4NV5A

C50a mutant of synechococcus vkor, c2 crystal form (dehydrated)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
266
structure length
259
Chain Sequence
RHSRLILAILAGLGSLLTAYLTYTKLTEQPAAGGCDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPDLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPLEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VKORC1/thioredoxin domain protein
publication title Structures of an intramembrane vitamin K epoxide reductase homolog reveal control mechanisms for electron transfer.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Oxidoreductase
total genus 80
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4nv5A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nv5A02
2VCVA 4JU5A 1HNBA 2B5YA 3KTBA 3KTLA 3TKSE 4IVFA 5CRWA 5DJLA 1SK2A 3U5RE 4EL1A 2A4VA 1AC1A 3GKMA 1SKRB 2LSTA 1S3AA 1SJIA 2YP6A 3A5WA 2L6DA 1R4WA 3QOUA 1TK8B 3HZ4A 5KN3A 1GULA 2CT6A 3UVTA 2AAWA 1ZZYA 3F3QA 4IQ1A 3G7YA 4WXTA 1G0TA 5ECSA 1VF3A 2HI7A 5HFGA 2OBKA 3C7MA 2CZ2A 3TUEA 2DIYA 3GHAA 2H73A 5DAKA 2LEGA 1PX7A 2PN8A 2KP2A 4WBRD 2F3MA 2YZHA 2PGTA 1WOUA 3GMFA 1A2MA 1R5PA 1VF2A 1O6JA 2C0GA 1PN9A 3TRXA 4ECBA 3LXTA 2H70A 4ID0A 4BVYA 2J23A 5IQYA 4ZBDA 5IPHA 4DSSB 2YWMA 5AISA 1UC7A 2LUSA 3ZREA 2A2SA 1SYRA 5IMZA 1T7PB 2QC7A 5IOWA 5AGYA 1TI3A 1LJRA 2C8UA 1XW6A 4XRDA 4KUNA 2H76A 2GDRA 1ERUA 2CVBA 1WJKA 3EINA 3HCZA 3GL3A 3AY8A 4NHZA 3FYGA 2PBJA 1XBSA 2O85A 3TJGA 5J41A 4Q5QA 3PINA 3LORA 3FK8A 2YN1A 3HDCA 3P2AA 3KMNA 1SL2B 4CDOA 5DALB 1PKWA 1RK4A 3WT1A 1HNCA 3QDNA 3F6FA 1GSQA 1UN2A 2CAIA 2FNOA 4Q5NA 2AB6A 2EIOA 3DVXA 4MPFA 3VI5A 3IAS2 4MMMA 5J4UA 3KEBA 4TVEA 3F4SA 5IO2A 1F3BA 4NHWA 2QKEA 1H75A 2P5RA 4BWQA 1ZYQB 5ECPB 2O8VB 4J56E 3TJBA 1XOAA 1WRYA 2IMEA 2P0GA 1I5GA 