A;  3C8E A;  3F3R A;  3A5W A;  2H1A A;  1A24 A;  4IQ1 A;  4U6R A;  12GS A;  3GX8 A;  2OA7 A;  3HYP A;  2NBS A;  1XW6 A;  2MMZ A;  5E59 A;  3LFL A;  3F4R A;  3BJ5 A;  3QAV A;  4V1A p;  1SK0 A;  2X49 A;  4I1T A;  2LRC A;  2LTK A;  3IC4 A;  2YV9 A;  1R5P A;  1KBN A;  3A2W A;  3G7J A;  4XIH A;  4G0I A;  2CAZ B;  2C0E A;  2WCI A;  5ECN B;  3US3 A;  3UBL A;  4TN8 A;  2H71 A;  4D73 A;  1PRX A;  1M0U A;  1CQG A;  4MF5 A;  1XWC A;  2NVL A;  3ISO A;  1LU4 A;  1Q98 A;  2L5O A;  5DVB A;  4MNN A;  3ZMK A;  4RUV A;  4MZW A;  5CRD A;  5HFK A;  1ZOF A;  3H4K A;  3GMF A;  3ZYW A;  1T1V A;  4GXZ A;  3VK9 A;  1FAA A;  4DSQ A;  2FNO A;  2PN8 A;  3KCM A;  2DJK A;  5HGI A;  2RIO A;  2CX3 A;  4DSS A;  4YH2 A;  4G76 A;  3EVI A;  3AY8 A;  1GP1 A;  2GLR A;  2K8V A;  3IDV A;  2PU9 C;  4IS0 A;  1B8X A;  1IYH A;  2KUC A;  1U3A A;  4EIP A;  4TOP A;  2PPT A;  2A2P A;  1DE1 A;  2KOK A;  1QMV A;  2C8U A;  2R0G A;  2VCZ A;  3FNB A;  5E4W A;  3LGC A;  3LEF A;  4RQX A;  1LJR A;  5IQY A;  5GST A;  1YKC A;  1O85 A;  1XG8 A;  2FA4 A;  1U5K A;  2H01 A;  1GSF A;  1OC8 A;  1Y25 A;  4ML6 A;  4HUA A;  4DEJ A;  1KNG A;  2FWF A;  2K8S A;  4POL A;  1ACV A;  4WF5 A;  3EE2 A;  3G7I A;  2FGX A;  4NAX A;  2QSI A;  1T4Z A;  6GSY A;  2CAI A;  2PVO C;  2AAW A;  5JCG A;  3APQ A;  1FOH A;  4KSO A;  5CNW A;  1F6M C;  4OD7 A;  3TB2 A;  2MZC A;  1PX7 A;  4GQF A;  2A4V A;  4K0G A;  4HI7 A;  1ERU A;  3HZ4 A;  2CVD A;  2FCH A;  5JWQ B;  3SBC A;  5J9C A;  1SYR A;  4K8M A;  3HVS A;  1GUL A;  5GZZ B;  3IHQ A;  4I6X A;  2A2D A;  3HCZ A;  5D8I A;  5H5R A;  3FR9 A;  2LQQ A;  2GVP A;  2J23 A;  2H1D A;  4MZB A;  3QMX A;  1ZYN A;  2HRA A;  1A8L A;  2LJA A;  1URM A;  3FZ9 A;  3SDJ A;  4YZD A;  1FG4 A;  3D0Z A;  3BCI A;  3G7Y A;  1GLP A;  4PQI A;  2IMD A;  5HQP A;  1PSQ A;  4QL7 A;  2YJ7 A;  4G2E A;  1PN9 A;  3GST A;  1E6B A;  1TW9 A;  2FWH A;  4ZBB A;  4F0B A;  1S3C A;  4YKF A;  5CP1 A;  4KUN A;  3DVX A;  2PUK C;  1YKA A;  4ZXG A;  2VL9 A;  3KMO A;  5AIX A;  3B55 A;  3VFI A;  3DVW A;  2LKU A;  2FU2 A;  3H1N A;  2GGT A;  3FK8 A;  4MA9 A;  2K18 A;  4ID0 A;  1WOU A;  3IAM 2;  4WET A; 
#chains in the Genus database with same CATH homology
