4NV5A

C50a mutant of synechococcus vkor, c2 crystal form (dehydrated)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
266
structure length
259
Chain Sequence
RHSRLILAILAGLGSLLTAYLTYTKLTEQPAAGGCDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPDLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPLEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VKORC1/thioredoxin domain protein
publication title Structures of an intramembrane vitamin K epoxide reductase homolog reveal control mechanisms for electron transfer.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Oxidoreductase
total genus 80
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4nv5A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nv5A02
3EYTA 2YPMA 4K0NA 4MCUA 3A2WA 2GTUA 3QPMA 3D5JA 1V58A 3ZIJA 4G19A 3D6IA 5AN1A 2VCZA 1X9MB 3D4MA 3UOMA 4KSMA 3M9JA 1HNBA 2JACA 5CNWA 1M2AA 1WJKA 4WETA 2VCXA 4OCEA 4EC0A 2VD0A 2H30A 5CRGA 1TRUA 4PGTA 1PD21 2LTKA 2H1BA 4L5LA 2DIYA 3E9JB 3HYPA 4K8MA 4N11A 4X1UA 1WOUA 1WMJA 3ZYWA 2GGTA 1G7OA 3QAWA 4NAXA 4QQ7A 3LJRA 3ERGA 3HJMA 1CQHA 2H1GA 5C04A 2L4QA 4G2EA 2L57A 2LUSA 4IVFA 1Z7RA 3ZRDA 3CRTA 4WF5A 1ZL9A 4JR4A 3OR5A 4IQ1A 1GUKA 4EF0A 2NBSA 2WDUA 1TW9A 1PQNA 5HR0A 1YF0A 3P8WA 3GURA 3QMXA 2EC4A 3MSZA 4WXTA 3PR8A 5LD0A 4F82A 1YKAA 1U3IA 1TDIA 4ZBAA 2CZ2A 3TUEA 1SL1B 2WZ9A 4JEDA 2WJUA 1E2YA 3SBCA 1ST9A 3KGKA 1OE7A 5IMZA 1AAZA 4EE0A 1QXHA 2VUPA 1JZWA 1A2JA 1B4PA 4GWRA 4YQVA 3H1NA 3ZITA 4ZILA 3QOUA 2F9SA 1B9XC 2B7KA 3CTFA 2IMFA 3TJGA 4HZ2A 3KMOA 2JSYA 1FW1A 3LEFA 2QKEA 3ZMLA 2R4VA 4K2DA 1EWXA 3FY7A 1UN2A 2IN3A 2VL9A 1H4OA 4IW9A 2DMMA 4GQFA 1NM3A 1MDIA 4IP6A 1BQ7A 3HJOA 5CYYA 2GQMA 3FR9A 1MDKA 1Z3EA 1K0OA 3EU3A 1QFNA 3UAPA 4ECIA 2CVDA 2VL3A 4P3YB 3IV4A 4MA9A 4RQXA 3RBTA 4KCEA 3DXBA 2IFQB 4GLTA 5CO3A 5KEJA 5KN3A 5ECNB 3BD2A 1HNCA 1ZCPA 3O76A 3VLNA 1ACVA 1JLVA 4XS4B 1BJXA 1F6MC 2C0GA 3LORA 2V6KA 1TXXA 1EP8A 1EEJA 3IA1A 3ZL5A 3P90A 5DCGA 5CP1A 3TGZA 3HVVA 1PA3A 1R5AA 2J9HA 3EC3A 5G5EA 2HLSA 2X8CA 2CVKA 2FWHA 2WULA 5DAKB 3TJBA 1GTIA 2HZEB 4NHZA 1SL2B 4TRXA 2REMA 3IBHA 2AB6A 2XBIA 3TKSC 3CBUA 1QGVA 4TR1B 2H66A 2YWMA 2H1AA 1OYJA 2IL3A 5ECLB 3KZQA 3VWUA 4JBBA 3GUSA 1ZYEA 2DIZA 1SJZA 4MZBA 5EPFA 2L4CA 4HOJA 4YH2A 4O5RA 3APOA 2QC7A 4WBJA 4ZL7A 3G7YA 3S9FA 4TXOB 4D73A 2V2GA 4HS1A 4MLYA 2YCDA 5J3RA 3IAM2 3CMIA 2WFCA 2L6DA 5ECIB 4AJ8A 4O7HA 4YAVA 2YNXA 2HNLA 2V6OA 4MABA 2H6ZA 4OD7A 1M7TA 2JZRA 1XXUA 5IOWA 3KEBA 2X8GA 4OFNA 5DCHA 2OKAA 1O73A 1KNGA 2H71A 3HHVA 4EO3A 1BAYA 5F07A 2YZHA 4EL1A 3SWLA 2GT5A 3GX0A 2VCQA 1X0RA 4NMUA 2PERA 2ZNMA 3TB2A 3KP8A 1NHOA 2CT6A 1U88A 3IRAA 2HZFA 1V9WA 2PGTA 4N30A 3KCMA 3C71A 2VL2C 5G1LA 1S3CA 3NZNA 4KDXA 3BCIA 4AGSA 5E59A 3NOFA 1HNAA 1WP0A 2B6MA 3DEXA 4WR5A 2PBJA 1O81A 3H4KA 1ERTA 4IELA 3CXGA 4IBPA 2B5XA 5D93A 1GNWA 2MBTA 3G7JA 4I5QA 2CX3A 4J56E 1WWJA 2H70A 5EL8A 4XTSA 1V2AA 3HZ8A 2VLVA 2HT9A 2R5GA 5IOXA 1A8LA 4IJIA 1VF3A 2J23A 1JLWA 3D4TA 1X5DA 4PQIA 1T4ZA 5F05A 5G1KA 1JZDA 3L9UA 4ML6A 3LWAA 4RI6A 4WKWA 1ERWA 2A2RA 3MDKA 4MPGA 5AISA 3AY8A 4L0WA 1RW1A 1XWBA 3FKFA 2CX4A 3ME7A 2F8AA 2E2MA 4CHSA 2IMEA 3HZ4A 5HR3A 1USBA 1Z7PA 2VLUA 3IR4A 3U6VA 4FH8A 1TK0B 5ECSA 3HDCA 3IPZA 3M8NA 1A24A 1M2DA 2E7PA 2G0FA 1TRSA 2MMAA 20GSA 1JZRA 3M9KA 1KTEA 2OE3A 4LL4B 3VI5A 4HZ4A 3FZ4A 3UEMA 4NXIA 5HQPA 1ML6A 5IPHA 2LS5A 3DMLA 1SK2A 4MF7A 3RHBA 4O92A 1GUHA 4WEYA 1EZKA 1K0BA 4AF2A 1GH2A 1GLPA 4LLRA 4OO5A 2LNSA 5IQYA 2ZCTA 5J5NA 3C7MA 2CV4A 1W89A 5B8AA 2L59A 2VAFA 2B7JA 2GLRA 4N10A 2FNOA 3HVSA 5ECQB 3CYNA 3FK8A 4POBA 3UIWA 4TOPA 3NIVA 1E6BA 2RM6A 1PN9A 1M9BA 2KLXA 2KOKA 4MPFA 4OMVA 1T1VA 4GSSA 3QR6A 2H19A 3IOSA 4LMWA 4JZQA 4EUYA 5A4UA 3EE2A 1AQWA 5FWGA 4OO4A 2IJYA 1K3LA 2O87A 4Q5QA 3RDWA 1SU9A 1XWCA 5CRDA 1EGRA 2A2SA 2LJKA 2LRNA 5J41A 2C8UA 5D9TA 1GUMA 3L0HA 2K8SA 4I97A 1U6TA 2LRCA 4MJCA 4XRAA 1K0NA 1KEBA 4FO5A 3UVTA 1R26A 3HJPA 1WE0A 3DIEA 2FUG2 4Q5NA 5IMVA 4KGIA 2GSSA 1FVKA 5FHIA 4NHWA 3I6AA 2DMLA 4ACSA 3UVHA 2ON5A 1SKRB 4PXOA 1XW5A 2R37A 4PNFA 1AC1A 4BL7A 5LNKe 4KSOA 2F8FA 2FLSA 4IKHA 2AV4A 1OE8A 3LFLA 5DALB 1X9WB 10GSA 4K7IA 4KA0A 3L78A 3HKRA 1Q98A 3A2XA 2H0HA 2C0FA 2JSZA 1EGOA 2P5RA 3TOUA 14GSA 2GT6A 2IMIA 5H5RA 2EIQA 2VD1A 2DJ1A 3ERFA 5IPGA 5GZZB 3ZZXA 4V2MA 4KNDA 3APQA 1OKDA 1XBSA 5GAPD 2IIYA 3HCZA 2WB9A 2YJ7A 4DSSA 2H8LA 2N5BA 3ERWA 3FYGA 1GSSA 3M3MA 2B3SA 2WGRA 1Q4JA 2H01A 5HFIA 4J2FA 1GP1A 3RHCA 1MD4A 1TI3A 3DWVA 4I2UA 1F9MA 3F63A 1W4VA 3GKNA 2B1KA 3J7Yb 5IO2A 1AIUA 4HI7A 2AJQB 2PVQA 1JHBA 1SENA 2F3MA 19GSA 5D8IA 1GLQA 2D2ZA 1VF1A 2FA4A 2C0EA 3U5RE 3A2VA 1Z6NA 4BVYA 2DLXA 1I9DA 3MAKA 3QCPA 2H74A 1QQ2A 1VF4A 2N5FA 5G30A 4KUNA 1YEPA 4OCFA 2FWGA 2BMXA 4OFTA 5L71A 4TR3A 3N9JA 2OBKA 3EWLA 3V1WA 2X99A 1TK5B 3MNGA 3TDGA 5HR1A 2NVLA 1TRWA 2YP6A 1EP7A 4OWYA 4IHUA 5DJLA 4XIHA 3F4RA 4MJBA 1I5GA 2M46A 5AIXA 1T4YA 2TRXA 3M1GA 2Z9SA 4I2TA 5JCWA 6GSSA 1FOVA 3L9VA 3VI7A 5D9VA 4TVEA 1ILOA 2FWFA 3GKXA 3ZFLA 4MF6A 3APSA 3L4NA 3UL3A 5KN0A 4MZWA 2JZTA 3LXZA 3ME8A 4I8BA 1YZXA 1ABAA 2X64A 5D96A 3GN3A 4IGJA 1XOBA 3RAZA 2ALBA 3N5OA 3I43A 1AUCA 2H76A 1RK4A 3DVXA 1X5CA 2VM1A 4PX1A 2HE3A 4BVXA 5COHA 2PWJA 5C00A 1ZGNA 3LG6A 1GRXA 4HUAA 2H0IA 2I1UA 2KP2A 3ZFBA 1CQGA 1GTAA 2JU5A 4XCSA 1XVQA 3P7XA 5JWOB 2IMKA 3P2AA 2YN1A 2KP1A 1ERVA 3I9V2 1Y6EA 4HJMA 2GDRA 1A0FA 2BTOT 3CSIA 3W8SA 1B48A 3F3RA 1OC9B 4DEJA 2LV3A 4WF4A 2FHEA 3FZ5A 2LEGA 2XPEA 2ON7A 5JCGA 5F0GA 3LGCA 1NW2A 4JE1A 1UVZA 2GSRA 1AXDA 4I6XA 1FB6A 4ZXGA 4MDCA 4NV2A 5CRWA 3KTLA 1QUWA 3TKRA 3DD3A 1SK1A 3FHKA 1FAAA 2VM2A 2MMNA 3GH6A 2PUKC 2VIMA 4JU5A 3D21A 3D22A 2C0DA 3TCOA 1ZZYA 2HXKA 3GH9A 2ES7A 5G5FA 1PMTA 4F0BA 3VK9A 2I9HA 3ZIVA 1J9BA 2GZPA 4DSRA 3EMXA 2OE0A 1M99A 2NDOA 2L5OA 5IIZA 2GZYA 2FY6A 3F3QA 1XW6A 2G2QA 1DSBA 1ON4A 2ZUPA 5ENUA 3GL5A 2E2GA 2K9FA 2M72A 3IC4A 3GIXA 3C1SA 3GSTA 4RI7A 3BOAA 2C1YA 4DSSB 1AQXA 3GTUA 1HD2A 1M0UA 1XFLA 1T8EB 4TR0A 1TU7A 5GSSA 2VCWA 1GWCA 4RQRA 1XWKA 2LJRA 3VFIA 4HQSA 1XIYA 1A2LA 1SYXA 2GSTA 1BX9A 1F2EA 3EVIA 1FVJA 1SD8A 3DGQA 3QAVA 2IWTA 1PGTA 1URMA 1EOHA 3O6TA 3UMAA 1G0TA 2FGXA 4Z7XA 1DE1A 3Q6OA 1U87A 4CW9A 2EIOA 5GSTA 5J4UA 3VWXA 2OBIA 5J9BA 1RQMA 2O8VB 1PX7A 1O6JA 3FW2A 2RLIA 3KJYA 1EEMA 3J7Yk 1TK8B 1G6WA 4AJ6A 3UBKA 1PL2A 4HU7A 3LSZA 1SKSB 2WRTA 3VPQA 4F9ZA 2V1MA 3KXOA 2YWOA 18GSA 2PU9C 3UJ1A 2CVBA 1ZYQB 7GSSA 1O8XA 4MH3A 5IMDA 2E0QA 3TKSE 5D73A 3M0FA 3WGEA 4DSQA 2AYTA 1EV4A 2LNTA 1IYHA 3F6DA 2LJAA 5D9XA 1S3AA 4PQHA 3E3EA 5ECOB 4V1Ag 1R4WA 5ID2A 3I69A 2X8HA 1HYUA 5G2ZA 1V57A 2AHEA 4XS1A 4ZL9A 4POMA 1B4QA 5KN2A 2N5AA 2RUFA 2DBCA 6GSXA 1M2BA 2WS2A 4ILFA 4ZIJA 1XWAA 4MH2A 4F2IA 1S3DA 2GQKA 1KBNA 4K1FA 5HFKA 4ZB8A 2QSIA 2CZ3A 3GMFA 2JL4A 3A3TA 2TIRA 5AIVA 3GKKA 3EURA 2TRCP 1UA5A 3WT1A 8GSSA 1LU4A 3KH9A 5B6MA 3QDNA 1MTCA 2HSHA 4ID0A 1K0CA 2CAIA 1AQVA 1ZMAA 2AAWA 2C3NA 4O32A 2VOCA 3F8UA 2H1DA 4K0GA 4KDYA 5GAND 1FHEA 3FR6A 4NWYA 4YQUA 4FYUA 2NPBA 2DJ3A 4XS4A 4HQZA 2LKUA 1NHYA 5F8BA 4RUVA 4QL9A 2XBQA 5EVOA 4PUFC 2P0GA 2VO4A 5F06A 4ECCA 5D9WA 4POLA 3WD6A 3IXRA 2LQQA 4L0UA 2RIIA 3FEUA 4D73B 2HZEA 2NTOA 1XWGA 3F4TA 2QGVA 4LMVA 6GSVA 1TI1A 2FA8A 3GKMA 4F03A 1WIKA 1YKCA 3TJFA 3JCML 3GTUB 3LQ7A 3TRXA 5H5QA 4GSTA 1PX6A 4BA7A 3UARA 1U3AA 1TKDB 4KE3A 4E8EA 1K0MA 3Q74A 1UC7A 5DVBA 3QFBC 2PN8A 4EKZA 2GS3A 2IPAA 1BYEA 1TP9A 4G10A 4FYCA 2DJJA 1TJDA 1YY7A 4GQCA 1THOA 3TKSA 2OE1A 4KW6A 2VCVA 3FZ9A 2MYGA 9GSSA 1SL0B 1X5EA 2OACA 3Q18A 3GX8A 3C1RA 3C73A 2R3XA 2FD3A 1NSWA 2HYXA 1A0RP 3TKQA 2XC2A 5HR2A 4ZB9A 1Z9HA 5DQYA 3H79A 4PNGA 5ECRB 1FG4A 2JZSA 1H75A 3PGTA 1XVWA 1C72A 5LCZA 1R5PA 4FIWA 1V98A 3FR3A 1O85A 1G6YA 1XPVA 3KMNA 1DE2A 1T3BA 2YOIA 1EV9A 1GSDA 1TTZA 4F0CA 4HJ2A 3WYWA 1SJ6A 3R2QA 4G9HA 3CTGA 1Y25A 1YF1A 2OJLA 3F0IA 1PL1A 3F9UA 2R2JA 3G9BA 2DJ2A 1O8WA 2YZUA 3F6FA 5E4WA 3ZVJD 2I81A 3QFAC 4ZBBA 1SD9A 2JADA 3IK9A 3F4SA 4GCIA 2FWEA 3HXSA 2VL2A 3ED3A 1F3AA 2C80A 2HRFA 5ID2B 2XPDA 1X9SB 4IJ3A 1XOAA 1TU8A 3BBYA 2C3QA 2HI7A 1OKTA 4TR4A 3W8JA 3ZLPA 4Q5RA 5IMCA 5B7CA 3LYPA 12GSA 4ZL8A 3IHQA 6GSYA 2K18A 22GSA 5HFGA 4ECBA 3IAS2 1SJIA 1V40A 4K6XA 1LBKA 1BEDA 5ECPB 2PMTA 4CDOA 5ECKB 3CRUA 2HRNA 5EY6A 4Q5FA 3GL3A 1XCCA 5J9CA 4IN0A 5ECMB 1THXA 4WBRD 4MF5A 1WRYA 1YJ6A 3TRPA 1K0AA 3HY2A 5AGYA 1B9YC 5B8BA 1GNEA 1HQOA 2O7KA 1Z5YE 3A5WA 4EVMA 3BJ5A 4HU9A 2M80A 5JWQB 4WR4A 4N0ZA 1YQ1A 4KAEA 4XHMA 1A23A 2XHFA 2VCTA 5B6NA 5ECHB 4PQ1A 1OAZA 4GF0A 1T00A 3ZMKA 1WPIA 2P5QA 3GYKA 4NPBA 2H6YA 3ISOA 4BWQA 2GZZA 2PVOC 3HVXA 4GRFA 2MMZA 5G31A 4PURA 3UBLA 5A4WA 2CAQA 17GSA 3Q19A 1PKWA 2EIRA 3KIJA 1QK8A 2KHPA 3D0ZA 1GSYA 4BPYA 3LYKA 3MWHA 2AUVA 4E8HA 1ZOFA 2L5LA 4JRRA 3VWWA 1BG5A 4JR6A 2LRTA 4X0XA 1OVNA 3US3A 1GL8A 3TJKA 1K0DA 2YWIA 2DJKA 3HD5A 4KB3A 1VRSD 3KM6A 2H6XA 4LA1A 1SK0A 3IDVA 5JWRB 1EOGA 1GSUA 1R7HA 3GSSA 4KH7A 2V41A 3CSJA 4X43A 1SKWB 3GV1A 3K8NA 3VURA 2C4JA 3WGDA 1N2AA 2C3TA 1B8XA 5DALA 2B5EA 1J0FA 3TKPA 2GSQA 1PKZA 5CRHA 4TW5A 1QMVA 1VGLA 2O89A 1GTBA 1N8JA 3KP9A 4V2LA 4MP4A 4MK3A 4POKA 3WGXA 4MMMA 3HA9A 1A2MA 3GHAA 4TKYA 3ZTLA 2MBSA 1JZOA 3E0UA 4H86A 4AJ7A 6GSWA 1GSQA 1DBYA 4K7OA 3FRCA 1M9AA 2YWNA 2YV7A 5ABRA 2PPTA 2I3YA 2KUCA 3ZVJA 4IS0A 4V2NA 1YDKA 1GTUA 4ZB6A 2RUEA 3TRQA 5ELGA 1PRXA 2GQLA 2F51A 1Z6MA 5KN1A 5DDLA 3C8EA 4L5OA 3GNJA 4HDEA 3KTBA 4TXVA 1SYRA 1F37A 3KD0A 4ISDA 5CAXA 1GSEA 4N0VA 2BJXA 5INYA 4TN8A 3QD9A 2YV9A 2WCIA 3WT2A 3PH9A 11GSA 5IMAA 2V32A 3BCKA 3H8QA 1J08A 1GULA 4ULXA 1IYIA 3DYRA 2MMOA 2VLTA 3IE3A 3DRNA 5DBQA 2DC5A 3RPNA 3L9SA 3LXTA 5DQSA 3KH7A 2I4AA 2K6VA 3IK7A 2K8VA 1MD3A 2LSTA 4NV5A 3CSHA 6GSUA 1DUGA 3EMPA 2OA7A 5IO0A 13GSA 1XZOA 4V1Ap 2DSAA 2DJ0A 3GRXA 1OC8A 4YQMA 4K7NA 1MDJA 2L6CA 4GXZA 3W6GA 4EXJA 6GSTA 3G7IA 5ELAA 4YAPA 2HFDA 5IM9A 2H75A 2HSYA 4IP1A 4KCAA 5A4VA 3EINA 4MJEA 2YANA 1PSQA 4GTUA 2OADA 3H93A 3TOTA 4XS6A 4BWSA 4K9ZA 3RPPA 1YEXA 2H72A 4ML1A 2H0GA 4OFMA 4ECJA 3GA4A 4MZCA 3EU4A 1G7EA 3DVWA 5IMFA 2CQ9A 3PINA 4LL1B 1TRVA 4PUAA 2IFQA 2IMDA 5JCUA 2GVPA 3FZAA 3O3TA 4QL7A 1T7PB 4MJAA 2CA8A 1A8YA 1OC9A 3ZREA 3QAGA 3TJJA 2O85A 1VF2A 4IQAA 4J57E 5A5KA 2LQOA 1OC3A 2B5YA 1FB0A 4EDZA 1AW9A 1MEKA 2FCHA 5DAKA 1GSFA 1K3OA 3GFKA 1LJRA 1JFUA 1O7UA 16GSA 4TR1A 4KX4A 4HEA2 4KDUA 5CREA 2RM5A 2MZCA 1TOFA 2YJHA 2A4VA 1FO5A 4DVCA 5DJMA 3VWVA 1ERUA 2B1LA 4ZBDA 4XRDA 3VPTA 4EDYA 1K3YA 4FYBA 4GSNA 5FT3A 5H5SA 2P31A 1XW9A 4TXOA 2R6KA 2H73A 3DKSA 4L8EA 1F3BA