2V2GA 1GUMA 4FYUA 4I6XA 1MD4A 1TRWA 3IK7A 1F9MA 3H8QA 3QCPA 4MJEA 5E4WA 2H71A 4BL7A 1THXA 5GAPD 5JCGA 3GSTA 1GTAA 4K0NA 3IXRA 4Q5RA 4KDXA 4POMA 1N8JA 4MDCA 1XWKA 3DEXA 4HEA2 3H1NA 2H19A 3BOAA 4IP6A 3PGTA 4FIWA 4IHUA 1GNEA 3TGZA 3E0UA 3D4TA 18GSA 5H5SA 4F2IA 1OC9B 2JU5A 3F6DA 4GCIA 3GFKA 3M1GA 3WT2A 3HVXA 2E2GA 2HLSA 1TRUA 3GX8A 1EGRA 3GA4A 4AF2A 2PUKC 1J08A 2H6YA 5IPGA 1J9BA 4O32A 4OCFA 4H86A 2DC5A 2CZ3A 2HSHA 3D6IA 5ECQB 3D5JA 1Z5YE 2G2QA 2RLIA 1THOA 3DIEA 2DBCA 3F0IA 2M46A 5CREA 2OE3A 1SD9A 6GSUA 2D2ZA 3A2XA 5HR1A 2HE3A 4AJ6A 3EE2A 4OCEA 2M72A 2LV3A 2YWIA 1PQNA 4GTUA 1OE8A 1XFLA 2KOKA 5ELGA 3ZFBA 3EC3A 1QK8A 3G7IA 3HJPA 4GF0A 4NAXA 2VM1A 3FZ9A 4MF7A 4L5LA 5FWGA 3GKKA 3DVWA 3TRQA 4EO3A 4WR5A 1LU4A 3A2WA 1K0AA 3TOTA 4FH8A 2B7KA 2H72A 1A0FA 2KHPA 5G30A 3HD5A 5ECKB 1H4OA 3CTFA 3ISOA 1AQVA 6GSVA 1QQ2A 4JEDA 4ZB8A 2WFCA 1AXDA 22GSA 4ZBBA 3GTUB 1F37A 1M2DA 4HJMA 2QGVA 1R7HA 2CV4A 1DE1A 3KCMA 3RHCA 2IN3A 3HY2A 3HKRA 1BAYA 2KLXA 3IHQA 3ZITA 2H75A 3RDWA 3MAKA 1ILOA 4HOJA 1KTEA 1EOHA 1VF1A 3HJOA 2P5QA 2V6KA 19GSA 3EMPA 1T4YA 4G19A 3NOFA 4NWYA 4WF5A 4K9ZA 2F8AA 3VPQA 1EEJA 4QQ7A 3WYWA 4N0ZA 1OKDA 3M3MA 5AIXA 4YQUA 5CRGA 4HZ4A 3NZNA 3LGCA 4KSMA 2HYXA 1O81A 4GRFA 4V1Ap 3HZ8A 4TN8A 1ERTA 4D73B 2PERA 4KGIA 1O73A 3F3RA 2FCHA 5EL8A 3MSZA 3TKSA 4WF4A 4OFTA 1U3AA 1TU8A 4MK3A 2CX3A 2IMIA 4K1FA 2GSSA 2H6ZA 4ACSA 1X9SB 5CNWA 17GSA 3P8WA 2YJ7A 1T8EB 2V41A 4ILFA 5C04A 3APOA 3ZVJA 2HZEB 1GP1A 2NDOA 4K7OA 3M8NA 3QFAC 4NV2A 4IKHA 1URMA 3BD2A 2LRTA 2N5FA 4J57E 3ZYWA 3A3TA 4WBJA 4I8BA 1PKZA 4V2MA 5D9XA 1TXXA 5AN1A 2MYGA 2O7KA 4YAVA 2YANA 1KNGA 2L4QA 2VD1A 2NTOA 4XS4B 1MDKA 3US3A 1XXUA 1YZXA 3LG6A 1F2EA 1NHOA 3QAWA 4XS1A 1AAZA 3IPZA 1WIKA 1SL1B 4MH2A 1B48A 3DMLA 2DMMA 3RPNA 1PGTA 5KN1A 4XCSA 4JZQA 