 17GS A;  4I97 A;  5FT3 A;  3A2X A;  3EYT A;  3I9V 1;  4EUY A;  3KEB A;  2NDO A;  2CZ3 A;  3ZIV A;  3C73 A;  1AQX A;  5LD0 A;  2VIM A;  1UN2 A;  1GSQ A;  1M2D A;  5G5F A;  4OMV A;  2E2G A;  4XS1 A;  1AIU A;  5AN1 A;  4TXO A;  2VAF A;  5IPH A;  2FHE A;  1V40 A;  3QCP A;  2AHE A;  1TRW A;  3IRA A;  4MH2 A;  1TRV A;  5JWR B;  1FVJ A;  2VCX A;  3ZRD A;  1H75 A;  3FHK A;  2PGT A;  2V1C C;  1ILO A;  3N5O A;  3BOA A;  1K0B A;  2G2Q A;  1YEP A;  2L6C A;  2KKM A;  2KP2 A;  5IOX A;  4NHZ A;  3VA9 A;  4KCE A;  1SL2 B;  3ERF A;  3W8J A;  5B6N A;  4ILF A;  3AJF A;  1TOF A;  4NMU A;  5KN3 A;  2VD0 A;  4JR6 A;  2JU5 A;  3APO A;  3BD2 A;  1VF2 A;  3M1G A;  1K3Y A;  1YZX A;  4Z7G A;  3I6A A;  3KP8 A;  4GTU A;  5B8B A;  3CMI A;  1K3L A;  1TKD B;  1XVQ A;  5J4U A;  1G6W A;  1Z3E A;  2VCV A;  3TJB A;  2V32 A;  1TI1 A;  3R3E A;  1XWG A;  5D73 A;  2GSS A;  2V41 A;  1XW5 A;  2VCT A;  3F6D A;  3GKM A;  3L9V A;  4O1P A;  5AGY A;  1PKZ A;  1SKW B;  3SWL A;  4KAE A;  3L9U A;  3Q18 A;  1I9D A;  4XS4 B;  1EP8 A;  1VGL A;  3KZQ A;  4GSS A;  1OYJ A;  2YP6 A;  4K1F A;  3DO9 A;  3EMX A;  4V2N A;  1GL8 A;  1EWX A;  2P31 A;  4L8E A;  1ZYP A;  1AXD A;  3O6T A;  2MBS A;  1VF4 A;  3M3M A;  3D22 A;  4LL4 B;  2M46 A;  3UVH A;  2VL2 C;  3GKX A;  3K8N A;  1S3A A;  1NM3 A;  4WEY A;  3EUR A;  4HDE A;  2GTU A;  2VCW A;  3MDK A;  3LG6 A;  2CV4 A;  3ERW A;  2D2Z A;  1DBY A;  3PIN A;  4G0K A;  4O7H A;  3ME8 A;  3E9J B;  3GTU B;  1GWC A;  4ZBD A;  1XBS A;  2GST A;  3TJJ A;  1MTC A;  1KEB A;  1B4Q A;  2A2C A;  1QQ2 A;  3VI7 A;  4TR4 A;  3LXZ A;  3FR6 A;  5DBQ A;  3FZ5 A;  2VD1 A;  1GUM A;  2H19 A;  3DGQ A;  5ECS A;  1WIK A;  4N0V A;  2JSZ A;  1W3S A;  3D4M A;  3TUE A;  3GHA A;  1MDK A;  1R5A A;  2KP1 A;  4P3Y B;  1QUW A;  4BA7 A;  2XPD A;  3VWX A;  2X99 A;  3O76 A;  5J41 A;  2X64 A;  5A4W A;  3S9F A;  4Z7X A;  5EPF A;  10GS A;  1FO5 A;  2LEG A;  4K7N A;  3DD3 A;  1X5E A;  3IXR A;  2OJL A;  2C0D A;  2EIO A;  3EU4 A;  3ZFL A;  1G7O A;  3IK7 A;  3O3T A;  2H1G A;  2VOC A;  2RUF A;  2DJ0 A;  4CY6 A;  4K5S A;  3A3T A;  4NPB A;  2C80 A;  4MJE A;  2NPB A;  4XTS A;  2F51 A;  2FY6 A;  5EY6 A;  2JAE A;  3CTF A;  5J5N A;  4LA1 A;  2CA8 A;  5HR0 A;  2JZT A;  