chains in the Genus database with same CATH superfamily
3EYTA 2YPMA 4K0NA 4MCUA 3A2WA 2GTUA 3QPMA 3D5JA 4YZDA 1V58A 3ZIJA 4G19A 3D6IA 5AN1A 2VCZA 1X9MB 3D4MA 3UOMA 4KSMA 3M9JA 3FMWA 1HNBA 2JACA 5CNWA 1M2AA 1WJKA 4WETA 2VCXA 4OCEA 4EC0A 2VD0A 2H30A 5CRGA 1TRUA 4PGTA 1PD21 2LTKA 2H1BA 4L5LA 2DIYA 3E9JB 3HYPA 4K8MA 4N11A 4X1UA 1WOUA 1WMJA 3ZYWA 2GGTA 1G7OA 3QAWA 4NAXA 4QQ7A 3LJRA 3ERGA 3HJMA 1CQHA 2H1GA 5C04A 2L4QA 4G2EA 2L57A 2LUSA 4IVFA 1Z7RA 3ZRDA 3CRTA 4WF5A 1ZL9A 4JR4A 3OR5A 4IQ1A 5KOWA 1GUKA 4EF0A 2NBSA 2WDUA 1TW9A 1PQNA 5HR0A 1YF0A 3P8WA 3GURA 3QMXA 2EC4A 3MSZA 4WXTA 3PR8A 5LD0A 2L1LB 4F82A 1YKAA 1U3IA 1TDIA 4ZBAA 2CZ2A 3TUEA 1SL1B 2WZ9A 4JEDA 2WJUA 1E2YA 3SBCA 1ST9A 3R3EA 3KGKA 2A2CA 1OE7A 5IMZA 3IAS1 1AAZA 4EE0A 1QXHA 2VUPA 1JZWA 1A2JA 1B4PA 4GWRA 4YQVA 3H1NA 3ZITA 4ZILA 3QOUA 2F9SA 1B9XC 2K19A 2B7KA 3CTFA 2IMFA 3TJGA 4HZ2A 3KMOA 2JSYA 1FW1A 3LEFA 2QKEA 3ZMLA 2R4VA 4K2DA 1EWXA 3FY7A 1UN2A 2IN3A 2VL9A 1H4OA 4IW9A 2DMMA 4GQFA 1NM3A 4IP6A 1MDIA 1BQ7A 3HJOA 5CYYA 1PN0A 5LNK1 2GQMA 3FR9A 4K2XA 1MDKA 1Z3EA 4OAUC 1K0OA 3EU3A 1QFNA 3UAPA 4ECIA 2CVDA 2VL3A 4P3YB 4O1PA 3IV4A 4MA9A 1FOHA 4RQXA 3RBTA 4KCEA 3DXBA 2IFQB 4GLTA 5CO3A 5KEJA 5KN3A 5ECNB 2CAZB 3BD2A 2A2DA 1HNCA 1ZCPA 3O76A 3SDJA 3VLNA 1ACVA 1JLVA 4XS4B 1BJXA 1F6MC 2C0GA 3LORA 2V6KA 1TXXA 1EP8A 1EEJA 3IA1A 3ZL5A 3P90A 5DCGA 5CP1A 3TGZA 3HVVA 1PA3A 3EC3A 1R5AA 2J9HA 5G5EA 2HLSA 2X8CA 2CVKA 2FWHA 2WULA 5DAKB 3TJBA 1GTIA 2HZEB 4NHZA 1SL2B 4TRXA 2REMA 4PL3A 3IBHA 2AB6A 2XBIA 3TKSC 3CBUA 1QGVA 4TR1B 2H66A 1YO7A 2F6MB 2YWMA 2H1AA 1OYJA 2IL3A 5ECLB 3KZQA 3VWUA 3IHGA 4JBBA 2HGKA 3GUSA 1ZYEA 2DIZA 1SJZA 4MZBA 5EPFA 2L4CA 3FVVA 4HFVA 4HOJA 4YH2A 4O5RA 3APOA 2QC7A 4WBJA 4ZL7A 3G7YA 3S9FA 4TXOB 4D73A 2V2GA 4HS1A 4MLYA 1XG8A 2YCDA 5J3RA 3IAM2 3CMIA 2WFCA 1PFOA 2L6DA 5ECIB 4O7HA 4AJ8A 2YNXA 2HNLA 2V6OA 4MABA 4YAVA 2H6ZA 4OD7A 1M7TA 2JZRA 3F4MA 1XXUA 5IOWA 3KEBA 2X8GA 4OFNA 5DCHA 2OKAA 1O73A 1KNGA 2H71A 4FQUA 3HHVA 4EO3A 1BAYA 5F07A 2YZHA 4EL1A 3SWLA 3GX0A 2GT5A 2VCQA 1X0RA 4NMUA 2PERA 2ZNMA 3TB2A 3KP8A 2XTRA 1NHOA 2CT6A 1U88A 3IRAA 2HZFA 1V9WA 2PGTA 4N30A 3KCMA 3C71A 2VL2C 5G1LA 1S3CA 3NZNA 4KDXA 3BCIA 4AGSA 4YKGA 5E59A 3NOFA 1HNAA 1WP0A 2B6MA 3DEXA 4WR5A 2PBJA 1O81A 3H4KA 1ERTA 4IELA 3CXGA 4IBPA 2ZRRA 2B5XA 5D93A 1GNWA 2MBTA 3G7JA 4I5QA 2CX3A 4J56E 1WWJA 2H70A 5EL8A 4XTSA 1V2AA 3HZ8A 2VLVA 2HT9A 2R5GA 5IOXA 4O5QA 1A8LA 4IJIA 1VF3A 2J23A 3UITA 1JLWA 3D4TA 1X5DA 4PQIA 1T4ZA 5F05A 5G1KA 1JZDA 3L9UA 4ML6A 3LWAA 4HSCX 4RI6A 4WKWA 1ERWA 2A2RA 2ETDA 3MDKA 4MPGA 5AISA 3AY8A 4L0WA 1RW1A 1XWBA 3FKFA 2CX4A 3ME7A 2F8AA 2HRKA 2E2MA 4CHSA 2IMEA 3HZ4A 5HR3A 1USBA 1Z7PA 2VLUA 3IR4A 3U6VA 4FH8A 1TK0B 5ECSA 3HDCA 3IPZA 3M8NA 1A24A 1M2DA 2E7PA 2G0FA 1TRSA 2MMAA 20GSA 1JZRA 3M9KA 1KTEA 2OE3A 4LL4B 3VI5A 4HZ4A 3FZ4A 3UEMA 4NXIA 5HQPA 1ML6A 5IPHA 3LJ1A 2LS5A 1SJ8A 3DMLA 1SK2A 4MF7A 3RHBA 4O92A 1GUHA 4WEYA 1EZKA 1K0BA 4AF2A 1GH2A 1TDPA 4KF9A 1GLPA 4LLRA 4OO5A 2LNSA 5IQYA 2ZCTA 5J5NA 3C7MA 2CV4A 1W89A 5B8AA 2L59A 2VAFA 2B7JA 3L0IA 2IP6A 2GLRA 4N10A 2FNOA 3HVSA 5ECQB 3CYNA 3FK8A 4POBA 3UIWA 4TOPA 3NIVA 1E6BA 2RM6A 1PN9A 1M9BA 2KLXA 2KOKA 4MPFA 4OMVA 1T1VA 4GSSA 3QR6A 2H19A 3IOSA 4LMWA 4JZQA 4EUYA 5A4UA 3EE2A 2BL8A 1AQWA 5FWGA 4OO4A 2IJYA 1K3LA 2O87A 4Q5QA 3RDWA 2FUG1 1SU9A 1XWCA 4HEA1 5CRDA 1EGRA 2A2SA 2LJKA 2LRNA 5J41A 2C8UA 5D9TA 1GUMA 3L0HA 2K8SA 1JQOA 5HGIA 4I97A 1U6TA 2LRCA 4YZ9A 4MJCA 4XRAA 1K0NA 1KEBA 4FO5A 3UVTA 1R26A 3HJPA 1WE0A 3DIEA 2FUG2 4Q5NA 5IMVA 4KGIA 2GSSA 4G76A 1FVKA 5FHIA 4NHWA 3I6AA 2DMLA 4ACSA 3UVHA 2ON5A 1SKRB 4PXOA 1XW5A 2R37A 4PNFA 1AC1A 4BL7A 5LNKe 4KSOA 2F8FA 2FLSA 4G0IA 4IKHA 2AV4A 1OE8A 3LFLA 5DALB 1X9WB 10GSA 4K7IA 4KA0A 3L78A 3HKRA 2XMXA 1Q98A 3A2XA 2H0HA 2C0FA 2JSZA 1EGOA 2P5RA 3TOUA 14GSA 2GT6A 2IMIA 5H5RA 2EIQA 2VD1A 2DJ1A 3ERFA 5IPGA 2E8GA 5GZZB 3ZZXA 4V2MA 4KNDA 3APQA 1OKDA 1XBSA 5GAPD 2IIYA 3HCZA 2WB9A 2YJ7A 4DSSA 2H8LA 2N5BA 3ERWA 3FYGA 1GSSA 3M3MA 2B3SA 4G75A 2WGRA 2FU2A 1Q4JA 3AJFA 2H01A 5HFIA 4J2FA 1GP1A 3MIXA 3RHCA 4Z2TA 1MD4A 1TI3A 3DWVA 4I2UA 1F9MA 3F63A 1W4VA 3GKNA 2B1KA 3J7Yb 5IO2A 1AIUA 4HI7A 1U5KA 2AJQB 2PVQA 1JHBA 1SENA 2F3MA 19GSA 5D8IA 1GLQA 2D2ZA 1VF1A 2FA4A 2C0EA 3U5RE 3A2VA 1Z6NA 4BVYA 2DLXA 1I9DA 3MAKA 3QCPA 2H74A 1QQ2A 1VF4A 2N5FA 5G30A 4KUNA 1YEPA 4OCFA 2JB3A 2FWGA 2BMXA 4OFTA 5L71A 4TR3A 3N9JA 2OBKA 3EWLA 3V1WA 2X99A 1TK5B 3MNGA 3TDGA 5HR1A 2NVLA 1TRWA 2YP6A 1EP7A 4OWYA 2F66B 4IHUA 5DJLA 3FNBA 4XIHA 3F4RA 4MJBA 1I5GA 2M46A 5AIXA 1T4YA 2TRXA 3M1GA 2Z9SA 4I2TA 5JCWA 6GSSA 1FOVA 3L9VA 3VI7A 5D9VA 4TVEA 1ILOA 2FWFA 3GKXA 3ZFLA 4MF6A 3APSA 3L4NA 3UL3A 5KN0A 2HSMA 4MZWA 2JZTA 3LXZA 3ME8A 4I8BA 1YZXA 1ABAA 2X64A 5D96A 3GN3A 3I9V1 4IGJA 1XOBA 3RAZA 2ALBA 3N5OA 3I43A 1AUCA 2H76A 1RK4A 3DVXA 1X5CA 2XTQA 2VM1A 4PX1A 2HE3A 4BVXA 4OAVB 4YZCA 5COHA 4Z7HA 3IC8A 2PWJA 5C00A 1ZGNA 4JCVE 3LG6A 1GRXA 4HUAA 2H0IA 2I1UA 2HRAA 2KP2A 4Z2RA 3ZFBA 1CQGA 1GTAA 2JU5A 4XCSA 1XVQA 3P7XA 5JWOB 2IMKA 3P2AA 2YN1A 2KP1A 1ERVA 3I9V2 1Y6EA 4HJMA 4EIQA 2GDRA 1A0FA 2BTOT 3CSIA 3W8SA 1B48A 3F3RA 1OC9B 4DEJA 2LV3A 3FBVA 4WF4A 2FHEA 3FZ5A 2LEGA 2FEFA 2XPEA 2ON7A 5JCGA 5F0GA 5BRTA 3LGCA 1NW2A 4JE1A 1UVZA 2GSRA 1AXDA 4I6XA 1FB6A 4ZXGA 4MDCA 4NV2A 5CRWA 3KTLA 1QUWA 3TKRA 3DD3A 1SK1A 3FHKA 1FAAA 2VM2A 2MMNA 3GH6A 2PUKC 2VIMA 4JU5A 3D21A 3D22A 3DO9A 2C0DA 3TCOA 3IAM1 1ZZYA 2HXKA 3GH9A 4BL7B 2ES7A 5G5FA 1PMTA 4F0BA 3VK9A 2I9HA 3ZIVA 1J9BA 2GZPA 4DSRA 3EMXA 2OE0A 1M99A 2NDOA 2L5OA 5IIZA 2GZYA 2FY6A 3F3QA 1XW6A 2G2QA 1DSBA 1ON4A 2X4AA 2ZUPA 5ENUA 3GL5A 2E2GA 2K9FA 2M72A 3IC4A 3GIXA 3C1SA 3GSTA 4RI7A 3BOAA 2C1YA 4AS2A 1AQXA 3GTUA 4DSSB 1HD2A 1M0UA 1XFLA 1T8EB 4TR0A 1TU7A 5GSSA 2VCWA 4GXTA 1GWCA 4RQRA 1XWKA 2LJRA 3VFIA 4HQSA 1XIYA 1A2LA 1SYXA 2GSTA 1BX9A 1F2EA 3EVIA 3HVNA 1FVJA 1SD8A 3DGQA 3QAVA 2IWTA 1PGTA 1URMA 1EOHA 3O6TA 3UMAA 4PTSA 1G0TA 2FGXA 4Z7XA 1DE1A 3Q6OA 1U87A 4A5PA 4CW9A 2EIOA 5GSTA 5J4UA 3VWXA 2OBIA 5J9BA 1RQMA 2MJFB 2O8VB 1PX7A 1O6JA 3FW2A 2RLIA 3KJYA 1EEMA 3J7Yk 1TK8B 1G6WA 2YFAA 4AJ6A 3UBKA 1PL2A 4PL4A 4HU7A 3LSZA 4PL5A 1SKSB 4MNNA 4X4JA 2WRTA 5BMUA 4EIPA 3VPQA 1S3RA 4F9ZA 2V1MA 4CY6A 3KXOA 2YWOA 18GSA 2PU9C 3UJ1A 2CVBA 1ZYQB 7GSSA 1O8XA 4MH3A 5IMDA 2E0QA 3TKSE 3DA4A 5D73A 3M0FA 3WGEA 3CQFA 4DSQA 2RIOA 2AYTA 1EV4A 2LNTA 1IYHA 3F6DA 2LJAA 5D9XA 1S3AA 4PQHA 3E3EA 5ECOB 4V1Ag 1R4WA 5ID2A 4I1TA 3I69A 2X8HA 1HYUA 5G2ZA 1V57A 2AHEA 4XS1A 4ZL9A 4POMA 1B4QA 5KN2A 2N5AA 2RUFA 2DBCA 6GSXA 1M2BA 2WS2A 4ILFA 4ZIJA 1XWAA 4MH2A 4F2IA 1S3DA 2GQKA 1KBNA 4K1FA 5HFKA 4ZB8A 2QSIA 2CZ3A 3GMFA 2JL4A 3A3TA 2TIRA 5AIVA 3GKKA 3EURA 2TRCP 1UA5A 3WT1A 8GSSA 1LU4A 3KH9A 5B6MA 3QDNA 1MTCA 2HSHA 4ID0A 1K0CA 2CAIA 1AQVA 1ZMAA 2AAWA 2C3NA 4O32A 4O5UA 2VOCA 2ZW3A 3F8UA 2H1DA 2GSCA 4K0GA 2JB2A 2JBWA 4KDYA 5GAND 2QA1A 1FHEA 3FR6A 2P22B 4NWYA 4YQUA 4FYUA 2NPBA 2DJ3A 4XS4A 4HQZA 2LKUA 1NHYA 5F8BA 4RUVA 4QL9A 2XBQA 5EVOA 2X49A 4PUFC 2P0GA 3P23A 2VO4A 5F06A 2RADA 4ECCA 5D9WA 4POLA 3WD6A 3IXRA 2LQQA 4L0UA 2RIIA 3FEUA 4D73B 2HZEA 2NTOA 1XWGA 3F4TA 2QGVA 4LMVA 6GSVA 1TI1A 2FA8A 3GKMA 4F03A 1WIKA 1YKCA 1ZYNA 3TJFA 3JCML 3GTUB 3LQ7A 3TRXA 5H5QA 4GSTA 1PX6A 4BA7A 3UARA 1U3AA 1TKDB 4KE3A 4E8EA 1K0MA 3Q74A 1UC7A 5DVBA 3QFBC 2PN8A 4EKZA 2GS3A 2IPAA 4ICYA 1BYEA 1TP9A 4G10A 3LJ2A 4FYCA 2DJJA 1TJDA 3B55A 1YY7A 4GQCA 1THOA 3TKSA 2OE1A 2DKHA 4KW6A 2VCVA 3FZ9A 2MYGA 9GSSA 1SL0B 2A2PA 1X5EA 2OACA 4CY8A 3Q18A 2JB1A 3GX8A 3C1RA 3C73A 2R3XA 2FD3A 1NSWA 2HYXA 1A0RP 3TKQA 2XC2A 5HR2A 4ZB9A 1Z9HA 5DQYA 4USSA 3H79A 4PNGA 5ECRB 1FG4A 2JZSA 1H75A 3PGTA 1XVWA 1C72A 5LCZA 1R5PA 3EPTA 4FIWA 1V98A 3FR3A 1O85A 1G6YA 1XPVA 3KMNA 1DE2A 1T3BA 2YOIA 1EV9A 1GSDA 1TTZA 4F0CA 2UZ8A 4HJ2A 3WYWA 1SJ6A 3R2QA 4G9HA 3CTGA 1Y25A 1YF1A 2OJLA 3F0IA 1PL1A 3F9UA 2JAEA 2A4HA 2R2JA 3G9BA 2DJ2A 1O8WA 2YZUA 3F6FA 4Z2UA 5E4WA 3ZVJD 2I81A 3QFAC 4ZBBA 1SD9A 2JADA 3IK9A 3F4SA 4GCIA 2FWEA 3HXSA 2VL2A 3ED3A 1F3AA 2C80A 2HRFA 5ID2B 2XPDA 1X9SB 4IJ3A 1XOAA 1TU8A 3BBYA 2RLDA 2C3QA 2HI7A 1OKTA 4TR4A 3W8JA 3ZLPA 4Q5RA 5IMCA 5B7CA 2R0GA 3LYPA 12GSA 4ZL8A 3IHQA 6GSYA 2K18A 22GSA 5HFGA 4ECBA 3IAS2 1SJIA 1V40A 4K6XA 1LBKA 4DWLA 1BEDA 5ECPB 2PMTA 4CDOA 5ECKB 3CRUA 2HRNA 5EY6A 4Q5FA 3GL3A 1XCCA 5J9CA 4G0KA 4IN0A 5ECMB 1THXA 4WBRD 4MF5A 1WRYA 1YJ6A 3TRPA 1K0AA 3HY2A 5AGYA 1B9YC 5B8BA 1GNEA 1HQOA 2O7KA 2YFBA 4Q9VA 1Z5YE 3A5WA 4EVMA 3BJ5A 4HU9A 2M80A 4O1OA 5JWQB 4WR4A 4N0ZA 1YQ1A 4KAEA 4XHMA 1A23A 2XHFA 2VCTA 5B6NA 5ECHB 3JSBA 4PQ1A 2QGMA 1OAZA 4GF0A 1T00A 3ZMKA 1WPIA 2P5QA 2QZGA 3GYKA 4NPBA 2H6YA 3DA3A 3ISOA 4BWQA 2GZZA 2PVOC 3HVXA 4GRFA 2MMZA 5G31A 4PURA 3UBLA 5A4WA 2CAQA 17GSA 3Q19A 3MYDA 1PKWA 3LW9A 2EIRA 3KIJA 1QK8A 2KHPA 3D0ZA 4G0LA 1GSYA 4BPYA 3LYKA 3MWHA 2AUVA 4E8HA 1ZOFA 2L5LA 4JRRA 3VWWA 1BG5A 4JR6A 2LRTA 4X0XA 1OVNA 3US3A 1GL8A 3TJKA 1K0DA 2YWIA 1W3SA 2DJKA 3HD5A 4KB3A 1VRSD 3KM6A 2H6XA 4LA1A 1SK0A 3IDVA 5JWRB 1EOGA 1GSUA 1R7HA 3GSSA 4KH7A 2V41A 3CSJA 4X43A 1SKWB 3GV1A 3K8NA 3VURA 2C4JA 3WGDA 1N2AA 2KKMA 2C3TA 3VA9A 1B8XA 5DALA 2B5EA 1J0FA 3TKPA 2GSQA 1PKZA 5CRHA 