4OFMA 3L4NA 2IMFA 3PR8A 10GSA 1TW9A 2B1KA 1SENA 1I9DA 2DJ1A 5C00A 1BYEA 2FHEA 1B4PA 2LQOA 3HXSA 2OA7A 4P3YB 3L0HA 5F0GA 4K2DA 2HRFA 3JCML 5DJMA 5GAND 3HVVA 5F05A 3KP8A 2JL4A 4HU9A 1V98A 1A2JA 5CYYA 2X99A 4BVXA 5G5FA 3MWHA 2VIMA 3H79A 3ZIJA 1RQMA 3FEUA 4LLRA 2YCDA 2PVQA 3EYTA 4CHSA 4XHMA 3FZ5A 5H5QA 1ERWA 3GUSA 1T1VA 3CTGA 3UEMA 4V1Ag 1FB6A 1GUKA 5KEJA 4ECCA 5GSTA 1XVQA 3GNJA 1V2AA 3MNGA 4AGSA 4RI7A 1USBA 3O6TA 1G6WA 1M2BA 1VGLA 1TU7A 2LKUA 5DDLA 2VAFA 1VF4A 3EWLA 2IMKA 16GSA 1M99A 1Z9HA 2G0FA 1K0DA 3KZQA 4YAPA 3CYNA 2XPDA 4ZL7A 1B8XA 3LQ7A 1S3CA 3TB2A 2DJ0A 4MF5A 4DVCA 1U88A 4YQVA 1MTCA 3DYRA 4KNDA 2RM5A 2LS5A 1XIYA 2IL3A 2JSYA 5ECNB 2IFQA 4I97A 3IE3A 5D96A 2LJRA 4MCUA 1ERVA 2HXKA 3VPTA 4GSTA 3GX0A 4XRAA 1QMVA 3VWVA 1ABAA 4GWRA 1XWAA 5H5RA 3IK9A 4WETA 2YZUA 2AJQB 4ISDA 2C3NA 3CXGA 1K3OA 3IBHA 1ZCPA 4FYBA 4X1UA 2JZTA 3ME7A 5ECOB 1JFUA 4PGTA 3CRTA 2DJ2A 5D9VA 3LJRA 2BJXA 1XW9A 4KSOA 4PUFC 3VK9A 1A24A 2ZNMA 2OACA 5COHA 3ZVJD 1MEKA 2WGRA 1A8YA 2YNXA 3FKFA 4ZBAA 2FWEA 5ECHB 3HA9A 1HD2A 4G10A 2OE1A 3NIVA 5KN0A 1WPIA 2NBSA 3C71A 1Z3EA 1GSUA 1YEXA 4MZWA 1T4ZA 5HR2A 2JZSA 4OO4A 3IA1A 4JR4A 1X0RA 3TKRA 1VRSD 4F0CA 3TCOA 3FRCA 2DLXA 2VM2A 4HJ2A 5JWOB 4IP1A 3C1SA 2DIZA 3VFIA 5F07A 1AUCA 1BEDA 3VWXA 3U6VA 3IV4A 1PSQA 1ML6A 5GZZB 3G7JA 1HQOA 1TRSA 4GQCA 1TJDA 13GSA 3TOUA 2VL9A 3ZMLA 3MDKA 4WEYA 4EDYA 3HHVA 4RI6A 3CSHA 5LD0A 3IC4A 2YWNA 2LJKA 1YJ6A 1W89A 3K8NA 5FT3A 3WGDA 2VLUA 1JZWA 4IQAA 2I4AA 2H01A 3GIXA 1GLQA 4IJ3A 1A2LA 3RAZA 3GURA 1ZOFA 2HZEA 1SU9A 2L5OA 3BCKA 4I5QA 4G9HA 1G7EA 2H66A 2VD0A 3QMXA 1ST9A 4KCAA 3ZIVA 1GSYA 2TRCP 1G7OA 2V6OA 5IM9A 1NHYA 3EMXA 2K9FA 1AQWA 1MDIA 2B3SA 2LTKA 2V1MA 3W8JA 4MJBA 4MF6A 3CSJA 4PURA 2VCQA 1XWBA 5L71A 3ZZXA 4XS4A 3S9FA 3ERGA 2X64A 3QAVA 5HR3A 