5G31 A;  1UC7 A;  3DA4 A;  3UIW A;  4I8B A;  1U88 A;  4ISD A;  1XZO A;  1C72 A;  3ZVJ A;  5GAP D;  1PQN A;  4GF0 A;  1X9W B;  1X5D A;  2XTR A;  1OKT A;  4BVY A;  4YQV A;  3DIE A;  6GSS A;  1A0F A;  4IJI A;  5ECM B;  4MF7 A;  3NIV A;  3GNJ A;  5ABR A;  4MLY A;  1ST9 A;  2HRN A;  4BWQ A;  1XIY A;  2E7P A;  2FD3 A;  4EXJ A;  2HI7 A;  4CW9 A;  2FA8 A;  2IWT A;  4PUA A;  5AIS A;  4HZ2 A;  2P22 B;  3HHV A;  2WDU A;  1M99 A;  3CTG A;  3E0U A;  4IKH A;  3U6V A;  3GKN A;  4I2T A;  3VWU A;  1U3I A;  1I5G A;  3UBK A;  4OO4 A;  4Q9V A;  3M9K A;  1XPV A;  4H86 A;  4YKG A;  1PX6 A;  4KW6 A;  5F07 A;  2JAD A;  2MYG A;  2B5X A;  2V6E A;  1OC9 B;  4G19 A;  4PNF A;  4F82 A;  4V1A g;  4NV2 A;  4PUF C;  4K7I A;  3ZZX A;  4YAV A;  1SEN A;  2R0C A;  3CXG A;  4TVE A;  2E0Q A;  3HY2 A;  3GL3 A;  1GTU A;  5C04 A;  4CY8 A;  3LXT A;  3QAW A;  2HZE A;  1OE8 A;  3KXO A;  3H8Q A;  2O8V B;  4EDY A;  4HZ4 A;  3HJM A;  2IFQ B;  4ZIL A;  4JZQ A;  5ECP B;  2M80 A;  3UMA A;  4EKZ A;  4MCU A;  2B5E A;  4KDY A;  1GRX A;  2BTO T;  4KF9 A;  2GT6 A;  4PNG A;  2FWG A;  1GUH A;  4IEL A;  2A2R A;  2V6O A;  2QGV A;  1XWA A;  1BYE A;  2LST A;  3EWL A;  3F3Q A;  4HOJ A;  1OKD A;  1BAY A;  3TDG A;  2EIR A;  2IP6 A;  3DWV A;  3HD5 A;  1SJI A;  1K0N A;  1Z6M A;  5IMC A;  2N5F A;  2VLV A;  1Z9H A;  4KB3 A;  6GSW A;  2H74 A;  5EVO A;  2PWJ A;  2RII A;  4EF0 A;  5CRE A;  2YNX A;  6GST A;  4TW5 A;  2PER A;  1M2A A;  1B9X C;  3G9B A;  1V57 A;  2H73 A;  3VLN A;  1X0R A;  5FHI A;  1GUK A;  1XOB A;  2YJH A;  3FZA A;  4WR4 A;  3LSZ A;  1A23 A;  3EPT A;  4F9Z A;  3L0I A;  4BVX B;  20GS A;  2RLI A;  1ZYE A;  16GS A;  2R6K A;  5D9T A;  4I5Q A;  4TR1 B;  2O89 A;  5ENU A;  2OAC A;  5D93 A;  2REM A;  3C7M A;  2HZF A;  3CYN A;  1SKR B;  1GSS A;  5IMA A;  4KCA A;  1ABA A;  4MH3 A;  4E8H A;  2R4V A;  4ZL9 A;  2L6D A;  3RPP A;  1F2E A;  3TKS E;  3QD9 A;  2H6Z A;  3IC8 A;  2ZUP A;  5HFG A;  5IMZ A;  3EC3 A;  3ZIJ A;  4GCI A;  5IOW A;  1EP7 A;  4HJ2 A;  3RHC A;  1V58 A;  4OAV B;  5DJM A;  2JAC A;  4Q5Q A;  4OWY A;  4MDC A;  3ZLP A;  4GXT A;  3P90 A;  1TRU A;  3LJ1 A;  1YQ1 A;  3DXB A;  1WE0 A;  1KTE A;  4WR5 A;  4AJ8 A;  5DAK A;  4XHM A;  5HR1 A;  2BMX