4TW5A 1QMVA 1VGLA 2O89A 1GTBA 1N8JA 3KP9A 4V2LA 4MP4A 4MK3A 4POKA 3WGXA 4MMMA 3HA9A 1A2MA 3GHAA 4TKYA 3ZTLA 4BVYB 2MBSA 1JZOA 3E0UA 4H86A 4AJ7A 6GSWA 1GSQA 1DBYA 4K7OA 3FRCA 1M9AA 2YWNA 2YV7A 5ABRA 2PPTA 2I3YA 2KUCA 3ZVJA 4IS0A 4V2NA 4YKFA 1YDKA 1GTUA 4ZB6A 2RUEA 1M3IA 3TRQA 5ELGA 1PRXA 2GQLA 2F51A 1Z6MA 5KN1A 5DDLA 2QSBA 3C8EA 4L5OA 3GNJA 4HDEA 3KTBA 4TXVA 5KOXA 1SYRA 1F37A 2V1CC 3KD0A 4ISDA 5CAXA 1GSEA 4N0VA 2BJXA 5INYA 4TN8A 3QD9A 2YV9A 2DKIA 2WCIA 3WT2A 3PH9A 11GSA 5IMAA 2V32A 3BCKA 3H8QA 1J08A 1GULA 4K5RA 4ULXA 1IYIA 3DYRA 2MMOA 2VLTA 3IE3A 3DRNA 5DBQA 2DC5A 3RPNA 3L9SA 3LXTA 5DQSA 3KH7A 2I4AA 2K6VA 4U6RA 3IK7A 2K8VA 1MD3A 4K5SA 2LSTA 4NV5A 4Z7GA 4BVXB 3CSHA 6GSUA 1DUGA 3EMPA 2OA7A 5IO0A 13GSA 1XZOA 4V1Ap 2DSAA 2DJ0A 3GRXA 1OC8A 4YQMA 4K7NA 1MDJA 4BIKA 2L6CA 4GXZA 3W6GA 4EXJA 6GSTA 3G7IA 5ELAA 4YAPA 2HFDA 5IM9A 2H75A 2HSYA 4IP1A 4KCAA 5A4VA 3EINA 4MJEA 2YANA 1PSQA 4GTUA 2OADA 3H93A 3TOTA 4XS6A 4BWSA 4K9ZA 3RPPA 1YEXA 2H72A 4ML1A 2H0GA 4OFMA 4ECJA 3GA4A 4MZCA 3EU4A 1G7EA 3DVWA 5IMFA 2CQ9A 3PINA 4LL1B 1TRVA 4PUAA 2IFQA 2IMDA 1M3JA 5JCUA 2GVPA 3FZAA 3O3TA 4QL7A 1T7PB 4MJAA 2CA8A 1A8YA 1OC9A 3ZREA 3QAGA 2R0CA 3TJJA 2O85A 1VF2A 4IQAA 4J57E 5A5KA 2LQOA 1OC3A 2B5YA 1FB0A 4EDZA 1AW9A 1MEKA 2FCHA 5DAKA 1GSFA 1K3OA 3GFKA 1LJRA 3A5IA 1JFUA 1O7UA 2V6EA 2BL7A 16GSA 4TR1A 2QA2A 4KX4A 4HEA2 4KDUA 5CREA 2RM5A 2MZCA 1TOFA 2YJHA 4AS3A 2A4VA 3PPUA 1FO5A 4DVCA 1ZYPA 5DJMA 3VWVA 1ERUA 2B1LA 4ZBDA 4XRDA 3LJ0A 3VPTA 4EDYA 1K3YA 4FYBA 4GSNA 5FT3A 3Q8DA 5H5SA 2P31A 1XW9A 4TXOA 2R6KA 2R0PA 2H73A 3DKSA 4L8EA 1F3BA
chains in the Genus database with same CATH topology
3EYTA 2YPMA 4K0NA 4MCUA 3A2WA 2GTUA 3QPMA 3D5JA 4YZDA 1V58A 3ZIJA 4G19A 3D6IA 5AN1A 2VCZA 1X9MB 3D4MA 3UOMA 4KSMA 3M9JA 3FMWA 1HNBA 2JACA 5CNWA 1M2AA 1WJKA 4WETA 2VCXA 4OCEA 4EC0A 2VD0A 2H30A 5CRGA 1TRUA 4PGTA 1PD21 2LTKA 2H1BA 4L5LA 2DIYA 3E9JB 3HYPA 4K8MA 4N11A 4X1UA 1WOUA 1WMJA 3ZYWA 2GGTA 1G7OA 3QAWA 4NAXA 4QQ7A 3LJRA 3ERGA 3HJMA 1CQHA 2H1GA 5C04A 2L4QA 4G2EA 2L57A 2LUSA 4IVFA 1Z7RA 3ZRDA 3CRTA 4WF5A 1ZL9A 4JR4A 3OR5A 4IQ1A 5KOWA 1GUKA 4EF0A 2NBSA 2WDUA 1TW9A 1PQNA 5HR0A 1YF0A 3P8WA 3GURA 3QMXA 2EC4A 3MSZA 4WXTA 3PR8A 5LD0A 2L1LB 4F82A 1YKAA 1U3IA 1TDIA 4ZBAA 2CZ2A 3TUEA 1SL1B 2WZ9A 4JEDA 2WJUA 1E2YA 3SBCA 1ST9A 3R3EA 3KGKA 2A2CA 1OE7A 5IMZA 3IAS1 1AAZA 4EE0A 1QXHA 2VUPA 1JZWA 1A2JA 1B4PA 4GWRA 4YQVA 3H1NA 3ZITA 4ZILA 3QOUA 2F9SA 1B9XC 2K19A 2B7KA 3CTFA 2IMFA 3TJGA 4HZ2A 3KMOA 2JSYA 1FW1A 3LEFA 2QKEA 3ZMLA 2R4VA 4K2DA 1EWXA 3FY7A 1UN2A 2IN3A 2VL9A 1H4OA 4IW9A 2DMMA 4GQFA 1NM3A 4IP6A 1MDIA 1BQ7A 3HJOA 5CYYA 1PN0A 5LNK1 2GQMA 3FR9A 4K2XA 1MDKA 1Z3EA 4OAUC 1K0OA 3EU3A 1QFNA 3UAPA 4ECIA 2CVDA 2VL3A 4P3YB 4O1PA 3IV4A 4MA9A 1FOHA 4RQXA 3RBTA 4KCEA 3DXBA 2IFQB 4GLTA 5CO3A 5KEJA 5KN3A 5ECNB 2CAZB 3BD2A 2A2DA 1HNCA 1ZCPA 3O76A 3SDJA 3VLNA 1ACVA 1JLVA 4XS4B 1BJXA 1F6MC 2C0GA 3LORA 2V6KA 1TXXA 1EP8A 1EEJA 3IA1A 3ZL5A 3P90A 5DCGA 5CP1A 3TGZA 3HVVA 1PA3A 3EC3A 1R5AA 2J9HA 5G5EA 2HLSA 2X8CA 2CVKA 2FWHA 2WULA 5DAKB 3TJBA 1GTIA 2HZEB 4NHZA 1SL2B 4TRXA 2REMA 4PL3A 3IBHA 2AB6A 2XBIA 3TKSC 3CBUA 1QGVA 4TR1B 2H66A 1YO7A 2F6MB 2YWMA 2H1AA 1OYJA 2IL3A 5ECLB 3KZQA 3VWUA 3IHGA 4JBBA 3GUSA 1ZYEA 2DIZA 1SJZA 4MZBA 5EPFA 2L4CA 4HFVA 4HOJA 4YH2A 4O5RA 3APOA 2QC7A 4WBJA 4ZL7A 3G7YA 3S9FA 4TXOB 4D73A 2V2GA 4HS1A 4MLYA 2YCDA 5J3RA 3IAM2 3CMIA 2WFCA 2L6DA 5ECIB 4AJ8A 4O7HA 2YNXA 2HNLA 2V6OA 4MABA 4YAVA 2H6ZA 4OD7A 1M7TA 2JZRA 3F4MA 1XXUA 5IOWA 3KEBA 2X8GA 4OFNA 5DCHA 2OKAA 1O73A 1KNGA 2H71A 4FQUA 3HHVA 4EO3A 1BAYA 5F07A 2YZHA 4EL1A 3SWLA 2GT5A 3GX0A 2VCQA 1X0RA 4NMUA 2PERA 2ZNMA 3TB2A 3KP8A 2XTRA 1NHOA 2CT6A 1U88A 3IRAA 2HZFA 1V9WA 2PGTA 4N30A 3KCMA 3C71A 2VL2C 5G1LA 1S3CA 3NZNA 4KDXA 3BCIA 4AGSA 4YKGA 5E59A 3NOFA 1HNAA 1WP0A 2B6MA 3DEXA 4WR5A 2PBJA 1O81A 3H4KA 1ERTA 4IELA 3CXGA 4IBPA 2ZRRA 2B5XA 5D93A 1GNWA 2MBTA 3G7JA 4I5QA 2CX3A 4J56E 1WWJA 2H70A 5EL8A 4XTSA 1V2AA 3HZ8A 2VLVA 2HT9A 2R5GA 5IOXA 4O5QA 1A8LA 4IJIA 1VF3A 2J23A 3UITA 1JLWA 3D4TA 1X5DA 4PQIA 1T4ZA 5F05A 5G1KA 1JZDA 3L9UA 4ML6A 3LWAA 4RI6A 4WKWA 1ERWA 2A2RA 3MDKA 4MPGA 5AISA 3AY8A 4L0WA 1RW1A 1XWBA 3FKFA 2CX4A 3ME7A 2F8AA 2HRKA 2E2MA 4CHSA 2IMEA 3HZ4A 5HR3A 1USBA 1Z7PA 2VLUA 3IR4A 3U6VA 4FH8A 1TK0B 5ECSA 3HDCA 3IPZA 3M8NA 1A24A 1M2DA 2E7PA 2G0FA 1TRSA 2MMAA 20GSA 1JZRA 3M9KA 1KTEA 2OE3A 4LL4B 3VI5A 4HZ4A 3FZ4A 3UEMA 4NXIA 5HQPA 1ML6A 5IPHA 3LJ1A 2LS5A 1SJ8A 3DMLA 1SK2A 4MF7A 3RHBA 4O92A 1GUHA 4WEYA 1EZKA 1K0BA 4AF2A 1GH2A 4KF9A 1GLPA 4LLRA 4OO5A 2LNSA 5IQYA 2ZCTA 5J5NA 3C7MA 2CV4A 1W89A 5B8AA 2L59A 2VAFA 2B7JA 3L0IA 2IP6A 2GLRA 4N10A 2FNOA 3HVSA 5ECQB 3CYNA 3FK8A 4POBA 3UIWA 4TOPA 3NIVA 1E6BA 2RM6A 1PN9A 1M9BA 2KLXA 2KOKA 4MPFA 4OMVA 1T1VA 4GSSA 3QR6A 2H19A 3IOSA 4LMWA 4JZQA 4EUYA 5A4UA 3EE2A 1AQWA 5FWGA 4OO4A 2IJYA 1K3LA 2O87A 4Q5QA 3RDWA 2FUG1 1SU9A 1XWCA 4HEA1 5CRDA 1EGRA 2A2SA 2LJKA 2LRNA 5J41A 2C8UA 5D9TA 1GUMA 3L0HA 2K8SA 5HGIA 4I97A 1U6TA 2LRCA 4YZ9A 4MJCA 4XRAA 1K0NA 1KEBA 4FO5A 3UVTA 1R26A 3HJPA 1WE0A 3DIEA 2FUG2 4Q5NA 5IMVA 4KGIA 2GSSA 4G76A 1FVKA 5FHIA 4NHWA 3I6AA 2DMLA 4ACSA 3UVHA 2ON5A 1SKRB 4PXOA 1XW5A 2R37A 4PNFA 1AC1A 4BL7A 5LNKe 4KSOA 2F8FA 2FLSA 4G0IA 4IKHA 2AV4A 1OE8A 3LFLA 5DALB 1X9WB 10GSA 4K7IA 4KA0A 3L78A 3HKRA 2XMXA 1Q98A 3A2XA 2H0HA 2C0FA 2JSZA 1EGOA 2P5RA 3TOUA 14GSA 2GT6A 2IMIA 5H5RA 2EIQA 2VD1A 2DJ1A 3ERFA 5IPGA 2E8GA 5GZZB 3ZZXA 4V2MA 4KNDA 3APQA 1OKDA 1XBSA 5GAPD 2IIYA 3HCZA 2WB9A 2YJ7A 4DSSA 2H8LA 2N5BA 3ERWA 3FYGA 1GSSA 3M3MA 2B3SA 4G75A 2WGRA 1Q4JA 3AJFA 2H01A 5HFIA 4J2FA 1GP1A 3MIXA 3RHCA 4Z2TA 1MD4A 1TI3A 3DWVA 4I2UA 1F9MA 3F63A 1W4VA 3GKNA 2B1KA 3J7Yb 5IO2A 1AIUA 4HI7A 1U5KA 2AJQB 2PVQA 1JHBA 1SENA 2F3MA 19GSA 5D8IA 1GLQA 2D2ZA 1VF1A 2FA4A 2C0EA 3U5RE 3A2VA 1Z6NA 4BVYA 2DLXA 1I9DA 3MAKA 3QCPA 2H74A 1QQ2A 1VF4A 2N5FA 5G30A 4KUNA 1YEPA 4OCFA 2JB3A 2FWGA 2BMXA 4OFTA 5L71A 4TR3A 3N9JA 2OBKA 3EWLA 3V1WA 2X99A 1TK5B 3MNGA 3TDGA 5HR1A 2NVLA 1TRWA 4OWYA 2YP6A 1EP7A 2F66B 4IHUA 5DJLA 4XIHA 3F4RA 4MJBA 1I5GA 2M46A 5AIXA 1T4YA 2TRXA 3M1GA 2Z9SA 4I2TA 5JCWA 6GSSA 1FOVA 3L9VA 3VI7A 5D9VA 4TVEA 1ILOA 2FWFA 3GKXA 3ZFLA 4MF6A 3APSA 3L4NA 3UL3A 5KN0A 2HSMA 4MZWA 2JZTA 3LXZA 3ME8A 4I8BA 1YZXA 1ABAA 2X64A 5D96A 3GN3A 3I9V1 4IGJA 1XOBA 3RAZA 2ALBA 3N5OA 3I43A 1AUCA 2H76A 1RK4A 3DVXA 1X5CA 2XTQA 2VM1A 4PX1A 2HE3A 4BVXA 4OAVB 4YZCA 5COHA 4Z7HA 3IC8A 2PWJA 5C00A 1ZGNA 4JCVE 3LG6A 1GRXA 4HUAA 2H0IA 2I1UA 2HRAA 2KP2A 4Z2RA 3ZFBA 1CQGA 1GTAA 2JU5A 4XCSA 1XVQA 3P7XA 5JWOB 2IMKA 3P2AA 2YN1A 2KP1A 1ERVA 3I9V2 1Y6EA 4HJMA 4EIQA 2GDRA 1A0FA 2BTOT 3CSIA 3W8SA 1B48A 3F3RA 1OC9B 4DEJA 2LV3A 3FBVA 4WF4A 2FHEA 3FZ5A 2LEGA 2XPEA 2ON7A 5JCGA 5F0GA 5BRTA 3LGCA 1NW2A 4JE1A 1UVZA 2GSRA 1AXDA 4I6XA 1FB6A 4ZXGA 4MDCA 4NV2A 5CRWA 3KTLA 1QUWA 3TKRA 3DD3A 1SK1A 3FHKA 1FAAA 2VM2A 2MMNA 3GH6A 2PUKC 2VIMA 4JU5A 3D21A 3D22A 3DO9A 2C0DA 3TCOA 3IAM1 1ZZYA 2HXKA 3GH9A 4BL7B 2ES7A 5G5FA 1PMTA 4F0BA 3VK9A 2I9HA 3ZIVA 1J9BA 2GZPA 4DSRA 3EMXA 2OE0A 1M99A 2NDOA 2L5OA 5IIZA 2GZYA 2FY6A 3F3QA 1XW6A 2G2QA 1DSBA 1ON4A 2X4AA 2ZUPA 5ENUA 3GL5A 2E2GA 2K9FA 2M72A 3IC4A 3GIXA 3C1SA 3GSTA 4RI7A 3BOAA 2C1YA 4AS2A 1AQXA 3GTUA 4DSSB 1HD2A 1M0UA 1XFLA 1T8EB 4TR0A 1TU7A 5GSSA 2VCWA 4GXTA 1GWCA 4RQRA 1XWKA 2LJRA 3VFIA 4HQSA 1XIYA 1A2LA 1SYXA 2GSTA 1BX9A 1F2EA 3EVIA 1FVJA 1SD8A 3DGQA 3QAVA 2IWTA 1PGTA 1URMA 1EOHA 3O6TA 3UMAA 4PTSA 1G0TA 2FGXA 4Z7XA 1DE1A 3Q6OA 1U87A 4A5PA 4CW9A 2EIOA 5GSTA 5J4UA 3VWXA 2OBIA 5J9BA 1RQMA 2MJFB 2O8VB 1PX7A 1O6JA 3FW2A 2RLIA 3KJYA 1EEMA 3J7Yk 1TK8B 1G6WA 2YFAA 4AJ6A 3UBKA 1PL2A 4PL4A 4HU7A 3LSZA 4PL5A 1SKSB 4MNNA 4X4JA 2WRTA 5BMUA 4EIPA 3VPQA 4F9ZA 2V1MA 4CY6A 3KXOA 2YWOA 18GSA 2PU9C 3UJ1A 2CVBA 1ZYQB 7GSSA 1O8XA 4MH3A 5IMDA 2E0QA 3TKSE 3DA4A 5D73A 3M0FA 3WGEA 4DSQA 2RIOA 2AYTA 1EV4A 2LNTA 1IYHA 3F6DA 2LJAA 5D9XA 1S3AA 4PQHA 3E3EA 5ECOB 4V1Ag 1R4WA 5ID2A 4I1TA 3I69A 2X8HA 1HYUA 5G2ZA 1V57A 2AHEA 4XS1A 4ZL9A 4POMA 1B4QA 5KN2A 2N5AA 2RUFA 2DBCA 6GSXA 1M2BA 2WS2A 4ILFA 4ZIJA 1XWAA 4MH2A 4F2IA 1S3DA 2GQKA 1KBNA 4K1FA 5HFKA 4ZB8A 2QSIA 2CZ3A 3GMFA 2JL4A 3A3TA 2TIRA 5AIVA 3GKKA 3EURA 2TRCP 1UA5A 3WT1A 8GSSA 1LU4A 3KH9A 5B6MA 3QDNA 1MTCA 2HSHA 4ID0A 1K0CA 2CAIA 1AQVA 1ZMAA 2AAWA 2C3NA 4O32A 4O5UA 2VOCA 3F8UA 2H1DA 4K0GA 2JB2A 4KDYA 5GAND 2QA1A 1FHEA 3FR6A 2P22B 4NWYA 4YQUA 4FYUA 2NPBA 2DJ3A 4XS4A 4HQZA 2LKUA 1NHYA 5F8BA 4RUVA 4QL9A 2XBQA 5EVOA 2X49A 4PUFC 2P0GA 3P23A 2VO4A 5F06A 4ECCA 5D9WA 4POLA 3WD6A 3IXRA 2LQQA 4L0UA 2RIIA 3FEUA 4D73B 2HZEA 2NTOA 1XWGA 3F4TA 2QGVA 4LMVA 6GSVA 1TI1A 2FA8A 3GKMA 4F03A 1WIKA 1YKCA 1ZYNA 3TJFA 3JCML 3GTUB 3LQ7A 3TRXA 5H5QA 4GSTA 1PX6A 4BA7A 3UARA 1U3AA 1TKDB 4KE3A 4E8EA 1K0MA 3Q74A 1UC7A 5DVBA 3QFBC 2PN8A 4EKZA 2GS3A 2IPAA 4ICYA 1BYEA 1TP9A 4G10A 3LJ2A 4FYCA 2DJJA 1TJDA 1YY7A 4GQCA 1THOA 3TKSA 2OE1A 2DKHA 4KW6A 2VCVA 3FZ9A 2MYGA 9GSSA 1SL0B 2A2PA 1X5EA 2OACA 4CY8A 3Q18A 2JB1A 3GX8A 3C1RA 3C73A 2R3XA 2FD3A 1NSWA 2HYXA 1A0RP 3TKQA 2XC2A 5HR2A 4ZB9A 1Z9HA 5DQYA 4USSA 3H79A 4PNGA 5ECRB 1FG4A 2JZSA 1H75A 3PGTA 1XVWA 1C72A 5LCZA 1R5PA 3EPTA 4FIWA 1V98A 3FR3A 1O85A 1G6YA 1XPVA 3KMNA 1DE2A 1T3BA 2YOIA 1EV9A 1GSDA 1TTZA 4F0CA 2UZ8A 4HJ2A 3WYWA 1SJ6A 3R2QA 4G9HA 3CTGA 1Y25A 1YF1A 2OJLA 3F0IA 1PL1A 3F9UA 2JAEA 2A4HA 2R2JA 3G9BA 2DJ2A 1O8WA 2YZUA 3F6FA 4Z2UA 5E4WA 3ZVJD 2I81A 3QFAC 4ZBBA 1SD9A 2JADA 3IK9A 3F4SA 4GCIA 2FWEA 3HXSA 2VL2A 3ED3A 1F3AA 2C80A 2HRFA 5ID2B 2XPDA 1X9SB 4IJ3A 1XOAA 1TU8A 3BBYA 2C3QA 2HI7A 1OKTA 4TR4A 3W8JA 3ZLPA 4Q5RA 5IMCA 5B7CA 2R0GA 3LYPA 12GSA 4ZL8A 3IHQA 6GSYA 2K18A 22GSA 5HFGA 4ECBA 3IAS2 1SJIA 1V40A 4K6XA 1LBKA 4DWLA 1BEDA 5ECPB 2PMTA 4CDOA 5ECKB 3CRUA 2HRNA 5EY6A 4Q5FA 3GL3A 1XCCA 5J9CA 4G0KA 