4KE3A 2F8FA 1J0FA 2BMXA 4F03A 4ML6A 2ON5A 9GSSA 1AW9A 2EIRA 4FO5A 2MMZA 3ME8A 3L9UA 5IMCA 5DBQA 4PQIA 3N5OA 3GRXA 1B9YC 5EPFA 5G2ZA 4F0BA 1IYIA 5J9BA 4F9ZA 1K0MA 1XWCA 2PPTA 5DCGA 4TOPA 3TKPA 3KMOA 4BA7A 2HT9A 2R6KA 3DWVA 2R37A 1DBYA 1Y25A 2O89A 2WRTA 4N11A 4PQHA 2R2JA 1NSWA 4ZILA 4XS6A 4MA9A 4EVMA 5CAXA 4IW9A 1V57A 4IJIA 5DAKB 7GSSA 4KAEA 2F51A 2MMNA 1B9XC 4JE1A 3J7Yk 1T00A 3I6AA 5D9WA 5J5NA 2AV4A 4MJCA 20GSA 5B8AA 4N10A 4RQXA 3CRUA 4BWSA 1BX9A 4MPGA 5IIZA 4WKWA 4OFNA 6GSTA 2E0QA 4DSRA 5DVBA 2R5GA 3KP9A 4DEJA 1XW5A 1XVWA 3TJJA 1JZRA 2GGTA 1ON4A 4OMVA 4HZ2A 4HU7A 4BPYA 1GSSA 2VCXA 4IBPA 3Q18A 5JCUA 3DD3A 2WJUA 2VUPA 2HZFA 1HYUA 2A2RA 2GZZA 1NM3A 1Z7PA 3P90A 4WR4A 2JSZA 4ECIA 4JBBA 2K6VA 2C4JA 8GSSA 1BJXA 3WGEA 4LL4B 3F8UA 2PVOC 5IMVA 2DJJA 4FYCA 4TW5A 4MZCA 4PQ1A 1WWJA 4DSSA 3FR3A 4OWYA 3KH9A 5IMAA 4TRXA 4XTSA 2XPEA 3CSIA 4NMUA 1XOBA 1SKWB 1FVJA 1FB0A 2OJLA 2MBTA 3ERFA 2ALBA 1JLWA 1WP0A 4TXOB 2IMDA 1GSFA 1UVZA 5ECIB 1YKCA 5A5KA 3HVSA 3FY7A 2C0DA 4KB3A 3FR6A 4X43A 1HNAA 4HS1A 2PMTA 6GSSA 3IAM2 2YJHA 5G1KA 2FWGA 2QSIA 3F4RA 4MLYA 1CQGA 2RM6A 2FY6A 4KW6A 2AHEA 4TR1B 1SD8A 1SJZA 2H1AA 3APQA 1ZGNA 1WMJA 5DALA 2OKAA 3KGKA 5HR0A 2WDUA 1Y6EA 1TI1A 4IELA 2NVLA 2LNTA 4KA0A 1A8LA 2C0FA 2REMA 1EV9A 1MD3A 1V58A 4AJ7A 6GSYA 4K8MA 3UARA 5J9CA 2H0IA 3FZ4A 4MJAA 4K6XA 2ON7A 4HUAA 2EC4A 3KJYA 2N5AA 1YDKA 4E8EA 1KBNA 5A4WA 2MMOA 1X5DA 3LYPA 4POKA 1JLVA 4GLTA 5D8IA 2H1BA 5IMDA 4L0UA 2FWFA 1K0OA 4O92A 2JADA 4POLA 1QUWA 1EZKA 1C72A 2TIRA 2YV9A 1Z7RA 4MP4A 2ZCTA 1X5CA 4AJ8A 4NXIA 2GZYA 4LMVA 5CP1A 1OC9A 1XPVA 2L6CA 5AIVA 4EUYA 1K3YA 2CX4A 5ECLB 3H93A 3F63A 2CA8A 5G5EA 2GLRA 1IYHA 1GTUA 1O7UA 3L78A 1DSBA 4CW9A 1R5AA 1X9WB 2VL2C 4PNGA 3QAGA 3KIJA 4EF0A 1V40A 2XBIA 4KDUA 1QXHA 1E6BA 1M0UA 2L4CA 