A;  1R7H A;  1SL0 B;  3WYW A;  1BED A;  1HNC A;  2WFC A;  1FVK A;  1PL1 A;  1TI3 A;  1A2L A;  2VM2 A;  2ZCT A;  5H5S A;  4F2I A;  3MAK A;  3EU3 A;  3IOS A;  1XVW A;  1TJD A;  4FYU A;  2C1Y A;  5GAN D;  1ERW A;  1USB A;  4K9Z A;  4PUR A;  4HS1 A;  1K0D A;  2VL2 A;  5G30 A;  2VL3 A;  3P8W A;  4WF4 A;  4Q5R A;  2EC4 A;  1JFU A;  3FZ4 A;  2DBC A;  3IAS 2;  1XWK A;  4MAB A;  5KN1 A;  2ZNM A;  4ZIJ A;  5ECO B;  4X1U A;  1SU9 A;  3WD6 A;  1V98 A;  3M9J A;  1QXH A;  4MZC A;  3H93 A;  5DQS A;  4AS3 A;  2O7K A;  2L57 A;  4JRR A;  3FRC A;  2IMF A;  1CQH A;  1PD2 1;  3A2V A;  4ECC A;  1WJK A;  1HYU A;  2VO4 A;  1ZGN A;  2H8L A;  2DJJ A;  4V2M A;  4NV5 A;  1SJ6 A;  3Q19 A;  2VCQ A;  3RPN A;  1WPI A;  4Z2U A;  2R3X A;  2HRF A;  1ZZY A;  2YFA A;  5ECH B;  2CVB A;  2YPM A;  4AGS A;  4KSM A;  1YEX A;  2B7K A;  4K7O A;  1GTI A;  4EO3 A;  4IGJ A;  2H0G A;  1FW1 A;  3TGZ A;  3GRX A;  3VWV A;  3I69 A;  5LNK e;  1A2M A;  3DA3 A;  1FOV A;  4ACS A;  2ZRR A;  3HVX A;  2R5G A;  4BL7 B;  3LJ2 A;  3UAR A;  5IO2 A;  1GTB A;  3QR6 A;  2YCD A;  2I1U A;  4O5U A;  3ZTL A;  4ZB8 A;  3GL5 A;  3M0F A;  2XTQ A;  6GSU A;  4PL4 A;  1AC1 A;  3P7X A;  2QKE A;  2GZZ A;  2VUP A;  2QC7 A;  2HXK A;  2I81 A;  2A2S A;  2LV3 A;  5D96 A;  1GTA A;  2ON7 A;  4JU5 A;  1B48 A;  2EIQ A;  5ECR B;  1SJ8 A;  2GDR A;  2YWM A;  4JED A;  2QA1 A;  1GLQ A;  3F4M A;  1PKW A;  5A4U A;  2L1L B;  5IPG A;  3KTB A;  2FUG 2;  2DML A;  4Z2T A;  1TXX A;  1JZD A;  4BPY A;  4XS6 A;  4WXT A;  4LLR A;  2CT6 A;  4N30 A;  5DAL B;  3FKF A;  5G2Z A;  2AB6 A;  5JCU A;  13GS A;  3HJO A;  2WJU A;  4FH8 A;  3DML A;  3QAG A;  4DVC A;  4HEA 2;  2DJ3 A;  3HA9 A;  3WT2 A;  1AQW A;  4MK3 A;  3TKQ A;  1Z6N A;  3UJ1 A;  3KTL A;  3WGD A;  1K0C A;  3FW2 A;  1UA5 A;  3GN3 A;  1NHY A;  2N5B A;  3HVV A;  4PGT A;  1YJ6 A;  4JCV E;  1JHB A;  3W8S A;  2P0G A;  3LW9 A;  2YWI A;  3KH7 A;  2OBK A;  3MIX A;  1OE7 A;  2JB1 A;  1SK1 A;  2FLS A;  3GX0 A;  2YAN A;  1TDI A;  4E8E A;  3TKR A;  3UEM A;  5IMF A;  4KX4 A;  3RDW A;  1MDI A;  3CSJ A;  3I43 A;  1ON4 A;  2DJ1 A;  1O7U A;  1TU8 A;  1HNA A;  3LWA A;  4N10 A;  3KIJ A;  1FB0 A;  4ML1 A;  2ON5 A;  5G5E A;  3ED3 A;  1SJZ A;  4GLT A;  