4IN0A 5ECMB 1THXA 4WBRD 4MF5A 1WRYA 1YJ6A 3TRPA 1K0AA 3HY2A 5AGYA 1B9YC 5B8BA 1GNEA 1HQOA 2O7KA 2YFBA 4Q9VA 1Z5YE 3A5WA 4EVMA 3BJ5A 4HU9A 2M80A 4O1OA 5JWQB 4WR4A 4N0ZA 1YQ1A 4KAEA 4XHMA 1A23A 2XHFA 2VCTA 5B6NA 5ECHB 3JSBA 4PQ1A 1OAZA 4GF0A 1T00A 3ZMKA 1WPIA 2P5QA 3GYKA 4NPBA 2H6YA 3DA3A 3ISOA 4BWQA 2GZZA 2PVOC 3HVXA 4GRFA 2MMZA 5G31A 4PURA 3UBLA 5A4WA 2CAQA 17GSA 3Q19A 3MYDA 1PKWA 3LW9A 2EIRA 3KIJA 1QK8A 2KHPA 3D0ZA 4G0LA 1GSYA 4BPYA 3LYKA 3MWHA 2AUVA 4E8HA 1ZOFA 2L5LA 4JRRA 3VWWA 1BG5A 4JR6A 2LRTA 4X0XA 1OVNA 3US3A 1GL8A 3TJKA 1K0DA 2YWIA 1W3SA 2DJKA 3HD5A 4KB3A 1VRSD 3KM6A 2H6XA 4LA1A 1SK0A 3IDVA 5JWRB 1EOGA 1GSUA 1R7HA 3GSSA 4KH7A 2V41A 3CSJA 4X43A 1SKWB 3GV1A 3K8NA 3VURA 2C4JA 3WGDA 1N2AA 2KKMA 2C3TA 3VA9A 1B8XA 5DALA 2B5EA 1J0FA 3TKPA 2GSQA 1PKZA 5CRHA 4TW5A 1QMVA 1VGLA 2O89A 1GTBA 1N8JA 3KP9A 4V2LA 4MP4A 4MK3A 4POKA 3WGXA 4MMMA 3HA9A 1A2MA 3GHAA 4TKYA 3ZTLA 4BVYB 2MBSA 1JZOA 3E0UA 4H86A 4AJ7A 6GSWA 1GSQA 1DBYA 4K7OA 3FRCA 1M9AA 2YWNA 2YV7A 5ABRA 2PPTA 2I3YA 2KUCA 3ZVJA 4IS0A 4V2NA 4YKFA 1YDKA 1GTUA 4ZB6A 2RUEA 3TRQA 5ELGA 1PRXA 2GQLA 2F51A 1Z6MA 5KN1A 5DDLA 3C8EA 4L5OA 3GNJA 4HDEA 3KTBA 4TXVA 5KOXA 1SYRA 1F37A 2V1CC 3KD0A 4ISDA 5CAXA 1GSEA 4N0VA 2BJXA 5INYA 4TN8A 3QD9A 2YV9A 2DKIA 2WCIA 3WT2A 3PH9A 11GSA 5IMAA 2V32A 3BCKA 3H8QA 1J08A 1GULA 4K5RA 4ULXA 1IYIA 3DYRA 2MMOA 2VLTA 3IE3A 3DRNA 5DBQA 2DC5A 3RPNA 3L9SA 3LXTA 5DQSA 3KH7A 2I4AA 2K6VA 4U6RA 3IK7A 2K8VA 1MD3A 4K5SA 2LSTA 4NV5A 4Z7GA 4BVXB 3CSHA 6GSUA 1DUGA 3EMPA 2OA7A 5IO0A 13GSA 1XZOA 4V1Ap 2DSAA 2DJ0A 3GRXA 1OC8A 4YQMA 4K7NA 1MDJA 2L6CA 4GXZA 3W6GA 4EXJA 6GSTA 3G7IA 5ELAA 4YAPA 2HFDA 5IM9A 2H75A 2HSYA 4IP1A 4KCAA 5A4VA 3EINA 4MJEA 2YANA 1PSQA 4GTUA 2OADA 3H93A 3TOTA 4XS6A 4BWSA 4K9ZA 3RPPA 1YEXA 2H72A 4ML1A 2H0GA 4OFMA 4ECJA 3GA4A 4MZCA 3EU4A 1G7EA 3DVWA 5IMFA 2CQ9A 3PINA 4LL1B 1TRVA 4PUAA 2IFQA 2IMDA 5JCUA 2GVPA 3FZAA 3O3TA 4QL7A 1T7PB 4MJAA 2CA8A 1A8YA 1OC9A 3ZREA 3QAGA 2R0CA 3TJJA 2O85A 1VF2A 4IQAA 4J57E 5A5KA 2LQOA 1OC3A 2B5YA 1FB0A 4EDZA 1AW9A 1MEKA 2FCHA 5DAKA 1GSFA 1K3OA 3GFKA 1LJRA 3A5IA 1JFUA 1O7UA 2V6EA 16GSA 4TR1A 2QA2A 4KX4A 4HEA2 4KDUA 5CREA 2RM5A 2MZCA 1TOFA 2YJHA 4AS3A 2A4VA 3PPUA 1FO5A 4DVCA 1ZYPA 5DJMA 3VWVA 1ERUA 2B1LA 4ZBDA 4XRDA 3LJ0A 3VPTA 4EDYA 1K3YA 4FYBA 4GSNA 5FT3A 3Q8DA 5H5SA 2P31A 1XW9A 4TXOA 2R6KA 2R0PA 2H73A 3DKSA 4L8EA 1F3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EYT A;  2YPM A;  4K0N A;  4MCU A;  3A2W A;  2GTU A;  3QPM A;  3D5J A;  1V58 A;  3ZIJ A;  4G19 A;  3D6I A;  5AN1 A;  2VCZ A;  1X9M B;  3D4M A;  3UOM A;  4KSM A;  3M9J A;  1HNB A;  2JAC A;  5CNW A;  1M2A A;  1WJK A;  4WET A;  2VCX A;  4OCE A;  4EC0 A;  2VD0 A;  2H30 A;  5CRG A;  1TRU A;  4PGT A;  1PD2 1;  2LTK A;  2H1B A;  4L5L A;  2DIY A;  3E9J B;  3HYP A;  4K8M A;  4N11 A;  4X1U A;  1WOU A;  1WMJ A;  3ZYW A;  2GGT A;  1G7O A;  3QAW A;  4NAX A;  4QQ7 A;  3LJR A;  3ERG A;  3HJM A;  1CQH A;  2H1G A;  5C04 A;  2L4Q A;  4G2E A;  2L57 A;  2LUS A;  4IVF A;  1Z7R A;  3ZRD A;  3CRT A;  4WF5 A;  1ZL9 A;  4JR4 A;  3OR5 A;  4IQ1 A;  1GUK A;  4EF0 A;  2NBS A;  2WDU A;  1TW9 A;  1PQN A;  5HR0 A;  1YF0 A;  3P8W A;  3GUR A;  3QMX A;  2EC4 A;  3MSZ A;  4WXT A;  3PR8 A;  5LD0 A;  4F82 A;  1YKA A;  1U3I A;  1TDI A;  4ZBA A;  2CZ2 A;  3TUE A;  1SL1 B;  2WZ9 A;  4JED A;  2WJU A;  1E2Y A;  3SBC A;  1ST9 A;  3KGK A;  1OE7 A;  5IMZ A;  1AAZ A;  4EE0 A;  1QXH A;  2VUP A;  1JZW A;  1A2J A;  1B4P A;  4GWR A;  4YQV A;  3H1N A;  3ZIT A;  4ZIL A;  3QOU A;  2F9S A;  1B9X C;  2B7K A;  3CTF A;  2IMF A;  3TJG A;  4HZ2 A;  3KMO A;  2JSY A;  1FW1 A;  3LEF A;  2QKE A;  3ZML A;  2R4V A;  4K2D A;  1EWX A;  3FY7 A;  1UN2 A;  2IN3 A;  2VL9 A;  1H4O A;  4IW9 A;  2DMM A;  4GQF A;  1NM3 A;  1MDI A;  4IP6 A;  1BQ7 A;  3HJO A;  5CYY A;  2GQM A;  3FR9 A;  1MDK A;  1Z3E A;  1K0O A;  3EU3 A;  1QFN A;  3UAP A;  4ECI A;  2CVD A;  2VL3 A;  4P3Y B;  3IV4 A;  4MA9 A;  4RQX A;  3RBT A;  4KCE A;  3DXB A;  2IFQ B;  4GLT A;  5CO3 A;  5KEJ A;  5KN3 A;  5ECN B;  3BD2 A;  1HNC A;  1ZCP A;  3O76 A;  3VLN A;  1ACV A;  1JLV A;  4XS4 B;  1BJX A;  1F6M C;  2C0G A;  3LOR A;  2V6K A;  1TXX A;  1EP8 A;  1EEJ A;  3IA1 A;  3ZL5 A;  3P90 A;  5DCG A;  5CP1 A;  3TGZ A;  3HVV A;  1PA3 A;  1R5A A;  2J9H A;  3EC3 A;  5G5E A;  2HLS A;  2X8C A;  2CVK A;  2FWH A;  2WUL A;  5DAK B;  3TJB A;  1GTI A;  2HZE B;  4NHZ A;  1SL2 B;  4TRX A;  2REM A;  3IBH A;  2AB6 A;  2XBI A;  3TKS C;  3CBU A;  1QGV A;  4TR1 B;  2H66 A;  2YWM A;  2H1A A;  1OYJ A;  2IL3 A;  5ECL B;  3KZQ A;  3VWU A;  4JBB A;  3GUS A;  1ZYE A;  2DIZ A;  1SJZ A;  4MZB A;  5EPF A;  2L4C A;  4HOJ A;  4YH2 A;  4O5R A;  3APO A;  2QC7 A;  4WBJ A;  4ZL7 A;  3G7Y A;  3S9F A;  4TXO B;  4D73 A;  2V2G A;  4HS1 A;  4MLY A;  2YCD A;  5J3R A;  3IAM 2;  3CMI A;  2WFC A;  2L6D A;  5ECI B;  4AJ8 A;  4O7H A;  4YAV A;  2YNX A;  2HNL A;  2V6O A;  4MAB A;  2H6Z A;  4OD7 A;  1M7T A;  2JZR A;  1XXU A;  5IOW A;  3KEB A;  2X8G A;  4OFN A;  5DCH A;  2OKA A;  1O73 A;  1KNG A;  2H71 A;  3HHV A;  4EO3 A;  1BAY A;  5F07 A;  2YZH A;  4EL1 A;  3SWL A;  2GT5 A;  3GX0 A;  2VCQ A;  1X0R A;  4NMU A;  2PER A;  2ZNM A;  3TB2 A;  3KP8 A;  1NHO A;  2CT6 A;  1U88 A;  3IRA A;  2HZF A;  1V9W A;  2PGT A;  4N30 A;  3KCM A;  3C71 A;  2VL2 C;  5G1L A;  1S3C A;  3NZN A;  4KDX A;  3BCI A;  4AGS A;  5E59 A;  3NOF A;  1HNA A;  1WP0 A;  2B6M A;  3DEX A;  4WR5 A;  2PBJ A;  1O81 A;  3H4K A;  1ERT A;  4IEL A;  3CXG A;  4IBP A;  2B5X A;  5D93 A;  1GNW A;  2MBT A;  3G7J A;  4I5Q A;  2CX3 A;  4J56 E;  1WWJ A;  2H70 A;  5EL8 A;  4XTS A;  1V2A A;  3HZ8 A;  2VLV A;  2HT9 A;  2R5G A;  5IOX A;  1A8L A;  4IJI A;  1VF3 A;  2J23 A;  1JLW A;  3D4T A;  1X5D A;  4PQI A;  1T4Z A;  5F05 A;  5G1K A;  1JZD A;  3L9U A;  4ML6 A;  3LWA A;  4RI6 A;  4WKW A;  1ERW A;  2A2R A;  3MDK A;  4MPG A;  5AIS A;  3AY8 A;  4L0W A;  1RW1 A;  1XWB A;  3FKF A;  2CX4 A;  3ME7 A;  2F8A A;  2E2M A;  4CHS A;  2IME A;  3HZ4 A;  5HR3 A;  1USB A;  1Z7P A;  2VLU A;  3IR4 A;  3U6V A;  4FH8 A;  1TK0 B;  5ECS A;  3HDC A;  3IPZ A;  3M8N A;  1A24 A;  1M2D A;  2E7P A;  2G0F A;  1TRS A;  2MMA A;  20GS A;  1JZR A;  3M9K A;  1KTE A;  2OE3 A;  4LL4 B;  3VI5 A;  4HZ4 A;  3FZ4 A;  3UEM A;  4NXI A;  5HQP A;  1ML6 A;  5IPH A;  2LS5 A;  3DML A;  1SK2 A;  4MF7 A;  3RHB A;  4O92 A;  1GUH A;  4WEY A;  1EZK A;  1K0B A;  4AF2 A;  1GH2 A;  1GLP A;  4LLR A;  4OO5 A;  2LNS A;  5IQY A;  2ZCT A;  5J5N A;  3C7M A;  2CV4 A;  1W89 A;  5B8A A;  2L59 A;  2VAF A;  2B7J A;  2GLR A;  4N10 A;  2FNO A;  3HVS A;  5ECQ B;  3CYN A;  3FK8 A;  4POB A;  3UIW A;  4TOP A;  3NIV A;  1E6B A;  2RM6 A;  1PN9 A;  1M9B A;  2KLX A;  2KOK A;  4MPF A;  4OMV A;  1T1V A;  4GSS A;  3QR6 A;  2H19 A;  3IOS A;  4LMW A;  4JZQ A;  4EUY A;  5A4U A;  3EE2 A;  1AQW A;  5FWG A;  4OO4 A;  2IJY A;  1K3L A;  2O87 A;  4Q5Q A;  3RDW A;  1SU9 A;  1XWC A;  5CRD A;  1EGR A;  2A2S A;  2LJK A;  2LRN A;  5J41 A;  2C8U A;  5D9T A;  1GUM A;  3L0H A;  2K8S A;  4I97 A;  1U6T A;  2LRC A;  4MJC A;  4XRA A;  1K0N A;  1KEB A;  4FO5 A;  3UVT A;  1R26 A;  3HJP A;  1WE0 A;  3DIE A;  2FUG 2;  4Q5N A;  5IMV A;  4KGI A;  2GSS A;  1FVK A;  5FHI A;  4NHW A;  3I6A A;  2DML A;  4ACS A;  3UVH A;  2ON5 A;  1SKR B;  4PXO A;  1XW5 A;  2R37 A;  4PNF A;  1AC1 A;  4BL7 A;  5LNK e;  4KSO A;  2F8F A;  2FLS A;  4IKH A;  2AV4 A;  1OE8 A;  3LFL A;  5DAL B;  1X9W B;  10GS A;  4K7I A;  4KA0 A;  3L78 A;  3HKR A;  1Q98 A;  3A2X A;  2H0H A;  2C0F A;  2JSZ A;  1EGO A;  2P5R A;  3TOU A;  14GS A;  2GT6 A;  2IMI A;  5H5R A;  2EIQ A;  2VD1 A;  2DJ1 A;  3ERF A;  5IPG A;  5GZZ B;  3ZZX A;  4V2M A;  4KND A;  3APQ A;  1OKD A;  1XBS A;  5GAP D;  2IIY A;  3HCZ A;  2WB9 A;  2YJ7 A;  4DSS A;  2H8L A;  2N5B A;  3ERW A;  3FYG A;  1GSS A;  3M3M A;  2B3S A;  2WGR A;  1Q4J A;  2H01 A;  5HFI A;  4J2F A;  1GP1 A;  3RHC A;  1MD4 A;  1TI3 A;  3DWV A;  4I2U A;  1F9M A;  3F63 A;  1W4V A;  3GKN A;  2B1K A;  3J7Y b;  5IO2 A;  1AIU A;  4HI7 A;  2AJQ B;  2PVQ A;  1JHB A;  1SEN A;  2F3M A;  19GS A;  5D8I A;  1GLQ A;  2D2Z A;  1VF1 A;  2FA4 A;  2C0E A;  3U5R E;  3A2V A;  1Z6N A;  4BVY A;  2DLX A;  1I9D A;  3MAK A;  3QCP A;  2H74 A;  1QQ2 A;  1VF4 A;  2N5F A;  5G30 A;  4KUN A;  1YEP A;  4OCF A;  2FWG A;  2BMX A;  4OFT A;  5L71 A;  4TR3 A;  3N9J A;  2OBK A;  3EWL A;  3V1W A;  2X99 A;  1TK5 B;  3MNG A;  3TDG A;  5HR1 A;  2NVL A;  1TRW A;  2YP6 A;  1EP7 A;  4OWY A;  4IHU A;  5DJL A;  4XIH A;  3F4R A;  4MJB A;  1I5G A;  2M46 A;  5AIX A;  1T4Y A;  2TRX A;  3M1G A;  2Z9S A;  4I2T A;  5JCW A;  6GSS A;  1FOV A;  3L9V A;  3VI7 A;  5D9V A;  4TVE A;  1ILO A;  2FWF A;  3GKX A;  3ZFL A;  4MF6 A;  3APS A;  3L4N A;  3UL3 A;  5KN0 A;  4MZW A;  2JZT A;  3LXZ A;  3ME8 A;  4I8B A;  1YZX A;  1ABA A;  2X64 A;  5D96 A;  3GN3 A;  4IGJ A;  1XOB A;  3RAZ A;  2ALB A;  3N5O A;  3I43 A;  1AUC A;  2H76 A;  1RK4 A;  3DVX A;  1X5C A;  2VM1 A;  4PX1 A;  2HE3 A;  4BVX A;  5COH A;  2PWJ A;  5C00 A;  1ZGN A;  3LG6 A;  1GRX A;  4HUA A;  2H0I A;  2I1U A;  2KP2 A;  3ZFB A;  1CQG A;  1GTA A;  2JU5 A;  4XCS A;  1XVQ A;  3P7X A;  5JWO B;  2IMK A;  3P2A A;  2YN1 A;  2KP1 A;  1ERV A;  3I9V 2;  1Y6E A;  4HJM A;  2GDR A;  1A0F A;  2BTO T;  3CSI A;  3W8S A;  1B48 A;  3F3R A;  1OC9 B;  4DEJ A;  2LV3 A;  4WF4 A;  2FHE A;  3FZ5 A;  2LEG A;  2XPE A;  2ON7 A;  5JCG A;  5F0G A;  3LGC A;  1NW2 A;  4JE1 A;  1UVZ A;  2GSR A;  1AXD A;  4I6X A;  1FB6 A;  4ZXG A;  4MDC A;  4NV2 A;  5CRW A;  3KTL A;  1QUW A;  3TKR A;  3DD3 A;  1SK1 A;  3FHK A;  1FAA A;  2VM2 A;  2MMN A;  3GH6 A;  2PUK C;  2VIM A;  4JU5 A;  3D21 A;  3D22 A;  2C0D A;  3TCO A;  1ZZY A;  2HXK