1PRXA 3WGXA 4V2NA 1XZOA 3UOMA 4EDZA 3RPPA 4TR3A 4YH2A 1PL2A 4E8HA 2Z9SA 4PXOA 1Z6NA 3GYKA 1CQHA 1DUGA 1KEBA 4EKZA 2C3QA 4GXZA 4NPBA 1ACVA 1W4VA 5EY6A 2OBIA 1M7TA 1OVNA 2YWOA 2K8VA 3D21A 4KDYA 5DCHA 2BTOT 1V9WA 2ZUPA 4PX1A 3FZAA 1SYXA 3QPMA 2C0EA 3UBKA 2GQLA 4Q5FA 2H8LA 4HQZA 2VLVA 2R3XA 2R4VA 2C80A 3ED3A 2OADA 4GQFA 1N2AA 2K8SA 2RUFA 3I69A 3BCIA 1XWGA 4IS0A 12GSA 11GSA 2F9SA 3UJ1A 3LXZA 4L0WA 3ZMKA 5FHIA 1GUHA 2C1YA 4ULXA 4ZL9A 5GSSA 3DRNA 5JWQB 4KCEA 1PX6A 1M2AA 2I81A 2GT6A 1MDJA 4ZB9A 1FHEA 2GQMA 2WS2A 1GRXA 4DSQA 2E7PA 3GTUA 1EV4A 5B8BA 1R26A 1YF1A 1F6MC 1A23A 1TTZA 4TXVA 3ZLPA 2X8HA 3QFBC 3FW2A 4EXJA 1QFNA 1SK0A 3KM6A 4I2UA 2WZ9A 3TJFA 6GSWA 3FR9A 3DXBA 1K3LA 1SJ6A 2J9HA 3DGQA 2L57A 2C3TA 3TRPA 2GVPA 1SK1A 4ZXGA 1YQ1A 5B6MA 1GLPA 1TKDB 1JZDA 3ZRDA 3LSZA 3L9SA 2VL2A 1Q98A 1FG4A 3F4TA 3GH6A 1AIUA 1NW2A 2MZCA 3QD9A 5HFIA 3P7XA 4KX4A 3SWLA 5DQSA 5A4UA 2K18A 3I43A 3EU3A 1LBKA 4D73A 5IO0A 2B1LA 4K7NA 1YKAA 1PD21 5ID2B 4TXOA 2IWTA 1K0NA 3APSA 5ECRB 1S3DA 5LCZA 4HDEA 1ZYEA 2O87A 1QGVA 5CRDA 5LNKe 1GTBA 1AQXA 1M9BA 5CRHA 2CVDA 1PA3A 3C73A 5G1LA 2TRXA 3TJKA 1K0CA 3W6GA 3UIWA 1WE0A 3RHBA 2DJKA 4TR1A 2OE0A 2LQQA 2HSYA 4LA1A 4X0XA 5INYA 5IMFA 1JHBA 1PMTA 2IPAA 4QL9A 2LRNA 3HJMA 5ECMB 1GNWA 2X8GA 2B5EA 4ECJA 1U6TA 2E2MA 3HYPA 3GKXA 3CMIA 4K0GA 5G31A 3GL5A 4J2FA 1FO5A 2RIIA 4O5RA 2HNLA 2L59A 3ERWA 3IOSA 3IRAA 3KH7A 2ES7A 3C1RA 3J7Yb 2YPMA 1UA5A 2HRNA 4O7HA 3BBYA 5B6NA 2MBSA 3GN3A 2GSQA 3GV1A 2HFDA 3O76A 1SKSB 1GWCA 1DE2A 2PWJA 2GTUA 1GTIA 3C8EA 2H1DA 1ZL9A 2FD3A 3A2VA 3KD0A 2WULA 2GS3A 4ML1A 1FAAA 3PH9A 4IGJA 3R2QA 2VL3A 4MABA 3DKSA 2JZRA 4ZB6A 4TR0A 5JWRB 2VCTA 3ZFLA 3W8SA 4MH3A 1M9AA 4L8EA 3LFLA 3TKSC 5J3RA 1GH2A 5D73A 3ZTLA 5EVOA 3Q19A 3D0ZA 4ZL8A 3EVIA 4NV5A 4LMWA 4LL1B 1E2YA 