5IMV A;  1PN0 A;  3F4S A;  2LRT A;  3MSZ A;  2AYT A;  2R37 A;  1SD8 A;  1FHE A;  4EIQ A;  5BRT A;  1ERT A;  4GQC A;  3TRQ A;  5D9X A;  4ZL8 A;  4OCE A;  5ID2 B;  1EV4 A;  1TK5 B;  4QL9 A;  1Z5Y E;  1EZK A;  2LRN A;  6GSX A;  2CAQ A;  1RK4 A;  1EOH A;  3U5R E;  4X0X A;  1O8X A;  3V1W A;  1AAZ A;  1K0A A;  3TOT A;  2X4A A;  1AW9 A;  3WGX A;  4PL3 A;  4K2D A;  4JE1 A;  2L4Q A;  4MJB A;  3PPU A;  4LMV A;  5COH A;  2WZ9 A;  2H0I A;  4V2L A;  9GSS A;  3F6F A;  3N9J A;  3ME7 A;  1TP9 A;  4I2U A;  4EVM A;  5B8A A;  5CRG A;  4F0C A;  4IBP A;  3TRX A;  5J9B A;  2DSA A;  3HDC A;  5AIV A;  4KA0 A;  3ZRE A;  4K5R A;  1XXU A;  2R0P A;  1Y6E A;  2HE3 A;  3DEX A;  1F9M A;  2Z9S A;  1BG5 A;  2TIR A;  2IL3 A;  4MJC A;  1VRS D;  2DKI A;  3CSH A;  2XBI A;  2WGR A;  4O92 A;  2C4J A;  4O5Q A;  4ZB6 A;  2JB2 A;  2H76 A;  4D73 B;  3UL3 A;  2P5Q A;  2NTO A;  2F3M A;  1UVZ A;  4Z7H A;  3JSB A;  3HZ8 A;  2HYX A;  3LYK A;  2GSR A;  4XS4 A;  2HT9 A;  5DQY A;  2QA2 A;  1TK8 B;  1PMT A;  1R26 A;  1NW2 A;  3F63 A;  3ERG A;  5A4V A;  4KH7 A;  4NXI A;  1SK2 A;  4DSS B;  3UIT A;  1YY7 A;  5FWG A;  4KND A;  4K6X A;  4O32 A;  3TJK A;  4Z2R A;  4YZC A;  3GYK A;  3PH9 A;  1BX9 A;  2F6M B;  4HQS A;  2MMO A;  3HKR A;  4ZBA A;  4MPF A;  5LCZ A;  4N11 A;  2RM6 A;  3GTU A;  2B1K A;  2JSY A;  3IA1 A;  2HFD A;  3FMW A;  3HJP A;  3F0I A;  2R2J A;  5KEJ A;  2VLT A;  2C3T A;  1WP0 A;  4GWR A;  2CQ9 A;  1OVN A;  4KGI A;  3NZN A;  3IPZ A;  2LJK A;  4FQU A;  3E3E A;  1X9M B;  4WBJ A;  5CRH A;  1FB6 A;  5HR3 A;  3UAP A;  3VUR A;  5F0G A;  4LL1 B;  4POM A;  3GSS A;  3VWW A;  2JZR A;  4G0L A;  3P23 A;  4GRF A;  2OAD A;  3IAM 1;  2LNS A;  1NHO A;  2MBT A;  4FIW A;  1DUG A;  2UZ8 A;  1K3O A;  2P5R A;  1T8E B;  4TKY A;  4DWL A;  2LQO A;  2H75 A;  4AF2 A;  2ES7 A;  2H6X A;  2GZY A;  2AUV A;  2XMX A;  4YAP A;  4OCF A;  2HLS A;  3TKS A;  2B3S A;  2IMK A;  1XCC A;  1YF1 A;  3GUR A;  1BQ7 A;  3M8N A;  2IN3 A;  2F8F A;  1EV9 A;  3GH9 A;  5DDL A;  2HSH A;  1SD9 A;  1LBK A;  5EL8 A;  1EOG A;  2C3Q A;  4ULX A;  3H79 A;  1QK8 A;  2B5Y A;  4OO5 A;  4G9H A;  5J3R A;  4USS A;  2DC5 A;  2F9S A;  5JWO B;  2FUG 1;  4OFN A;  5A5K A;  2H30 A;  3DKS A;  1NSW