A;  3GH9 A;  2ES7 A;  5G5F A;  1PMT A;  4F0B A;  3VK9 A;  2I9H A;  3ZIV A;  1J9B A;  2GZP A;  4DSR A;  3EMX A;  2OE0 A;  1M99 A;  2NDO A;  2L5O A;  5IIZ A;  2GZY A;  2FY6 A;  3F3Q A;  1XW6 A;  2G2Q A;  1DSB A;  1ON4 A;  2ZUP A;  5ENU A;  3GL5 A;  2E2G A;  2K9F A;  2M72 A;  3IC4 A;  3GIX A;  3C1S A;  3GST A;  4RI7 A;  3BOA A;  2C1Y A;  4DSS B;  1AQX A;  3GTU A;  1HD2 A;  1M0U A;  1XFL A;  1T8E B;  4TR0 A;  1TU7 A;  5GSS A;  2VCW A;  1GWC A;  4RQR A;  1XWK A;  2LJR A;  3VFI A;  4HQS A;  1XIY A;  1A2L A;  1SYX A;  2GST A;  1BX9 A;  1F2E A;  3EVI A;  1FVJ A;  1SD8 A;  3DGQ A;  3QAV A;  2IWT A;  1PGT A;  1URM A;  1EOH A;  3O6T A;  3UMA A;  1G0T A;  2FGX A;  4Z7X A;  1DE1 A;  3Q6O A;  1U87 A;  4CW9 A;  2EIO A;  5GST A;  5J4U A;  3VWX A;  2OBI A;  5J9B A;  1RQM A;  2O8V B;  1PX7 A;  1O6J A;  3FW2 A;  2RLI A;  3KJY A;  1EEM A;  3J7Y k;  1TK8 B;  1G6W A;  4AJ6 A;  3UBK A;  1PL2 A;  4HU7 A;  3LSZ A;  1SKS B;  2WRT A;  3VPQ A;  4F9Z A;  2V1M A;  3KXO A;  2YWO A;  18GS A;  2PU9 C;  3UJ1 A;  2CVB A;  1ZYQ B;  7GSS A;  1O8X A;  4MH3 A;  5IMD A;  2E0Q A;  3TKS E;  5D73 A;  3M0F A;  3WGE A;  4DSQ A;  2AYT A;  1EV4 A;  2LNT A;  1IYH A;  3F6D A;  2LJA A;  5D9X A;  1S3A A;  4PQH A;  3E3E A;  5ECO B;  4V1A g;  1R4W A;  5ID2 A;  3I69 A;  2X8H A;  1HYU A;  5G2Z A;  1V57 A;  2AHE A;  4XS1 A;  4ZL9 A;  4POM A;  1B4Q A;  5KN2 A;  2N5A A;  2RUF A;  2DBC A;  6GSX A;  1M2B A;  2WS2 A;  4ILF A;  4ZIJ A;  1XWA A;  4MH2 A;  4F2I A;  1S3D A;  2GQK A;  1KBN A;  4K1F A;  5HFK A;  4ZB8 A;  2QSI A;  2CZ3 A;  3GMF A;  2JL4 A;  3A3T A;  2TIR A;  5AIV A;  3GKK A;  3EUR A;  2TRC P;  1UA5 A;  3WT1 A;  8GSS A;  1LU4 A;  3KH9 A;  5B6M A;  3QDN A;  1MTC A;  2HSH A;  4ID0 A;  1K0C A;  2CAI A;  1AQV A;  1ZMA A;  2AAW A;  2C3N A;  4O32 A;  2VOC A;  3F8U A;  2H1D A;  4K0G A;  4KDY A;  5GAN D;  1FHE A;  3FR6 A;  4NWY A;  4YQU A;  4FYU A;  2NPB A;  2DJ3 A;  4XS4 A;  4HQZ A;  2LKU A;  1NHY A;  5F8B A;  4RUV A;  4QL9 A;  2XBQ A;  5EVO A;  4PUF C;  2P0G A;  2VO4 A;  5F06 A;  4ECC A;  5D9W A;  4POL A;  3WD6 A;  3IXR A;  2LQQ A;  4L0U A;  2RII A;  3FEU A;  4D73 B;  2HZE A;  2NTO A;  1XWG A;  3F4T A;  2QGV A;  4LMV A;  6GSV A;  1TI1 A;  2FA8 A;  3GKM A;  4F03 A;  1WIK A;  1YKC A;  3TJF A;  3JCM L;  3GTU B;  3LQ7 A;  3TRX A;  5H5Q A;  4GST A;  1PX6 A;  4BA7 A;  3UAR A;  1U3A A;  1TKD B;  4KE3 A;  4E8E A;  1K0M A;  3Q74 A;  1UC7 A;  5DVB A;  3QFB C;  2PN8 A;  4EKZ A;  2GS3 A;  2IPA A;  1BYE A;  1TP9 A;  4G10 A;  4FYC A;  2DJJ A;  1TJD A;  1YY7 A;  4GQC A;  1THO A;  3TKS A;  2OE1 A;  4KW6 A;  2VCV A;  3FZ9 A;  2MYG A;  9GSS A;  1SL0 B;  1X5E A;  2OAC A;  3Q18 A;  3GX8 A;  3C1R A;  3C73 A;  2R3X A;  2FD3 A;  1NSW A;  2HYX A;  1A0R P;  3TKQ A;  2XC2 A;  5HR2 A;  4ZB9 A;  1Z9H A;  5DQY A;  3H79 A;  4PNG A;  5ECR B;  1FG4 A;  2JZS A;  1H75 A;  3PGT A;  1XVW A;  1C72 A;  5LCZ A;  1R5P A;  4FIW A;  1V98 A;  3FR3 A;  1O85 A;  1G6Y A;  1XPV A;  3KMN A;  1DE2 A;  1T3B A;  2YOI A;  1EV9 A;  1GSD A;  1TTZ A;  4F0C A;  4HJ2 A;  3WYW A;  1SJ6 A;  3R2Q A;  4G9H A;  3CTG A;  1Y25 A;  1YF1 A;  2OJL A;  3F0I A;  1PL1 A;  3F9U A;  2R2J A;  3G9B A;  2DJ2 A;  1O8W A;  2YZU A;  3F6F A;  5E4W A;  3ZVJ D;  2I81 A;  3QFA C;  4ZBB A;  1SD9 A;  2JAD A;  3IK9 A;  3F4S A;  4GCI A;  2FWE A;  3HXS A;  2VL2 A;  3ED3 A;  1F3A A;  2C80 A;  2HRF A;  5ID2 B;  2XPD A;  1X9S B;  4IJ3 A;  1XOA A;  1TU8 A;  3BBY A;  2C3Q A;  2HI7 A;  1OKT A;  4TR4 A;  3W8J A;  3ZLP A;  4Q5R A;  5IMC A;  5B7C A;  3LYP A;  12GS A;  4ZL8 A;  3IHQ A;  6GSY A;  2K18 A;  22GS A;  5HFG A;  4ECB A;  3IAS 2;  1SJI A;  1V40 A;  4K6X A;  1LBK A;  1BED A;  5ECP B;  2PMT A;  4CDO A;  5ECK B;  3CRU A;  2HRN A;  5EY6 A;  4Q5F A;  3GL3 A;  1XCC A;  5J9C A;  4IN0 A;  5ECM B;  1THX A;  4WBR D;  4MF5 A;  1WRY A;  1YJ6 A;  3TRP A;  1K0A A;  3HY2 A;  5AGY A;  1B9Y C;  5B8B A;  1GNE A;  1HQO A;  2O7K A;  1Z5Y E;  3A5W A;  4EVM A;  3BJ5 A;  4HU9 A;  2M80 A;  5JWQ B;  4WR4 A;  4N0Z A;  1YQ1 A;  4KAE A;  4XHM A;  1A23 A;  2XHF A;  2VCT A;  5B6N A;  5ECH B;  4PQ1 A;  1OAZ A;  4GF0 A;  1T00 A;  3ZMK A;  1WPI A;  2P5Q A;  3GYK A;  4NPB A;  2H6Y A;  3ISO A;  4BWQ A;  2GZZ A;  2PVO C;  3HVX A;  4GRF A;  2MMZ A;  5G31 A;  4PUR A;  3UBL A;  5A4W A;  2CAQ A;  17GS A;  3Q19 A;  1PKW A;  2EIR A;  3KIJ A;  1QK8 A;  2KHP A;  3D0Z A;  1GSY A;  4BPY A;  3LYK A;  3MWH A;  2AUV A;  4E8H A;  1ZOF A;  2L5L A;  4JRR A;  3VWW A;  1BG5 A;  4JR6 A;  2LRT A;  4X0X A;  1OVN A;  3US3 A;  1GL8 A;  3TJK A;  1K0D A;  2YWI A;  2DJK A;  3HD5 A;  4KB3 A;  1VRS D;  3KM6 A;  2H6X A;  4LA1 A;  1SK0 A;  3IDV A;  5JWR B;  1EOG A;  1GSU A;  1R7H A;  3GSS A;  4KH7 A;  2V41 A;  3CSJ A;  4X43 A;  1SKW B;  3GV1 A;  3K8N A;  3VUR A;  2C4J A;  3WGD A;  1N2A A;  2C3T A;  1B8X A;  5DAL A;  2B5E A;  1J0F A;  3TKP A;  2GSQ A;  1PKZ A;  5CRH A;  4TW5 A;  1QMV A;  1VGL A;  2O89 A;  1GTB A;  1N8J A;  3KP9 A;  4V2L A;  4MP4 A;  4MK3 A;  4POK A;  3WGX A;  4MMM A;  3HA9 A;  1A2M A;  3GHA A;  4TKY A;  3ZTL A;  2MBS A;  1JZO A;  3E0U A;  4H86 A;  4AJ7 A;  6GSW A;  1GSQ A;  1DBY A;  4K7O A;  3FRC A;  1M9A A;  2YWN A;  2YV7 A;  5ABR A;  2PPT A;  2I3Y A;  2KUC A;  3ZVJ A;  4IS0 A;  4V2N A;  1YDK A;  1GTU A;  4ZB6 A;  2RUE A;  3TRQ A;  5ELG A;  1PRX A;  2GQL A;  2F51 A;  1Z6M A;  5KN1 A;  5DDL A;  3C8E A;  4L5O A;  3GNJ A;  4HDE A;  3KTB A;  4TXV A;  1SYR A;  1F37 A;  3KD0 A;  4ISD A;  5CAX A;  1GSE A;  4N0V A;  2BJX A;  5INY A;  4TN8 A;  3QD9 A;  2YV9 A;  2WCI A;  3WT2 A;  3PH9 A;  11GS A;  5IMA A;  2V32 A;  3BCK A;  3H8Q A;  1J08 A;  1GUL A;  4ULX A;  1IYI A;  3DYR A;  2MMO A;  2VLT A;  3IE3 A;  3DRN A;  5DBQ A;  2DC5 A;  3RPN A;  3L9S A;  3LXT A;  5DQS A;  3KH7 A;  2I4A A;  2K6V A;  3IK7 A;  2K8V A;  1MD3 A;  2LST A;  4NV5 A;  3CSH A;  6GSU A;  1DUG A;  3EMP A;  2OA7 A;  5IO0 A;  13GS A;  1XZO A;  4V1A p;  2DSA A;  2DJ0 A;  3GRX A;  1OC8 A;  4YQM A;  4K7N A;  1MDJ A;  2L6C A;  4GXZ A;  3W6G A;  4EXJ A;  6GST A;  3G7I A;  5ELA A;  4YAP A;  2HFD A;  5IM9 A;  2H75 A;  2HSY A;  4IP1 A;  4KCA A;  5A4V A;  3EIN A;  4MJE A;  2YAN A;  1PSQ A;  4GTU A;  2OAD A;  3H93 A;  3TOT A;  4XS6 A;  4BWS A;  4K9Z A;  3RPP A;  1YEX A;  2H72 A;  4ML1 A;  2H0G A;  4OFM A;  4ECJ A;  3GA4 A;  4MZC A;  3EU4 A;  1G7E A;  3DVW A;  5IMF A;  2CQ9 A;  3PIN A;  4LL1 B;  1TRV A;  4PUA A;  2IFQ A;  2IMD A;  5JCU A;  2GVP A;  3FZA A;  3O3T A;  4QL7 A;  1T7P B;  4MJA A;  2CA8 A;  1A8Y A;  1OC9 A;  3ZRE A;  3QAG A;  3TJJ A;  2O85 A;  1VF2 A;  4IQA A;  4J57 E;  5A5K A;  2LQO A;  1OC3 A;  2B5Y A;  1FB0 A;  4EDZ A;  1AW9 A;  1MEK A;  2FCH A;  5DAK A;  1GSF A;  1K3O A;  3GFK A;  1LJR A;  1JFU A;  1O7U A;  16GS A;  4TR1 A;  4KX4 A;  4HEA 2;  4KDU A;  5CRE A;  2RM5 A;  2MZC A;  1TOF A;  2YJH A;  2A4V A;  1FO5 A;  4DVC A;  5DJM A;  3VWV A;  1ERU A;  2B1L A;  4ZBD A;  4XRD A;  3VPT A;  4EDY A;  1K3Y A;  4FYB A;  4GSN A;  5FT3 A;  5H5S A;  2P31 A;  1XW9 A;  4TXO A;  2R6K A;  2H73 A;  3DKS A;  4L8E A;  1F3B A; 
#chains in the Genus database with same CATH topology
 3EYT A;  2YPM A;  4K0N A;  4MCU A;  3A2W A;  2GTU A;  3QPM A;  3D5J A;  4YZD A;  1V58 A;  3ZIJ A;  4G19 A;  3D6I A;  5AN1 A;  2VCZ A;  1X9M B;  3D4M A;  3UOM A;  4KSM A;  3M9J A;  3FMW A;  1HNB A;  2JAC A;  5CNW A;  1M2A A;  1WJK A;  4WET A;  2VCX A;  4OCE A;  4EC0 A;  2VD0 A;  2H30 A;  5CRG A;  1TRU A;  4PGT A;  1PD2 1;  2LTK A;  2H1B A;  4L5L A;  2DIY A;  3E9J B;  3HYP A;  4K8M A;  4N11 A;  4X1U A;  1WOU A;  1WMJ A;  3ZYW A;  2GGT A;  1G7O A;  3QAW A;  4NAX A;  4QQ7 A;  3LJR A;  3ERG A;  3HJM A;  1CQH A;  2H1G A;  5C04 A;  2L4Q A;  4G2E A;  2L57 A;  2LUS A;  4IVF A;  1Z7R A;  3ZRD A;  3CRT A;  4WF5 A;  1ZL9 A;  4JR4 A;  3OR5 A;  4IQ1 A;  5KOW A;  1GUK A;  4EF0 A;  2NBS A;  2WDU A;  1TW9 A;  1PQN A;  5HR0 A;  1YF0 A;  3P8W A;  3GUR A;  3QMX A;  2EC4 A;  3MSZ A;  4WXT A;  3PR8 A;  5LD0 A;  2L1L B;  4F82 A;  1YKA A;  1U3I A;  1TDI A;  4ZBA A;  2CZ2 A;  3TUE A;  1SL1 B;  2WZ9 A;  4JED A;  2WJU A;  1E2Y A;  3SBC A;  1ST9 A;  3R3E A;  3KGK A;  2A2C A;  1OE7 A;  5IMZ A;  3IAS 1;  1AAZ A;  4EE0 A;  1QXH A;  2VUP A;  1JZW A;  1A2J A;  1B4P A;  4GWR A;  4YQV A;  3H1N A;  3ZIT A;  4ZIL A;  3QOU A;  2F9S A;  1B9X C;  2K19 A;  2B7K A;  3CTF A;  2IMF A;  3TJG A;  4HZ2 A;  3KMO A;  2JSY A;  1FW1 A;  3LEF A;  2QKE A;  3ZML A;  2R4V A;  4K2D A;  1EWX A;  3FY7 A;  1UN2 A;  2IN3 A;  2VL9 A;  1H4O A;  4IW9 A;  2DMM A;  4GQF A;  1NM3 A;  4IP6 A;  1MDI A;  1BQ7 A;  3HJO A;  5CYY A;  1PN0 A;  5LNK 1;  2GQM A;  3FR9 A;  4K2X A;  1MDK A;  1Z3E A;  4OAU C;  1K0O A;  3EU3 A;  1QFN A;  3UAP A;  4ECI A;  2CVD A;  2VL3 A;  4P3Y B;  4O1P A;  3IV4 A;  4MA9 A;  1FOH A;  4RQX A;  3RBT A;  4KCE A;  3DXB A;  2IFQ B;  4GLT A;  5CO3 A;  5KEJ A;  5KN3 A;  5ECN B;  2CAZ B;  3BD2 A;  2A2D A;  1HNC A;  1ZCP A;  3O76 A;  3SDJ A;  3VLN A;  1ACV A;  1JLV A;  4XS4 B;  1BJX A;  1F6M C;  2C0G A;  3LOR A;  2V6K A;  1TXX A;  1EP8 A;  1EEJ A;  3IA1 A;  3ZL5 A;  3P90 A;  5DCG A;  5CP1 A;  3TGZ A;  3HVV A;  1PA3 A;  3EC3 A;  1R5A A;  2J9H A;  5G5E A;  2HLS A;  2X8C A;  2CVK A;  2FWH A;  2WUL A;  5DAK B;  3TJB A;  1GTI A;  2HZE B;  4NHZ A;  1SL2 B;  4TRX A;  2REM A;  4PL3 A;  3IBH A;  2AB6 A;  2XBI A;  3TKS C;  3CBU A;  1QGV A;  4TR1 B;  2H66 A;  1YO7 A;  2F6M B;  2YWM A;  2H1A A;  1OYJ A;  2IL3 A;  5ECL B;  3KZQ A;  3VWU A;  3IHG A;  4JBB A;  2HGK A;  3GUS A;  1ZYE A;  2DIZ A;  1SJZ A;  4MZB A;  5EPF A;  2L4C A;  3FVV A;  4HFV A;  4HOJ A;  4YH2 A;  4O5R A;  3APO A;  2QC7 A;  4WBJ A;  4ZL7 A;  3G7Y A;  3S9F A;  4TXO B;  4D73 A;  