1FOVA 5F8BA 2FA4A 4N30A 3M9KA 2LNSA 1EOGA 3EURA 5D93A 5IOXA 1SL0B 1FVKA 2IFQB 1JZOA 2DSAA 2H1GA 1OE7A 4TKYA 1TDIA 5HFKA 2VO4A 2NPBA 3M0FA 2FLSA 2B7JA 3M9JA 3LYKA 1O8WA 14GSA 1GSDA 2JACA 5ABRA 1EP8A 4HI7A 2LRCA 3TKQA 1OKTA 1RW1A 4EC0A 2AYTA 3I9V2 4Z7XA 2GSRA 3BJ5A 4K7IA 6GSXA 5HQPA 2CVKA 4TR4A 3H4KA 2L5LA 2MMAA 1OYJA 3L9VA 1F3AA 3VI7A 2FWHA 2CAQA 4RUVA 3GH9A 2WCIA 4JR6A 1X9MB 3VURA 3OR5A 2I3YA 3TDGA 1OC8A 4RQRA 3N9JA 2H0HA 4N0VA 5KN2A 3VLNA 2I1UA 5B7CA 2YOIA 3IDVA 3KXOA 4OD7A 3UAPA 1TK0B 2FUG2 1T3BA 1O85A 1GSEA 4JRRA 3ZL5A 2KUCA 4G2EA 5ELAA 4HQSA 1EEMA 4ZIJA 1FW1A 3Q74A 4V2LA 3QR6A 1YY7A 4QL7A 1K0BA 4F82A 1EWXA 2I9HA 5DQYA 1TOFA 2H0GA 2RUEA 2M80A 1OC3A 5JCWA 3IR4A 2GZPA 1G6YA 3UBLA 3VWUA 1U3IA 4YQMA 2IIYA 2KP1A 1EGOA 3G9BA 1A0RP 2FA8A 3LEFA 2N5BA 2EIQA 4EE0A 1OAZA 3GSSA 2WB9A 2DMLA 2AUVA 3SBCA 4MZBA 1YEPA 4OO5A 2VLTA 5F06A 4I2TA 1X5EA 2YV7A 3CBUA 1Q4JA 3FHKA 1B4QA 2XC2A 5ID2A 1XCCA 2B6MA 2FGXA 5D9TA 1TP9A 2H6XA 4XIHA 1ZMAA 1GL8A 2H74A 3F9UA 2GQKA 3UL3A 4KH7A 4PNFA 3O3TA 3D4MA 1U87A 4L5OA 2XBQA 5A4VA 4POBA 2VCWA 3D22A 3V1WA 2H30A 1O8XA 3E3EA 3RBTA 1YF0A 2GT5A 2VOCA 3VWWA 4GSSA 1BG5A 3UMAA 3LWAA 3EU4A 2LJAA 5CO3A 3GKNA 3Q6OA 2PU9C 3UVHA 2VCZA 4GSNA 2DJ3A 2CQ9A 2P31A 5E59A 2GSTA 2X8CA 3E9JB 1TK5B 2V32A 2B5XA 1EP7A 4PUAA 4IN0A 1TRVA 3WD6A 2IJYA 1PL1A 1Z6MA 2XHFA 1BQ7A 5ENUA
chains in the Genus database with same CATH superfamily
2VCVA 4JU5A 1HNBA 2B5YA 3KTBA 3KTLA 3TKSE 4IVFA 5CRWA 5DJLA 1SK2A 3U5RE 4EL1A 2A4VA 1AC1A 3GKMA 1SKRB 2LSTA 1S3AA 1SJIA 2YP6A 3A5WA 2QGMA 2L6DA 1R4WA 3QOUA 2DKHA 1TK8B 3HZ4A 5KN3A 1GULA 2CT6A 3UVTA 2AAWA 1ZZYA 3F3QA 4IQ1A 3G7YA 4WXTA 1G0TA 5ECSA 1VF3A 2HI7A 5HFGA 2OBKA 3C7MA 2CZ2A 3TUEA 2DIYA 3GHAA 2H73A 5DAKA 2LEGA 4I1TA 1PX7A 2PN8A 2KP2A 4WBRD 2F3MA 