A;  2DIY A;  3L4N A;  1ZMA A;  3VI5 A;  4CHS A;  2K6V A;  3BBY A;  2DKH A;  2TRX A;  4G75 A;  2KHP A;  3R2Q A;  4K2X A;  2H72 A;  5HFI A;  4LMW A;  2IMI A;  2H6Y A;  2CZ2 A;  2HSY A;  1U87 A;  2XHF A;  3DYR A;  1O6J A;  1AUC A;  3D21 A;  3D6I A;  4EC0 A;  2OKA A;  4HEA 1;  2CVK A;  1EGR A;  4TXO B;  1GNW A;  1OC9 A;  2HSM A;  3Q74 A;  5KOX A;  1T00 A;  2V1M A;  1THO A;  1ML6 A;  2GQK A;  4OFT A;  1XOA A;  5DCG A;  1J9B A;  3JCM L;  3L78 A;  4HQZ A;  1X9S B;  4TRX A;  6GSV A;  3CSI A;  2F66 B;  1DSB A;  2IJY A;  3TKP A;  1A0R P;  3GFK A;  1JLV A;  3ZL5 A;  1TRS A;  5ECI B;  2IFQ A;  3KM6 A;  3CRU A;  4PTS A;  5G1K A;  4Q5N A;  3FY7 A;  3IR4 A;  7GSS A;  1TU7 A;  5ECK B;  1ERV A;  1EGO A;  8GSS A;  5DCH A;  5L71 A;  4J2F A;  5IMD A;  3APS A;  4IHU A;  1XW9 A;  3FR3 A;  4X4J A;  4HJM A;  5IM9 A;  3J7Y k;  5ECQ B;  1X5C A;  18GS A;  3MNG A;  4CDO A;  2XC2 A;  4KE3 A;  4TR0 A;  4N0Z A;  1A8Y A;  1B4P A;  3TRP A;  1HNB A;  4JBB A;  4K0N A;  1G0T A;  2PVQ A;  2B1L A;  2B7J A;  2LS5 A;  1SL1 B;  4BWS A;  4J57 E;  2PMT A;  4PQ1 A;  3EIN A;  1M9A A;  4ECJ A;  3W6G A;  2IPA A;  3NOF A;  3P2A A;  4EE0 A;  3KH9 A;  5JCW A;  5KOW A;  5F05 A;  1F37 A;  4BVX A;  2IME A;  5F8B A;  4YQM A;  1OC3 A;  1Z7P A;  1BJX A;  1O73 A;  11GS A;  4TR1 A;  1G7E A;  1JLW A;  4O1O A;  4HFV A;  1RW1 A;  3LJR A;  2LJR A;  3UVT A;  1VF1 A;  1A2J A;  2E8G A;  3TKS C;  1HQO A;  4NWY A;  3GKK A;  4WKW A;  4MF6 A;  5F06 A;  3KGK A;  2I4A A;  3KJY A;  2PBJ A;  4ECI A;  1K0M A;  5GSS A;  4IJ3 A;  4MP4 A;  2M72 A;  4GST A;  1T4Y A;  2MMA A;  4DSR A;  3F8U A;  1ZL9 A;  2H1B A;  2OE3 A;  4NHW A;  1RQM A;  3GA4 A;  1J0F A;  3TJG A;  2TRC P;  3UOM A;  2K9F A;  2KLX A;  3LOR A;  5ELG A;  3PR8 A;  3CRT A;  2K19 A;  2I9H A;  3QPM A;  2RM5 A;  2I3Y A;  1OAZ A;  1EEJ A;  1B9Y C;  1QFN A;  4HU7 A;  4IP6 A;  2L5L A;  2G0F A;  4YZ9 A;  4A5P A;  3C71 A;  1YDK A;  2YWO A;  2MJF B;  4AS2 A;  3BCK A;  3ZML A;  3FBV A;  2OE0 A;  1T7P B;  2YFB A;  2IIY A;  5DJL A;  2RUE A;  2A4H A;  3KP9 A;  2WUL A;  5CRW A;  2H0H A;  2JL4 A;  2C0G A;  3IV4 A;  3WGE A;  2VM1 A;  2C3N A;  3RAZ A;  5G1L A;  4G10 A;  3EMP A;  3QFB C;  1HD2 A;  3FYG A;  1ZYQ B;  