2V2G A;  4HS1 A;  4MLY A;  1XG8 A;  2YCD A;  5J3R A;  3IAM 2;  3CMI A;  2WFC A;  1PFO A;  2L6D A;  5ECI B;  4O7H A;  4AJ8 A;  2YNX A;  2HNL A;  2V6O A;  4MAB A;  4YAV A;  2H6Z A;  4OD7 A;  1M7T A;  2JZR A;  3F4M A;  1XXU A;  5IOW A;  3KEB A;  2X8G A;  4OFN A;  5DCH A;  2OKA A;  1O73 A;  1KNG A;  2H71 A;  4FQU A;  3HHV A;  4EO3 A;  1BAY A;  5F07 A;  2YZH A;  4EL1 A;  3SWL A;  3GX0 A;  2GT5 A;  2VCQ A;  1X0R A;  4NMU A;  2PER A;  2ZNM A;  3TB2 A;  3KP8 A;  2XTR A;  1NHO A;  2CT6 A;  1U88 A;  3IRA A;  2HZF A;  1V9W A;  2PGT A;  4N30 A;  3KCM A;  3C71 A;  2VL2 C;  5G1L A;  1S3C A;  3NZN A;  4KDX A;  3BCI A;  4AGS A;  4YKG A;  5E59 A;  3NOF A;  1HNA A;  1WP0 A;  2B6M A;  3DEX A;  4WR5 A;  2PBJ A;  1O81 A;  3H4K A;  1ERT A;  4IEL A;  3CXG A;  4IBP A;  2ZRR A;  2B5X A;  5D93 A;  1GNW A;  2MBT A;  3G7J A;  4I5Q A;  2CX3 A;  4J56 E;  1WWJ A;  2H70 A;  5EL8 A;  4XTS A;  1V2A A;  3HZ8 A;  2VLV A;  2HT9 A;  2R5G A;  5IOX A;  4O5Q A;  1A8L A;  4IJI A;  1VF3 A;  2J23 A;  3UIT A;  1JLW A;  3D4T A;  1X5D A;  4PQI A;  1T4Z A;  5F05 A;  5G1K A;  1JZD A;  3L9U A;  4ML6 A;  3LWA A;  4HSC X;  4RI6 A;  4WKW A;  1ERW A;  2A2R A;  2ETD A;  3MDK A;  4MPG A;  5AIS A;  3AY8 A;  4L0W A;  1RW1 A;  1XWB A;  3FKF A;  2CX4 A;  3ME7 A;  2F8A A;  2HRK A;  2E2M A;  4CHS A;  2IME A;  3HZ4 A;  5HR3 A;  1USB A;  1Z7P A;  2VLU A;  3IR4 A;  3U6V A;  4FH8 A;  1TK0 B;  5ECS A;  3HDC A;  3IPZ A;  3M8N A;  1A24 A;  1M2D A;  2E7P A;  2G0F A;  1TRS A;  2MMA A;  20GS A;  1JZR A;  3M9K A;  1KTE A;  2OE3 A;  4LL4 B;  3VI5 A;  4HZ4 A;  3FZ4 A;  3UEM A;  4NXI A;  5HQP A;  1ML6 A;  5IPH A;  3LJ1 A;  2LS5 A;  1SJ8 A;  3DML A;  1SK2 A;  4MF7 A;  3RHB A;  4O92 A;  1GUH A;  4WEY A;  1EZK A;  1K0B A;  4AF2 A;  1GH2 A;  1TDP A;  4KF9 A;  1GLP A;  4LLR A;  4OO5 A;  2LNS A;  5IQY A;  2ZCT A;  5J5N A;  3C7M A;  2CV4 A;  1W89 A;  5B8A A;  2L59 A;  2VAF A;  2B7J A;  3L0I A;  2IP6 A;  2GLR A;  4N10 A;  2FNO A;  3HVS A;  5ECQ B;  3CYN A;  3FK8 A;  4POB A;  3UIW A;  4TOP A;  3NIV A;  1E6B A;  2RM6 A;  1PN9 A;  1M9B A;  2KLX A;  2KOK A;  4MPF A;  4OMV A;  1T1V A;  4GSS A;  3QR6 A;  2H19 A;  3IOS A;  4LMW A;  4JZQ A;  4EUY A;  5A4U A;  3EE2 A;  2BL8 A;  1AQW A;  5FWG A;  4OO4 A;  2IJY A;  1K3L A;  2O87 A;  4Q5Q A;  3RDW A;  2FUG 1;  1SU9 A;  1XWC A;  4HEA 1;  5CRD A;  1EGR A;  2A2S A;  2LJK A;  2LRN A;  5J41 A;  2C8U A;  5D9T A;  1GUM A;  3L0H A;  2K8S A;  1JQO A;  5HGI A;  4I97 A;  1U6T A;  2LRC A;  4YZ9 A;  4MJC A;  4XRA A;  1K0N A;  1KEB A;  4FO5 A;  3UVT A;  1R26 A;  3HJP A;  1WE0 A;  3DIE A;  2FUG 2;  4Q5N A;  5IMV A;  4KGI A;  2GSS A;  4G76 A;  1FVK A;  5FHI A;  4NHW A;  3I6A A;  2DML A;  4ACS A;  3UVH A;  2ON5 A;  1SKR B;  4PXO A;  1XW5 A;  2R37 A;  4PNF A;  1AC1 A;  4BL7 A;  5LNK e;  4KSO A;  2F8F A;  2FLS A;  4G0I A;  4IKH A;  2AV4 A;  1OE8 A;  3LFL A;  5DAL B;  1X9W B;  10GS A;  4K7I A;  4KA0 A;  3L78 A;  3HKR A;  2XMX A;  1Q98 A;  3A2X A;  2H0H A;  2C0F A;  2JSZ A;  1EGO A;  2P5R A;  3TOU A;  14GS A;  2GT6 A;  2IMI A;  5H5R A;  2EIQ A;  2VD1 A;  2DJ1 A;  3ERF A;  5IPG A;  2E8G A;  5GZZ B;  3ZZX A;  4V2M A;  4KND A;  3APQ A;  1OKD A;  1XBS A;  5GAP D;  2IIY A;  3HCZ A;  2WB9 A;  2YJ7 A;  4DSS A;  2H8L A;  2N5B A;  3ERW A;  3FYG A;  1GSS A;  3M3M A;  2B3S A;  4G75 A;  2WGR A;  2FU2 A;  1Q4J A;  3AJF A;  2H01 A;  5HFI A;  4J2F A;  1GP1 A;  3MIX A;  3RHC A;  4Z2T A;  1MD4 A;  1TI3 A;  3DWV A;  4I2U A;  1F9M A;  3F63 A;  1W4V A;  3GKN A;  2B1K A;  3J7Y b;  5IO2 A;  1AIU A;  4HI7 A;  1U5K A;  2AJQ B;  2PVQ A;  1JHB A;  1SEN A;  2F3M A;  19GS A;  5D8I A;  1GLQ A;  2D2Z A;  1VF1 A;  2FA4 A;  2C0E A;  3U5R E;  3A2V A;  1Z6N A;  4BVY A;  2DLX A;  1I9D A;  3MAK A;  3QCP A;  2H74 A;  1QQ2 A;  1VF4 A;  2N5F A;  5G30 A;  4KUN A;  1YEP A;  4OCF A;  2JB3 A;  2FWG A;  2BMX A;  4OFT A;  5L71 A;  4TR3 A;  3N9J A;  2OBK A;  3EWL A;  3V1W A;  2X99 A;  1TK5 B;  3MNG A;  3TDG A;  5HR1 A;  2NVL A;  1TRW A;  2YP6 A;  1EP7 A;  4OWY A;  2F66 B;  4IHU A;  5DJL A;  3FNB A;  4XIH A;  3F4R A;  4MJB A;  1I5G A;  2M46 A;  5AIX A;  1T4Y A;  2TRX A;  3M1G A;  2Z9S A;  4I2T A;  5JCW A;  6GSS A;  1FOV A;  3L9V A;  3VI7 A;  5D9V A;  4TVE A;  1ILO A;  2FWF A;  3GKX A;  3ZFL A;  4MF6 A;  3APS A;  3L4N A;  3UL3 A;  5KN0 A;  2HSM A;  4MZW A;  2JZT A;  3LXZ A;  3ME8 A;  4I8B A;  1YZX A;  1ABA A;  2X64 A;  5D96 A;  3GN3 A;  3I9V 1;  4IGJ A;  1XOB A;  3RAZ A;  2ALB A;  3N5O A;  3I43 A;  1AUC A;  2H76 A;  1RK4 A;  3DVX A;  1X5C A;  2XTQ A;  2VM1 A;  4PX1 A;  2HE3 A;  4BVX A;  4OAV B;  4YZC A;  5COH A;  4Z7H A;  3IC8 A;  2PWJ A;  5C00 A;  1ZGN A;  4JCV E;  3LG6 A;  1GRX A;  4HUA A;  2H0I A;  2I1U A;  2HRA A;  2KP2 A;  4Z2R A;  3ZFB A;  1CQG A;  1GTA A;  2JU5 A;  4XCS A;  1XVQ A;  3P7X A;  5JWO B;  2IMK A;  3P2A A;  2YN1 A;  2KP1 A;  1ERV A;  3I9V 2;  1Y6E A;  4HJM A;  4EIQ A;  2GDR A;  1A0F A;  2BTO T;  3CSI A;  3W8S A;  1B48 A;  3F3R A;  1OC9 B;  4DEJ A;  2LV3 A;  3FBV A;  4WF4 A;  2FHE A;  3FZ5 A;  2LEG A;  2FEF A;  2XPE A;  2ON7 A;  5JCG A;  5F0G A;  5BRT A;  3LGC A;  1NW2 A;  4JE1 A;  1UVZ A;  2GSR A;  1AXD A;  4I6X A;  1FB6 A;  4ZXG A;  4MDC A;  4NV2 A;  5CRW A;  3KTL A;  1QUW A;  3TKR A;  3DD3 A;  1SK1 A;  3FHK A;  1FAA A;  2VM2 A;  2MMN A;  3GH6 A;  2PUK C;  2VIM A;  4JU5 A;  3D21 A;  3D22 A;  3DO9 A;  2C0D A;  3TCO A;  3IAM 1;  1ZZY A;  2HXK A;  3GH9 A;  4BL7 B;  2ES7 A;  5G5F A;  1PMT A;  4F0B A;  3VK9 A;  2I9H A;  3ZIV A;  1J9B A;  2GZP A;  4DSR A;  3EMX A;  2OE0 A;  1M99 A;  2NDO A;  2L5O A;  5IIZ A;  2GZY A;  2FY6 A;  3F3Q A;  1XW6 A;  2G2Q A;  1DSB A;  1ON4 A;  2X4A A;  2ZUP A;  5ENU A;  3GL5 A;  2E2G A;  2K9F A;  2M72 A;  3IC4 A;  3GIX A;  3C1S A;  3GST A;  4RI7 A;  3BOA A;  2C1Y A;  4AS2 A;  1AQX A;  3GTU A;  4DSS B;  1HD2 A;  1M0U A;  1XFL A;  1T8E B;  4TR0 A;  1TU7 A;  5GSS A;  2VCW A;  4GXT A;  1GWC A;  4RQR A;  1XWK A;  2LJR A;  3VFI A;  4HQS A;  1XIY A;  1A2L A;  1SYX A;  2GST A;  1BX9 A;  1F2E A;  3EVI A;  3HVN A;  1FVJ A;  1SD8 A;  3DGQ A;  3QAV A;  2IWT A;  1PGT A;  1URM A;  1EOH A;  3O6T A;  3UMA A;  4PTS A;  1G0T A;  2FGX A;  4Z7X A;  1DE1 A;  3Q6O A;  1U87 A;  4A5P A;  4CW9 A;  2EIO A;  5GST A;  5J4U A;  3VWX A;  2OBI A;  5J9B A;  1RQM A;  2MJF B;  2O8V B;  1PX7 A;  1O6J A;  3FW2 A;  2RLI A;  3KJY A;  1EEM A;  3J7Y k;  1TK8 B;  1G6W A;  2YFA A;  4AJ6 A;  3UBK A;  1PL2 A;  4PL4 A;  4HU7 A;  3LSZ A;  4PL5 A;  1SKS B;  4MNN A;  4X4J A;  2WRT A;  5BMU A;  4EIP A;  3VPQ A;  1S3R A;  4F9Z A;  2V1M A;  4CY6 A;  3KXO A;  2YWO A;  18GS A;  2PU9 C;  3UJ1 A;  2CVB A;  1ZYQ B;  7GSS A;  1O8X A;  4MH3 A;  5IMD A;  2E0Q A;  3TKS E;  3DA4 A;  5D73 A;  3M0F A;  3WGE A;  3CQF A;  4DSQ A;  2RIO A;  2AYT A;  1EV4 A;  2LNT A;  1IYH A;  3F6D A;  2LJA A;  5D9X A;  1S3A A;  4PQH A;  3E3E A;  5ECO B;  4V1A g;  1R4W A;  5ID2 A;  4I1T A;  3I69 A;  2X8H A;  1HYU A;  5G2Z A;  1V57 A;  2AHE A;  4XS1 A;  4ZL9 A;  4POM A;  1B4Q A;  5KN2 A;  2N5A A;  2RUF A;  2DBC A;  6GSX A;  1M2B A;  2WS2 A;  4ILF A;  4ZIJ A;  1XWA A;  4MH2 A;  4F2I A;  1S3D A;  2GQK A;  1KBN A;  4K1F A;  5HFK A;  4ZB8 A;  2QSI A;  2CZ3 A;  3GMF A;  2JL4 A;  3A3T A;  2TIR A;  5AIV A;  3GKK A;  3EUR A;  2TRC P;  1UA5 A;  3WT1 A;  8GSS A;  1LU4 A;  3KH9 A;  5B6M A;  3QDN A;  1MTC A;  2HSH A;  4ID0 A;  1K0C A;  2CAI A;  1AQV A;  1ZMA A;  2AAW A;  2C3N A;  4O32 A;  4O5U A;  2VOC A;  2ZW3 A;  3F8U A;  2H1D A;  2GSC A;  4K0G A;  2JB2 A;  2JBW A;  4KDY A;  5GAN D;  2QA1 A;  1FHE A;  3FR6 A;  2P22 B;  4NWY A;  4YQU A;  4FYU A;  2NPB A;  2DJ3 A;  4XS4 A;  4HQZ A;  2LKU A;  1NHY A;  5F8B A;  4RUV A;  4QL9 A;  2XBQ A;  5EVO A;  2X49 A;  4PUF C;  2P0G A;  3P23 A;  2VO4 A;  5F06 A;  2RAD A;  4ECC A;  5D9W A;  4POL A;  3WD6 A;  3IXR A;  2LQQ A;  4L0U A;  2RII A;  3FEU A;  4D73 B;  2HZE A;  2NTO A;  1XWG A;  3F4T A;  2QGV A;  4LMV A;  6GSV A;  1TI1 A;  2FA8 A;  3GKM A;  4F03 A;  1WIK A;  1YKC A;  1ZYN A;  3TJF A;  3JCM L;  3GTU B;  3LQ7 A;  3TRX A;  5H5Q A;  4GST A;  1PX6 A;  4BA7 A;  3UAR A;  1U3A A;  1TKD B;  4KE3 A;  4E8E A;  1K0M A;  3Q74 A;  1UC7 A;  5DVB A;  3QFB C;  2PN8 A;  4EKZ A;  2GS3 A;  2IPA A;  4ICY A;  1BYE A;  1TP9 A;  4G10 A;  3LJ2 A;  4FYC A;  2DJJ A;  1TJD A;  3B55 A;  1YY7 A;  4GQC A;  1THO A;  3TKS A;  2OE1 A;  2DKH A;  4KW6 A;  2VCV A;  3FZ9 A;  2MYG A;  9GSS A;  1SL0 B;  2A2P A;  1X5E A;  2OAC A;  4CY8 A;  3Q18 A;  2JB1 A;  3GX8 A;  3C1R A;  3C73 A;  2R3X A;  2FD3 A;  1NSW A;  2HYX A;  1A0R P;  3TKQ A;  2XC2 A;  5HR2 A;  4ZB9 A;  1Z9H A;  5DQY A;  4USS A;  3H79 A;  4PNG A;  5ECR B;  1FG4 A;  2JZS A;  1H75 A;  3PGT A;  1XVW A;  1C72 A;  5LCZ A;  1R5P A;  3EPT A;  4FIW A;  1V98 A;  3FR3 A;  1O85 A;  1G6Y A;  1XPV A;  3KMN A;  1DE2 A;  1T3B A;  2YOI A;  1EV9 A;  1GSD A;  1TTZ A;  4F0C A;  2UZ8 A;  4HJ2 A;  3WYW A;  1SJ6 A;  3R2Q A;  4G9H A;  3CTG A;  1Y25 A;  1YF1 A;  2OJL A;  3F0I A;  1PL1 A;  3F9U A;  2JAE A;  2A4H A;  2R2J A;  3G9B A;  2DJ2 A;  1O8W A;  2YZU A;  3F6F A;  4Z2U A;  5E4W A;  3ZVJ D;  2I81 A;  3QFA C;  4ZBB A;  1SD9 A;  2JAD A;  3IK9 A;  3F4S A;  4GCI A;  2FWE A;  3HXS A;  2VL2 A;  3ED3 A;  1F3A A;  2C80 A;  2HRF A;  5ID2 B;  2XPD A;  1X9S B;  4IJ3 A;  1XOA A;  1TU8 A;  3BBY A;  2RLD A;  2C3Q A;  2HI7 A;  1OKT A;  4TR4 A;  3W8J A;  3ZLP A;  4Q5R A;  5IMC A;  5B7C A;  2R0G A;  3LYP A;  12GS A;  4ZL8 A;  3IHQ A;  6GSY A;  2K18 A;  22GS A;  5HFG A;  4ECB A;  3IAS 2;  1SJI A;  1V40 A;  4K6X A;  1LBK A;  4DWL A;  1BED A;  5ECP B;  2PMT A;  4CDO A;  5ECK B;  3CRU A;  2HRN A;  5EY6 A;  4Q5F A;  3GL3 A;  1XCC A;  5J9C A;  4G0K