2YZHA 2PGTA 1XG8A 1WOUA 3GMFA 1A2MA 1R5PA 1VF2A 1O6JA 2C0GA 1PN9A 3TRXA 4ECBA 3LXTA 2H70A 3FVVA 4ID0A 4BVYA 2J23A 5IQYA 4ZBDA 5IPHA 4DSSB 2YWMA 5AISA 2XTRA 1UC7A 2LUSA 3ZREA 2A2SA 1SYRA 5IMZA 1T7PB 2QC7A 5IOWA 5AGYA 4A5PA 1TI3A 1LJRA 2C8UA 1XW6A 4XRDA 4KUNA 2H76A 2GDRA 1ERUA 2CVBA 1WJKA 3EINA 4PL4A 3HCZA 3GL3A 3AY8A 4NHZA 3FYGA 2PBJA 1XBSA 2O85A 3TJGA 5J41A 4Q5QA 3PINA 3LORA 3FK8A 2YN1A 3HDCA 3P2AA 3KMNA 1SL2B 4CDOA 5DALB 1PKWA 1S3RA 2A2CA 1RK4A 3WT1A 1HNCA 3QDNA 3F6FA 1GSQA 1UN2A 2CAIA 2FNOA 4Q5NA 2AB6A 2EIOA 3DVXA 4MPFA 3VI5A 3IAS2 4MMMA 5J4UA 3KEBA 4TVEA 3F4SA 5IO2A 2R0GA 1F3BA 4NHWA 2QKEA 1H75A 2P5RA 4BWQA 1ZYQB 5ECPB 2O8VB 4J56E 3TJBA 1XOAA 1WRYA 2IMEA 2P0GA 1I5GA 2V2GA 1GUMA 4FYUA 4I6XA 1MD4A 1TRWA 3IK7A 1F9MA 3H8QA 3QCPA 4MJEA 5E4WA 2H71A 4BL7A 1THXA 5GAPD 5JCGA 3GSTA 1GTAA 4K0NA 2ZRRA 3IXRA 4Q5RA 2X4AA 4KDXA 4POMA 1N8JA 4MDCA 1XWKA 3DEXA 4HEA2 2HRKA 3H1NA 4O1PA 5HGIA 2H19A 3BOAA 4IP6A 4G76A 3PGTA 4FIWA 4IHUA 1GNEA 3TGZA 3E0UA 3D4TA 3LW9A 4YZDA 3IAS1 18GSA 5H5SA 4F2IA 1OC9B 3FNBA 2JU5A 3F6DA 4GCIA 3IHGA 3GFKA 3M1GA 3WT2A 3HVXA 4BVXB 2E2GA 2HLSA 1TRUA 3GX8A 3Q8DA 1EGRA 3GA4A 2XTQA 4AF2A 2PUKC 1J08A 2H6YA 5IPGA 1J9BA 4O32A 4OCFA 4H86A 2DC5A 2CZ3A 2HSHA 3D6IA 3D5JA 5ECQB 1Z5YE 2G2QA 2RLIA 1THOA 3DIEA 2DBCA 3F0IA 2M46A 5CREA 2OE3A 1SD9A 4O5QA 2JB2A 6GSUA 2D2ZA 3A2XA 5BMUA 5HR1A 2HE3A 3IC8A 4AJ6A 4HEA1 3EE2A 4OCEA 2M72A 2LV3A 2YWIA 1PQNA 4GTUA 1OE8A 1XFLA 2KOKA 5ELGA 3ZFBA 3EC3A 1QK8A 3G7IA 3HJPA 4GF0A 4NAXA 2VM1A 3FZ9A 4MF7A 4L5LA 5FWGA 3GKKA 4YKFA 3DVWA 3TRQA 4EO3A 4WR5A 1LU4A 3A2WA 2HSMA 1K0AA 3TOTA 4FH8A 2B7KA 2H72A 2X49A 1A0FA 2KHPA 3MYDA 5G30A 3HD5A 5ECKB 1H4OA 3CTFA 3ISOA 1AQVA 6GSVA 1QQ2A 4JEDA 4MNNA 4ZB8A 2WFCA 1AXDA 3F4MA 22GSA 4ZBBA 3GTUB 1M3JA 1F37A 1M2DA 