2F8A A;  1JZR A;  1IYI A;  1J08 A;  4BVY B;  5IO0 A;  3IK9 A;  2H70 A;  2GT5 A;  1K0O A;  1U6T A;  3Q6O A;  2GZP A;  19GS A;  4X43 A;  1SYX A;  1TTZ A;  4YQU A;  1GSE A;  1QGV A;  4IW9 A;  3C1S A;  1MD3 A;  4HU9 A;  5C00 A;  5KN0 A;  1WMJ A;  2DLX A;  2YZU A;  4RQR A;  2FWE A;  4GSN A;  2XBQ A;  4L0W A;  4WBR D;  1VF3 A;  3IE3 A;  2GQL A;  2X8H A;  4MJA A;  1YF0 A;  5D9V A;  3FEU A;  2L59 A;  4J56 E;  3Q8D A;  4XRA A;  2MMN A;  2DIZ A;  4AJ7 A;  4FYB A;  4MMM A;  4BL7 A;  2X8C A;  5H5Q A;  1PA3 A;  2HZE B;  4IP1 A;  22GS A;  2AV4 A;  2YN1 A;  2ALB A;  2JB3 A;  1H4O A;  2YZH A;  3OR5 A;  2C0F A;  1GH2 A;  2E2M A;  5ELA A;  1Q4J A;  5CYY A;  3GV1 A;  2OE1 A;  5LNK 1;  2XPE A;  1F3A A;  4PXO A;  1S3D A;  3RBT A;  2GQM A;  1ZCP A;  2H66 A;  3LYP A;  4PQH A;  2YV7 A;  4JR4 A;  1GNE A;  1SKS B;  5IIZ A;  2VLU A;  1XFL A;  3DRN A;  5DAL A;  3C1R A;  3PGT A;  3I9V 2;  1GSU A;  3L9S A;  2V6K A;  1GSY A;  5BMU A;  3LQ7 A;  5ECL B;  4MPG A;  3MYD A;  1V9W A;  2L4C A;  4FO5 A;  3QOU A;  4ZB9 A;  1N8J A;  2JZS A;  1GSD A;  5D9W A;  2HNL A;  1DE2 A;  1T3B A;  2CX4 A;  4L0U A;  5KN2 A;  1F3B A;  2WRT A;  2BJX A;  4TXV A;  1Z7R A;  2HRK A;  4L5L A;  4IQA A;  1N2A A;  3VPT A;  1WRY A;  4ICY A;  3IHG A;  4F03 A;  4KDU A;  2J9H A;  2OBI A;  4XRD A;  3MWH A;  4OAU C;  2X8G A;  3D4T A;  2YWN A;  3GIX A;  2V2G A;  2B6M A;  3F4T A;  1TK0 B;  4TR3 A;  5CO3 A;  3TOU A;  2LNT A;  5CAX A;  4RI7 A;  3LJ0 A;  3CBU A;  3ZVJ D;  4PL5 A;  3IAS 1;  5B6M A;  5B7C A;  3A5I A;  4ZL7 A;  4EL1 A;  3KD0 A;  3QFA C;  2DJ2 A;  2N5A A;  4IVF A;  4PX1 A;  3TCO A;  1MEK A;  3HXS A;  4XCS A;  1PGT A;  3RHB A;  3F9U A;  1W89 A;  4POB A;  1XWB A;  1MD4 A;  3KMN A;  3ZIT A;  1JZO A;  3GH6 A;  3J7Y b;  1AQV A;  4OFM A;  5ID2 A;  1M9B A;  2WB9 A;  3D5J A;  4KDX A;  5DAK B;  4POK A;  2DMM A;  1O81 A;  1M7T A;  1YO7 A;  4AJ6 A;  2WS2 A;  1MDJ A;  3L0H A;  3ZFB A;  4O5R A;  4FYC A;  1EEM A;  2O87 A;  3IBH A;  2O85 A;  1THX A;  1G6Y A;  1M2B A;  1O8W A;  3TJF A;  2GS3 A;  3QDN A;  3VPQ A;  3WT1 A;  4RI6 A;  4ECB A;  4IN0 A;  2GSQ A;  3GUS A;  2LUS A;  1PL2 A;  1W4V A;  1E2Y A;  5HR2 A;  2YOI A;  1WWJ A;  4Q5F A;  4L5O A;  2AJQ B;  