A;  4IN0 A;  5ECM B;  1THX A;  4WBR D;  4MF5 A;  1WRY A;  1YJ6 A;  3TRP A;  1K0A A;  3HY2 A;  5AGY A;  1B9Y C;  5B8B A;  1GNE A;  1HQO A;  2O7K A;  2YFB A;  4Q9V A;  1Z5Y E;  3A5W A;  4EVM A;  3BJ5 A;  4HU9 A;  2M80 A;  4O1O A;  5JWQ B;  4WR4 A;  4N0Z A;  1YQ1 A;  4KAE A;  4XHM A;  1A23 A;  2XHF A;  2VCT A;  5B6N A;  5ECH B;  3JSB A;  4PQ1 A;  2QGM A;  1OAZ A;  4GF0 A;  1T00 A;  3ZMK A;  1WPI A;  2P5Q A;  2QZG A;  3GYK A;  4NPB A;  2H6Y A;  3DA3 A;  3ISO A;  4BWQ A;  2GZZ A;  2PVO C;  3HVX A;  4GRF A;  2MMZ A;  5G31 A;  4PUR A;  3UBL A;  5A4W A;  2CAQ A;  17GS A;  3Q19 A;  3MYD A;  1PKW A;  3LW9 A;  2EIR A;  3KIJ A;  1QK8 A;  2KHP A;  3D0Z A;  4G0L A;  1GSY A;  4BPY A;  3LYK A;  3MWH A;  2AUV A;  4E8H A;  1ZOF A;  2L5L A;  4JRR A;  3VWW A;  1BG5 A;  4JR6 A;  2LRT A;  4X0X A;  1OVN A;  3US3 A;  1GL8 A;  3TJK A;  1K0D A;  2YWI A;  1W3S A;  2DJK A;  3HD5 A;  4KB3 A;  1VRS D;  3KM6 A;  2H6X A;  4LA1 A;  1SK0 A;  3IDV A;  5JWR B;  1EOG A;  1GSU A;  1R7H A;  3GSS A;  4KH7 A;  2V41 A;  3CSJ A;  4X43 A;  1SKW B;  3GV1 A;  3K8N A;  3VUR A;  2C4J A;  3WGD A;  1N2A A;  2KKM A;  2C3T A;  3VA9 A;  1B8X A;  5DAL A;  2B5E A;  1J0F A;  3TKP A;  2GSQ A;  1PKZ A;  5CRH A;  4TW5 A;  1QMV A;  1VGL A;  2O89 A;  1GTB A;  1N8J A;  3KP9 A;  4V2L A;  4MP4 A;  4MK3 A;  4POK A;  3WGX A;  4MMM A;  3HA9 A;  1A2M A;  3GHA A;  4TKY A;  3ZTL A;  4BVY B;  2MBS A;  1JZO A;  3E0U A;  4H86 A;  4AJ7 A;  6GSW A;  1GSQ A;  1DBY A;  4K7O A;  3FRC A;  1M9A A;  2YWN A;  2YV7 A;  5ABR A;  2PPT A;  2I3Y A;  2KUC A;  3ZVJ A;  4IS0 A;  4V2N A;  4YKF A;  1YDK A;  1GTU A;  4ZB6 A;  2RUE A;  1M3I A;  3TRQ A;  5ELG A;  1PRX A;  2GQL A;  2F51 A;  1Z6M A;  5KN1 A;  5DDL A;  2QSB A;  3C8E A;  4L5O A;  3GNJ A;  4HDE A;  3KTB A;  4TXV A;  5KOX A;  1SYR A;  1F37 A;  2V1C C;  3KD0 A;  4ISD A;  5CAX A;  1GSE A;  4N0V A;  2BJX A;  5INY A;  4TN8 A;  3QD9 A;  2YV9 A;  2DKI A;  2WCI A;  3WT2 A;  3PH9 A;  11GS A;  5IMA A;  2V32 A;  3BCK A;  3H8Q A;  1J08 A;  1GUL A;  4K5R A;  4ULX A;  1IYI A;  3DYR A;  2MMO A;  2VLT A;  3IE3 A;  3DRN A;  5DBQ A;  2DC5 A;  3RPN A;  3L9S A;  3LXT A;  5DQS A;  3KH7 A;  2I4A A;  2K6V A;  4U6R A;  3IK7 A;  2K8V A;  1MD3 A;  4K5S A;  2LST A;  4NV5 A;  4Z7G A;  4BVX B;  3CSH A;  6GSU A;  1DUG A;  3EMP A;  2OA7 A;  5IO0 A;  13GS A;  1XZO A;  4V1A p;  2DSA A;  2DJ0 A;  3GRX A;  1OC8 A;  4YQM A;  4K7N A;  1MDJ A;  4BIK A;  2L6C A;  4GXZ A;  3W6G A;  4EXJ A;  6GST A;  3G7I A;  5ELA A;  4YAP A;  2HFD A;  5IM9 A;  2H75 A;  2HSY A;  4IP1 A;  4KCA A;  5A4V A;  3EIN A;  4MJE A;  2YAN A;  1PSQ A;  4GTU A;  2OAD A;  3H93 A;  3TOT A;  4XS6 A;  4BWS A;  4K9Z A;  3RPP A;  1YEX A;  2H72 A;  4ML1 A;  2H0G A;  4OFM A;  4ECJ A;  3GA4 A;  4MZC A;  3EU4 A;  1G7E A;  3DVW A;  5IMF A;  2CQ9 A;  3PIN A;  4LL1 B;  1TRV A;  4PUA A;  2IFQ A;  2IMD A;  1M3J A;  5JCU A;  2GVP A;  3FZA A;  3O3T A;  4QL7 A;  1T7P B;  4MJA A;  2CA8 A;  1A8Y A;  1OC9 A;  3ZRE A;  3QAG A;  2R0C A;  3TJJ A;  2O85 A;  1VF2 A;  4IQA A;  4J57 E;  5A5K A;  2LQO A;  1OC3 A;  2B5Y A;  1FB0 A;  4EDZ A;  1AW9 A;  1MEK A;  2FCH A;  5DAK A;  1GSF A;  1K3O A;  3GFK A;  1LJR A;  3A5I A;  1JFU A;  1O7U A;  2V6E A;  2BL7 A;  16GS A;  4TR1 A;  2QA2 A;  4KX4 A;  4HEA 2;  4KDU A;  5CRE A;  2RM5 A;  2MZC A;  1TOF A;  2YJH A;  4AS3 A;  2A4V A;  3PPU A;  1FO5 A;  4DVC A;  1ZYP A;  5DJM A;  3VWV A;  1ERU A;  2B1L A;  4ZBD A;  4XRD A;  3LJ0 A;  3VPT A;  4EDY A;  1K3Y A;  4FYB A;  4GSN A;  5FT3 A;  3Q8D A;  5H5S A;  2P31 A;  1XW9 A;  4TXO A;  2R6K A;  2R0P A;  2H73 A;  3DKS A;  4L8E A;  1F3B A; 
#chains in the Genus database with same CATH homology
 3EYT A;  2YPM A;  4K0N A;  4MCU A;  3A2W A;  2GTU A;  3QPM A;  3D5J A;  4YZD A;  1V58 A;  3ZIJ A;  4G19 A;  3D6I A;  5AN1 A;  2VCZ A;  1X9M B;  3D4M A;  3UOM A;  4KSM A;  3M9J A;  3FMW A;  1HNB A;  2JAC A;  5CNW A;  1M2A A;  1WJK A;  4WET A;  2VCX A;  4OCE A;  4EC0 A;  2VD0 A;  2H30 A;  5CRG A;  1TRU A;  4PGT A;  1PD2 1;  2LTK A;  2H1B A;  4L5L A;  2DIY A;  3E9J B;  3HYP A;  4K8M A;  4N11 A;  4X1U A;  1WOU A;  1WMJ A;  3ZYW A;  2GGT A;  1G7O A;  3QAW A;  4NAX A;  4QQ7 A;  3LJR A;  3ERG A;  3HJM A;  1CQH A;  2H1G A;  5C04 A;  2L4Q A;  4G2E A;  2L57 A;  2LUS A;  4IVF A;  1Z7R A;  3ZRD A;  3CRT A;  4WF5 A;  1ZL9 A;  4JR4 A;  3OR5 A;  4IQ1 A;  5KOW A;  1GUK A;  4EF0 A;  2NBS A;  2WDU A;  1TW9 A;  1PQN A;  5HR0 A;  1YF0 A;  3P8W A;  3GUR A;  3QMX A;  2EC4 A;  3MSZ A;  4WXT A;  3PR8 A;  5LD0 A;  2L1L B;  4F82 A;  1YKA A;  1U3I A;  1TDI A;  4ZBA A;  2CZ2 A;  3TUE A;  1SL1 B;  2WZ9 A;  4JED A;  2WJU A;  1E2Y A;  3SBC A;  1ST9 A;  3R3E A;  3KGK A;  2A2C A;  1OE7 A;  5IMZ A;  3IAS 1;  1AAZ A;  4EE0 A;  1QXH A;  2VUP A;  1JZW A;  1A2J A;  1B4P A;  4GWR A;  4YQV A;  3H1N A;  3ZIT A;  4ZIL A;  3QOU A;  2F9S A;  1B9X C;  2K19 A;  2B7K A;  3CTF A;  2IMF A;  3TJG A;  4HZ2 A;  3KMO A;  2JSY A;  1FW1 A;  3LEF A;  2QKE A;  3ZML A;  2R4V A;  4K2D A;  1EWX A;  3FY7 A;  1UN2 A;  2IN3 A;  2VL9 A;  1H4O A;  4IW9 A;  2DMM A;  4GQF A;  1NM3 A;  4IP6 A;  1MDI A;  1BQ7 A;  3HJO A;  5CYY A;  1PN0 A;  5LNK 1;  2GQM A;  3FR9 A;  4K2X A;  1MDK A;  1Z3E A;  4OAU C;  1K0O A;  3EU3 A;  1QFN A;  3UAP A;  4ECI A;  2CVD A;  2VL3 A;  4P3Y B;  4O1P A;  3IV4 A;  4MA9 A;  1FOH A;  4RQX A;  3RBT A;  4KCE A;  3DXB A;  2IFQ B;  4GLT A;  5CO3 A;  5KEJ A;  5KN3 A;  5ECN B;  2CAZ B;  3BD2 A;  2A2D A;  1HNC A;  1ZCP A;  3O76 A;  3SDJ A;  3VLN A;  1ACV A;  1JLV A;  4XS4 B;  1BJX A;  1F6M C;  2C0G A;  3LOR A;  2V6K A;  1TXX A;  1EP8 A;  1EEJ A;  3IA1 A;  3ZL5 A;  3P90 A;  5DCG A;  5CP1 A;  3TGZ A;  3HVV A;  1PA3 A;  3EC3 A;  1R5A A;  2J9H A;  5G5E A;  2HLS A;  2X8C A;  2CVK A;  2FWH A;  2WUL A;  5DAK B;  3TJB A;  1GTI A;  2HZE B;  4NHZ A;  1SL2 B;  4TRX A;  2REM A;  4PL3 A;  3IBH A;  2AB6 A;  2XBI A;  3TKS C;  3CBU A;  1QGV A;  4TR1 B;  2H66 A;  1YO7 A;  2F6M B;  2YWM A;  2H1A A;  1OYJ A;  2IL3 A;  5ECL B;  3KZQ A;  3VWU A;  3IHG A;  4JBB A;  3GUS A;  1ZYE A;  2DIZ A;  1SJZ A;  4MZB A;  5EPF A;  2L4C A;  4HFV A;  4HOJ A;  4YH2 A;  4O5R A;  3APO A;  2QC7 A;  4WBJ A;  4ZL7 A;  3G7Y A;  3S9F A;  4TXO B;  4D73 A;  2V2G A;  4HS1 A;  4MLY A;  2YCD A;  5J3R A;  3IAM 2;  3CMI A;  2WFC A;  2L6D A;  5ECI B;  4AJ8 A;  4O7H A;  2YNX A;  2HNL A;  2V6O A;  4MAB A;  4YAV A;  2H6Z A;  4OD7 A;  1M7T A;  2JZR A;  3F4M A;  1XXU A;  5IOW A;  3KEB A;  2X8G A;  4OFN A;  5DCH A;  2OKA A;  1O73 A;  1KNG A;  2H71 A;  4FQU A;  3HHV A;  4EO3 A;  1BAY A;  5F07 A;  2YZH A;  4EL1 A;  3SWL A;  2GT5 A;  3GX0 A;  2VCQ A;  1X0R A;  4NMU A;  2PER A;  2ZNM A;  3TB2 A;  3KP8 A;  2XTR A;  1NHO A;  2CT6 A;  1U88 A;  3IRA A;  2HZF A;  1V9W A;  2PGT A;  4N30 A;  3KCM A;  3C71 A;  2VL2 C;  5G1L A;  1S3C A;  3NZN A;  4KDX A;  3BCI A;  4AGS A;  4YKG A;  5E59 A;  3NOF A;  1HNA A;  1WP0 A;  2B6M A;  3DEX A;  4WR5 A;  2PBJ A;  1O81 A;  3H4K A;  1ERT A;  4IEL A;  3CXG A;  4IBP A;  2ZRR A;  2B5X A;  5D93 A;  1GNW A;  2MBT A;  3G7J A;  4I5Q A;  2CX3 A;  4J56 E;  1WWJ A;  2H70 A;  5EL8 A;  4XTS A;  1V2A A;  3HZ8 A;  2VLV A;  2HT9 A;  2R5G A;  5IOX A;  4O5Q A;  1A8L A;  4IJI A;  1VF3 A;  2J23 A;  3UIT A;  1JLW A;  3D4T A;  1X5D A;  4PQI A;  1T4Z A;  5F05 A;  5G1K A;  1JZD A;  3L9U A;  4ML6 A;  3LWA A;  4RI6 A;  4WKW A;  1ERW A;  2A2R A;  3MDK A;  4MPG A;  5AIS A;  3AY8 A;  4L0W A;  1RW1 A;  1XWB A;  3FKF A;  2CX4 A;  3ME7 A;  2F8A A;  2HRK A;  2E2M A;  4CHS A;  2IME A;  3HZ4 A;  5HR3 A;  1USB A;  1Z7P A;  2VLU A;  3IR4 A;  3U6V A;  4FH8 A;  1TK0 B;  5ECS A;  3HDC A;  3IPZ A;  3M8N A;  1A24 A;  1M2D A;  2E7P A;  2G0F A;  1TRS A;  2MMA A;  20GS A;  1JZR A;  3M9K A;  1KTE A;  2OE3 A;  4LL4 B;  3VI5 A;  4HZ4 A;  3FZ4 A;  3UEM A;  4NXI A;  5HQP A;  1ML6 A;  5IPH A;  3LJ1 A;  2LS5 A;  1SJ8 A;  3DML A;  1SK2 A;  4MF7 A;  3RHB A;  4O92 A;  1GUH A;  4WEY A;  1EZK A;  1K0B A;  4AF2 A;  1GH2 A;  4KF9 A;  1GLP A;  4LLR A;  4OO5 A;  2LNS A;  5IQY A;  2ZCT A;  5J5N A;  3C7M A;  2CV4 A;  1W89 A;  5B8A A;  2L59 A;  2VAF A;  2B7J A;  3L0I A;  2IP6 A;  2GLR A;  4N10 A;  2FNO A;  3HVS A;  5ECQ B;  3CYN A;  3FK8 A;  4POB A;  3UIW A;  4TOP A;  3NIV A;  1E6B A;  2RM6 A;  1PN9 A;  1M9B A;  2KLX A;  2KOK A;  4MPF A;  4OMV A;  1T1V A;  4GSS A;  3QR6 A;  2H19 A;  3IOS A;  4LMW A;  4JZQ A;  4EUY A;  5A4U A;  3EE2 A;  1AQW A;  5FWG A;  4OO4 A;  2IJY A;  1K3L A;  2O87 A;  4Q5Q A;  3RDW A;  2FUG 1;  1SU9 A;  1XWC A;  4HEA 1;  5CRD A;  1EGR A;  2A2S A;  2LJK A;  2LRN A;  5J41 A;  2C8U A;  5D9T A;  1GUM A;  3L0H A;  2K8S A;  5HGI A;  4I97 A;  1U6T A;  2LRC A;  4YZ9 A;  4MJC A;  4XRA A;  1K0N A;  1KEB A;  4FO5 A;  3UVT A;  1R26 A;  3HJP A;  1WE0 A;  3DIE A;  2FUG 2;  4Q5N A;  5IMV A;  4KGI A;  2GSS A;  4G76 A;  1FVK A;  5FHI A;  4NHW A;  3I6A A;  2DML A;  4ACS A;  3UVH A;  2ON5 A;  1SKR B;  4PXO A;  1XW5 A;  2R37 A;  4PNF A;  1AC1 A;  4BL7 A;  5LNK e;  4KSO A;  2F8F A;  2FLS A;  4G0I A;  4IKH A;  2AV4 A;  1OE8 A;  3LFL A;  5DAL B;  1X9W B;  10GS A;  4K7I A;  4KA0 A;  3L78 A;  3HKR A;  2XMX A;  1Q98 A;  3A2X A;  2H0H A;  2C0F A;  2JSZ A;  1EGO A;  2P5R A;  3TOU A;  14GS A;  2GT6 A;  2IMI A;  5H5R A;  2EIQ A;  2VD1 A;  2DJ1 A;  3ERF A;  5IPG A;  2E8G A;  5GZZ B;  3ZZX A;  4V2M A;  4KND A;  3APQ A;  1OKD A;  1XBS A;  5GAP D;  2IIY A;  3HCZ A;  2WB9 A;  2YJ7 A;  4DSS A;  2H8L A;  2N5B A;  3ERW A;  3FYG A;  1GSS A;  3M3M A;  2B3S A;  4G75 A;  2WGR A;  1Q4J A;  3AJF A;  2H01 A;  5HFI A;  4J2F A;  1GP1 A;  3MIX A;  3RHC A;  4Z2T A;  1MD4 A;  1TI3 A;  3DWV A;  4I2U A;  1F9M A;  3F63 A;  1W4V A;  3GKN A;  2B1K A;  3J7Y b;  5IO2 A;  1AIU A;  4HI7 A;  1U5K A;  2AJQ B;  2PVQ A;  1JHB A;  1SEN A;  2F3M A;  19GS A;  5D8I A;  1GLQ A;  2D2Z A;  1VF1 A;  2FA4 A;  2C0E A;  3U5R E;  3A2V A;  1Z6N A;  4BVY A;  2DLX A;  1I9D A;  3MAK A;  3QCP A;  2H74 A;  1QQ2 A;  1VF4 A;  2N5F A;  5G30 A;  4KUN A;  1YEP A;  4OCF A;  2JB3 A;  2FWG A;  2BMX A;  4OFT A;  5L71 A;  4TR3 A;  3N9J A;  2OBK A;  3EWL A;  3V1W A;  2X99 A;  1TK5 B;  3MNG A;  3TDG A;  5HR1 A;  2NVL A;  1TRW A;  4OWY A;  2YP6 A;  1EP7 A;  2F66 B;  4IHU A;  5DJL A;  4XIH A;  3F4R A;  4MJB A;  1I5G A;  2M46 A;  5AIX A;  1T4Y A;  2TRX A;  3M1G A;  2Z9S A;  4I2T A;  5JCW A;  6GSS A;  1FOV A;  3L9V A;  3VI7 A;  5D9V A;  4TVE A;  1ILO A;  2FWF A;  3GKX A;  3ZFL A;  4MF6 A;  3APS A;  3L4N A;  3UL3 A;  5KN0 A;  2HSM A;  4MZW A;  2JZT A;  3LXZ A;  3ME8 A;  4I8B A;  1YZX A;  1ABA A;  2X64 A;  5D96 A;  3GN3 A;  3I9V 1;  4IGJ A;  1XOB A;  3RAZ A;  2ALB A;  3N5O A;  3I43 A;  1AUC A;  2H76 A;  1RK4 A;  3DVX A;  1X5C A;  2XTQ A;  2VM1 A;  4PX1 A;  2HE3 A;  4BVX A;  4OAV B;  4YZC A;  5COH A;  4Z7H A;  3IC8 A;  2PWJ A;  5C00 A;  1ZGN A;  4JCV E;  3LG6 A;  1GRX A;  4HUA A;  2H0I A;  2I1U A;  2HRA A;  2KP2 A;  4Z2R A;  3ZFB A;  1CQG A;  1GTA A;  2JU5 A;  4XCS A;  1XVQ A;  3P7X A;  5JWO B;  2IMK A;  3P2A A;  2YN1 A;  2KP1 A;  1ERV A;  3I9V 2;  1Y6E A;  4HJM A;  4EIQ A;  2GDR A;  1A0F A;  2BTO T;  3CSI A;  3W8S A;  1B48 A;  3F3R A;  1OC9 B;  4DEJ A;  2LV3 A;  3FBV A;  4WF4 A;  2FHE A;  3FZ5 A;  2LEG A;  2XPE A;  2ON7 A;  5JCG A;  5F0G A;  5BRT A;  3LGC A;  1NW2 A;  4JE1 A;  1UVZ A;  2GSR A;  1AXD A;  4I6X A;  1FB6 A;  4ZXG A;  4MDC A;  4NV2 A;  5CRW A;  3KTL A;  1QUW A;  3TKR A;  3DD3 A;  1SK1 A;  3FHK A;  1FAA A;  2VM2 A;  2MMN A;  3GH6 A;  2PUK C;  2VIM A;  4JU5 A;  3D21 A;  3D22 A;  3DO9 A;  2C0D A;  3TCO A;  3IAM 1;  1ZZY A;  2HXK A;  3GH9 A;  4BL7 B;  2ES7 A;  5G5F A;  1PMT A;  4F0B A;  3VK9 A;  2I9H A;  3ZIV A;  1J9B A;  2GZP A;  4DSR A;  3EMX A;  2OE0 A;  1M99 A;  2NDO A;  2L5O A;  5IIZ A;  2GZY A;  2FY6 A;  3F3Q A;  1XW6 A;  2G2Q A;  1DSB A;  1ON4 A;  2X4A A;  2ZUP A;  5ENU A;  3GL5 A;  2E2G A;  2K9F A;  2M72 A;  3IC4 A;  3GIX A;  3C1S A;  3GST A;  4RI7 A;  3BOA A;  2C1Y A;  4AS2 A;  1AQX A;  3GTU A;  4DSS B;  1HD2 A;  1M0U A;  1XFL A;  1T8E B;  4TR0 A;  1TU7 A;  5GSS A;  2VCW A;  4GXT A;  1GWC A;  4RQR A;  1XWK A;  2LJR A;  3VFI A;  4HQS A;  1XIY A;  1A2L A;  1SYX A;  2GST A;  1BX9 A;  1F2E A;  3EVI A;  1FVJ A;  1SD8 A;  3DGQ A;  3QAV A;  2IWT A;  1PGT A;  1URM A;  1EOH A;  3O6T A;  3UMA A;  4PTS A;  1G0T A;  2FGX A;  4Z7X A;  1DE1 A;  3Q6O A;  1U87 A;  4A5P A;  4CW9 A;  2EIO A;  5GST A;  5J4U A;  3VWX A;  2OBI A;  5J9B A;  1RQM A;  2MJF B;  2O8V B;  1PX7 A;  1O6J A;  3FW2 A;  2RLI A;  3KJY A;  1EEM A;  3J7Y k;  1TK8 B;  1G6W A;  2YFA A;  4AJ6 A;  3UBK A;  1PL2 A;  4PL4 A;  4HU7 A;  3LSZ A;  4PL5 A;  1SKS B;  4MNN A;  4X4J A;  2WRT A;  5BMU A;  4EIP A;  3VPQ A;  4F9Z A;  2V1M A;  4CY6 A;  3KXO A;  2YWO A;  18GS A;  2PU9 C;  3UJ1 A;  2CVB A;  1ZYQ B;  7GSS A;  1O8X A;  4MH3 A;  5IMD A;  2E0Q A;  3TKS E;  3DA4 A;  5D73 A;  3M0F A;  3WGE A;  4DSQ A;  2RIO A;  2AYT A;  1EV4 A;  2LNT A;  1IYH A;  3F6D A;  2LJA A;  5D9X A;  1S3A A;  4PQH A;  3E3E A;  5ECO B;  4V1A g;  1R4W A;  5ID2 A;  4I1T A;  3I69 A;  2X8H A;  1HYU A;  5G2Z A;  1V57 A;  2AHE A;  4XS1 A;  4ZL9 A;  4POM A;  1B4Q A;  5KN2 A;  2N5A A;  2RUF A;  2DBC A;  6GSX A;  1M2B A;  2WS2 A;  4ILF A;  4ZIJ A;  1XWA A;  4MH2 A;  4F2I A;  1S3D A;  2GQK A;  1KBN A;  4K1F A;  5HFK A;  4ZB8 A;  2QSI A;  2CZ3 A;  3GMF A;  2JL4 A;  3A3T A;  2TIR A;  5AIV A;  3GKK A;  3EUR A;  2TRC P;  1UA5 A;  3WT1 A;  8GSS A;  1LU4 A;  3KH9 A;  5B6M A;  3QDN A;  1MTC A;  2HSH A;  4ID0 A;  1K0C A;  2CAI A;  1AQV A;  1ZMA A;  2AAW A;  2C3N A;  4O32 A;  4O5U A;  2VOC A;  3F8U A;  2H1D A;  4K0G A;  2JB2 A;  4KDY A;  5GAN D;  2QA1 A;  1FHE A;  3FR6 A;  2P22 B;  4NWY A;  4YQU A;  4FYU A;  2NPB A;  2DJ3 A;  4XS4 A;  4HQZ A;  2LKU A;  1NHY A;  5F8B A;  4RUV A;  4QL9 A;  2XBQ A;  5EVO A;  2X49 A;  4PUF C;  2P0G A;  3P23 A;  2VO4 A;  5F06 A;  4ECC A;  5D9W A;  4POL A;  3WD6 A;  3IXR A;  2LQQ A;  4L0U A;  2RII A;  3FEU A;  4D73 B;  2HZE A;  2NTO A;  1XWG A;  3F4T A;  2QGV A;  4LMV A;  6GSV A;  1TI1 A;  2FA8 A;  3GKM A;  4F03 A;  1WIK A;  1YKC A;  1ZYN A;  3TJF A;  3JCM L;  3GTU B;  3LQ7 A;  3TRX A;  5H5Q A;  4GST A;  1PX6 A;  4BA7 A;  3UAR A;  1U3A A;  1TKD B;  4KE3 A;  4E8E A;  1K0M A;  3Q74 A;  1UC7 A;  5DVB A;  3QFB C;  2PN8 A;  4EKZ A;  2GS3 A;  2IPA A;  4ICY A;  1BYE A;  1TP9 A;  4G10 A;  3LJ2 A;  4FYC A;  2DJJ A;  1TJD A;  1YY7 A;  4GQC A;  1THO A;  3TKS A;  2OE1 A;  2DKH A;  4KW6 A;  2VCV A;  3FZ9 A;  2MYG A;  9GSS A;  1SL0 B;  2A2P A;  1X5E A;  2OAC A;  4CY8 A;  3Q18 A;  2JB1 A;  3GX8 A;  3C1R A;  3C73 A;  2R3X A;  2FD3 A;  1NSW A;  2HYX A;  1A0R P;  3TKQ A;  2XC2 A;  5HR2 A;  4ZB9 A;  1Z9H A;  5DQY A;  4USS A;  3H79 A;  4PNG A;  5ECR B;  1FG4 A;  2JZS A;  1H75 A;  3PGT A;  1XVW A;  1C72 A;  5LCZ A;  1R5P A;  3EPT A;  4FIW A;  1V98 A;  3FR3 A;  1O85 A;  1G6Y A;  1XPV A;  3KMN A;  1DE2 A;  1T3B A;  2YOI A;  1EV9 A;  1GSD A;  1TTZ A;  4F0C A;  2UZ8 A;  4HJ2 A;  3WYW A;  1SJ6 A;  3R2Q A;  4G9H A;  3CTG A;  1Y25 A;  1YF1 A;  2OJL A;  3F0I A;  1PL1 A;  3F9U A;  2JAE A;  2A4H A;  2R2J A;  3G9B A;  2DJ2 A;  1O8W A;  2YZU A;  3F6F A;  4Z2U A;  5E4W A;  3ZVJ D;  2I81 A;  3QFA C;  4ZBB A;  1SD9 A;  2JAD A;  3IK9 A;  3F4S A;  4GCI A;  2FWE A;  3HXS A;  2VL2 A;  3ED3 A;  1F3A A;  2C80 A;  2HRF A;  5ID2 B;  2XPD A;  1X9S B;  4IJ3 A;  1XOA A;  1TU8 A;  3BBY A;  2C3Q A;  2HI7 A;  1OKT A;  4TR4 A;  3W8J A;  3ZLP A;  4Q5R A;  5IMC A;  5B7C A;  2R0G A;  3LYP A;  12GS A;  4ZL8 A;  3IHQ A;  6GSY A;  2K18 A;  22GS A;  5HFG A;  4ECB A;  3IAS 2;  1SJI A;  1V40 A;  4K6X A;  1LBK A;  4DWL A;  1BED A;  5ECP B;  2PMT A;  4CDO A;  5ECK B;  3CRU A;  2HRN A;  5EY6 A;  4Q5F A;  3GL3 A;  1XCC A;  5J9C A;  4G0K A;  4IN0 A;  5ECM B;  1THX A;  4WBR D;  4MF5 A;  1WRY A;  1YJ6 A;  3TRP A;  1K0A A;  3HY2 A;  5AGY A;  1B9Y C;  5B8B A;  1GNE A;  1HQO A;  2O7K A;  2YFB A;  4Q9V A;  1Z5Y E;  3A5W A;  4EVM A;  3BJ5 A;  4HU9 A;  2M80 A;  4O1O A;  5JWQ B;  4WR4 A;  4N0Z A;  1YQ1 A;  4KAE A;  4XHM A;  1A23 A;  2XHF A;  2VCT A;  5B6N A;  5ECH B;  3JSB A;  4PQ1 A;  1OAZ A;  4GF0 A;  1T00 A;  3ZMK A;  1WPI A;  2P5Q A;  3GYK A;  4NPB A;  2H6Y A;  3DA3 A;  3ISO A;  4BWQ A;  2GZZ A;  2PVO C;  3HVX A;  4GRF A;  2MMZ A;  5G31 A;  4PUR A;  3UBL A;  5A4W A;  2CAQ A;  17GS A;  3Q19 A;  3MYD A;  1PKW A;  3LW9 A;  2EIR A;  3KIJ A;  1QK8 A;  2KHP A;  3D0Z A;  4G0L A;  1GSY A;  4BPY A;  3LYK A;  3MWH A;  2AUV A;  4E8H A;  1ZOF A;  2L5L A;  4JRR A;  3VWW A;  1BG5 A;  4JR6 A;  2LRT A;  4X0X A;  1OVN A;  3US3 A;  1GL8 A;  3TJK A;  1K0D A;  2YWI A;  1W3S A;  2DJK A;  3HD5 A;  4KB3 A;  1VRS D;  3KM6 A;  2H6X A;  4LA1 A;  1SK0 A;  3IDV A;  5JWR B;  1EOG A;  1GSU A;  1R7H A;  3GSS A;  4KH7 A;  2V41 A;  3CSJ A;  4X43 A;  1SKW B;  3GV1 A;  3K8N A;  3VUR A;  2C4J A;  3WGD A;  1N2A A;  2KKM A;  2C3T A;  3VA9 A;  1B8X A;  5DAL A;  2B5E A;  1J0F A;  3TKP A;  2GSQ A;  1PKZ A;  5CRH A;  4TW5 A;  1QMV A;  1VGL A;  2O89 A;  1GTB A;  1N8J A;  3KP9 A;  4V2L A;  4MP4 A;  4MK3 A;  4POK A;  3WGX A;  4MMM A;  3HA9 A;  1A2M A;  3GHA A;  4TKY A;  3ZTL A;  4BVY B;  2MBS A;  1JZO A;  3E0U A;  4H86 A;  4AJ7 A;  6GSW A;  1GSQ A;  1DBY A;  4K7O A;  3FRC A;  1M9A A;  2YWN A;  2YV7 A;  5ABR A;  2PPT A;  2I3Y A;  2KUC A;  3ZVJ A;  4IS0 A;  4V2N A;  4YKF A;  1YDK A;  1GTU A;  4ZB6 A;  2RUE A;  3TRQ A;  5ELG A;  1PRX A;  2GQL A;  2F51 A;  1Z6M A;  5KN1 A;  5DDL A;  3C8E A;  4L5O A;  3GNJ A;  4HDE A;  3KTB A;  4TXV A;  5KOX A;  1SYR A;  1F37 A;  2V1C C;  3KD0 A;  4ISD A;  5CAX A;  1GSE A;  4N0V A;  2BJX A;  5INY A;  4TN8 A;  3QD9 A;  2YV9 A;  2DKI A;  2WCI A;  3WT2 A;  3PH9 A;  11GS A;  5IMA A;  2V32 A;  3BCK A;  3H8Q A;  1J08 A;  1GUL A;  4K5R A;  4ULX A;  1IYI A;  3DYR A;  2MMO A;  2VLT A;  3IE3 A;  3DRN A;  5DBQ A;  2DC5 A;  3RPN A;  3L9S A;  3LXT A;  5DQS A;  3KH7 A;  2I4A A;  2K6V A;  4U6R A;  3IK7 A;  2K8V A;  1MD3 A;  4K5S A;  2LST A;  4NV5 A;  4Z7G A;  4BVX B;  3CSH A;  6GSU A;  1DUG A;  3EMP A;  2OA7 A;  5IO0 A;  13GS A;  1XZO A;  4V1A p;  2DSA A;  2DJ0 A;  3GRX A;  1OC8 A;  4YQM A;  4K7N A;  1MDJ A;  2L6C A;  4GXZ A;  3W6G A;  4EXJ A;  6GST A;  3G7I A;  5ELA A;  4YAP A;  2HFD A;  5IM9 A;  2H75 A;  2HSY A;  4IP1 A;  4KCA A;  5A4V A;  3EIN A;  4MJE A;  2YAN A;  1PSQ A;  4GTU A;  2OAD A;  3H93 A;  3TOT A;  4XS6 A;  4BWS A;  4K9Z A;  3RPP A;  1YEX A;  2H72 A;  4ML1 A;  2H0G A;  4OFM A;  4ECJ A;  3GA4 A;  4MZC A;  3EU4 A;  1G7E A;  3DVW A;  5IMF A;  2CQ9 A;  3PIN A;  4LL1 B;  1TRV A;  4PUA A;  2IFQ A;  2IMD A;  5JCU A;  2GVP A;  3FZA A;  3O3T A;  4QL7 A;  1T7P B;  4MJA A;  2CA8 A;  1A8Y A;  1OC9 A;  3ZRE A;  3QAG A;  2R0C A;  3TJJ A;  2O85 A;  1VF2 A;  4IQA A;  4J57 E;  5A5K A;  2LQO A;  1OC3 A;  2B5Y A;  1FB0 A;  4EDZ A;  1AW9 A;  1MEK A;  2FCH A;  5DAK A;  1GSF A;  1K3O A;  3GFK A;  1LJR A;  3A5I A;  1JFU A;  1O7U A;  2V6E A;  16GS A;  4TR1 A;  2QA2 A;  4KX4 A;  4HEA 2;  4KDU A;  5CRE A;  2RM5 A;  2MZC A;  1TOF A;  2YJH A;  4AS3 A;  2A4V A;  3PPU A;  1FO5 A;  4DVC A;  1ZYP A;  5DJM A;  3VWV A;  1ERU A;  2B1L A;  4ZBD A;  4XRD A;  3LJ0 A;  3VPT A;  4EDY A;  1K3Y A;  4FYB A;  4GSN A;  5FT3 A;  3Q8D A;  5H5S A;  2P31 A;  1XW9 A;  4TXO A;  2R6K A;  2R0P A;  2H73 A;  3DKS A;  4L8E A;  1F3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...