1R4W A;  4EDZ A;  1JZW A;  5INY A;  14GS A;  1V2A A;  4QQ7 A;  3C8E A;  3F3R A;  3A5W A;  2H1A A;  1A24 A;  4IQ1 A;  4U6R A;  12GS A;  3GX8 A;  2OA7 A;  3HYP A;  2NBS A;  1XW6 A;  2MMZ A;  5E59 A;  3LFL A;  3F4R A;  3BJ5 A;  3QAV A;  4V1A p;  1SK0 A;  2X49 A;  4I1T A;  2LRC A;  2LTK A;  3IC4 A;  2YV9 A;  1R5P A;  1KBN A;  3A2W A;  3G7J A;  4XIH A;  4G0I A;  2CAZ B;  2C0E A;  2WCI A;  5ECN B;  3US3 A;  3UBL A;  4TN8 A;  2H71 A;  4D73 A;  1PRX A;  1M0U A;  1CQG A;  4MF5 A;  1XWC A;  2NVL A;  3ISO A;  1LU4 A;  1Q98 A;  2L5O A;  5DVB A;  4MNN A;  3ZMK A;  4RUV A;  4MZW A;  5CRD A;  5HFK A;  1ZOF A;  3H4K A;  3GMF A;  3ZYW A;  1T1V A;  4GXZ A;  3VK9 A;  1FAA A;  4DSQ A;  2FNO A;  2PN8 A;  3KCM A;  2DJK A;  5HGI A;  2RIO A;  2CX3 A;  4DSS A;  4YH2 A;  4G76 A;  3EVI A;  3AY8 A;  1GP1 A;  2GLR A;  2K8V A;  3IDV A;  2PU9 C;  4IS0 A;  1B8X A;  1IYH A;  2KUC A;  1U3A A;  4EIP A;  4TOP A;  2PPT A;  2A2P A;  1DE1 A;  2KOK A;  1QMV A;  2C8U A;  2R0G A;  2VCZ A;  5E4W A;  3LGC A;  3LEF A;  4RQX A;  1LJR A;  5IQY A;  5GST A;  1YKC A;  1O85 A;  2FA4 A;  1U5K A;  2H01 A;  1GSF A;  1OC8 A;  1Y25 A;  4ML6 A;  4HUA A;  4DEJ A;  1KNG A;  2FWF A;  2K8S A;  4POL A;  1ACV A;  4WF5 A;  3EE2 A;  3G7I A;  2FGX A;  4NAX A;  2QSI A;  1T4Z A;  6GSY A;  2CAI A;  2PVO C;  2AAW A;  5JCG A;  3APQ A;  1FOH A;  4KSO A;  5CNW A;  1F6M C;  4OD7 A;  3TB2 A;  2MZC A;  1PX7 A;  4GQF A;  2A4V A;  4K0G A;  4HI7 A;  1ERU A;  3HZ4 A;  2CVD A;  2FCH A;  5JWQ B;  3SBC A;  5J9C A;  1SYR A;  4K8M A;  3HVS A;  1GUL A;  5GZZ B;  3IHQ A;  4I6X A;  2A2D A;  3HCZ A;  5D8I A;  5H5R A;  3FR9 A;  2LQQ A;  2GVP A;  2J23 A;  2H1D A;  4MZB A;  3QMX A;  1ZYN A;  2HRA A;  1A8L A;  2LJA A;  1URM A;  3FZ9 A;  3SDJ A;  4YZD A;  1FG4 A;  3D0Z A;  3BCI A;  3G7Y A;  1GLP A;  4PQI A;  2IMD A;  5HQP A;  1PSQ A;  4QL7 A;  2YJ7 A;  4G2E A;  1PN9 A;  3GST A;  1E6B A;  1TW9 A;  2FWH A;  4ZBB A;  4F0B A;  1S3C A;  4YKF A;  5CP1 A;  4KUN A;  3DVX A;  2PUK C;  1YKA A;  4ZXG A;  2VL9 A;  3KMO A;  5AIX A;  3VFI A;  3DVW A;  2LKU A;  3H1N A;  2GGT A;  3FK8 A;  4MA9 A;  2K18 A;  4ID0 A;  1WOU A;  3IAM 2;  4WET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...