4HJMA 3AJFA 2QGVA 1R7HA 2CV4A 1DE1A 3KCMA 3RHCA 2IN3A 3HY2A 3HKRA 1BAYA 2KLXA 3IHQA 3ZITA 2H75A 2V6EA 3RDWA 3MAKA 1ILOA 4HOJA 1KTEA 1EOHA 1VF1A 4Z7GA 2P5QA 2V6KA 3HJOA 19GSA 3EMPA 1T4YA 4G19A 3NOFA 4NWYA 4Z2TA 4WF5A 4Z2RA 4K9ZA 2F8AA 3VPQA 1EEJA 4QQ7A 3WYWA 4N0ZA 1OKDA 3M3MA 5AIXA 4YQUA 5CRGA 4HZ4A 3NZNA 3LGCA 4KSMA 2HYXA 1O81A 4GRFA 4V1Ap 3HZ8A 4TN8A 1ERTA 4D73B 2PERA 4KGIA 1O73A 3F3RA 2FCHA 5EL8A 3MSZA 3TKSA 4WF4A 4OFTA 1U3AA 1TU8A 4MK3A 2CX3A 2IMIA 4K1FA 2GSSA 2H6ZA 4ACSA 2XMXA 1X9SB 5CNWA 17GSA 3P8WA 2RIOA 2YJ7A 1T8EB 2V41A 4ILFA 5C04A 1PFOA 2JB1A 3APOA 3ZVJA 2HZEB 1GP1A 2NDOA 4K7OA 3M8NA 3QFAC 4NV2A 4IKHA 1URMA 3BD2A 2LRTA 2N5FA 2KKMA 4J57E 2V1CC 3ZYWA 2JB3A 3A3TA 4WBJA 4I8BA 3FMWA 1PKZA 4V2MA 5D9XA 1TXXA 5AN1A 2MYGA 2O7KA 4YAVA 2YANA 1KNGA 2L4QA 2VD1A 2NTOA 4XS4B 1MDKA 3US3A 1XXUA 1YZXA 3LG6A 1F2EA 1NHOA 3QAWA 4XS1A 1AAZA 3IPZA 1WIKA 1SL1B 4MH2A 1B48A 3DMLA 2DMMA 3RPNA 1PGTA 5KN1A 4XCSA 4JZQA 4OFMA 3L4NA 2IMFA 3PR8A 10GSA 1TW9A 2B1KA 1SENA 5KOWA 1I9DA 2DJ1A 5C00A 1BYEA 2FHEA 1B4PA 1PN0A 2LQOA 3HXSA 2OA7A 4P3YB 3L0HA 5F0GA 4K2DA 4K5RA 2HRFA 3JCML 5DJMA 5GAND 3HVVA 5F05A 3KP8A 1JQOA 2JL4A 4HU9A 1V98A 1A2JA 5CYYA 2X99A 4BVXA 5G5FA 3MWHA 2VIMA 3H79A 3ZIJA 4Z2UA 1RQMA 3FEUA 4LLRA 2YCDA 2PVQA 3EYTA 4CHSA 4XHMA 3FZ5A 5H5QA 1ERWA 3GUSA 1T1VA 3CTGA 3UEMA 4V1Ag 1FB6A 1GUKA 3CQFA 5KEJA 4ECCA 5GSTA 1XVQA 3GNJA 1V2AA 3MNGA 4AGSA 4RI7A 1USBA 3O6TA 1G6WA 1M2BA 1VGLA 1TU7A 2LKUA 5DDLA 2VAFA 1VF4A 3EWLA 2IMKA 16GSA 2YFAA 1M99A 1Z9HA 2G0FA 1K0DA 3KZQA 4YAPA 3CYNA 2XPDA 4ZL7A 1B8XA 3LQ7A 1S3CA 3TB2A 2DJ0A 4MF5A 4DVCA 1U88A 4YQVA 1MTCA 2DKIA 3DYRA 4KNDA 2RM5A 2LS5A 1XIYA 2IL3A 2YFBA 2JSYA 5ECNB 2IFQA 4I97A 3IE3A 5D96A 2LJRA 4MCUA 1ERVA 2HXKA 3VPTA 4GSTA 3GX0A 3HVNA 4XRAA 1QMVA 3VWVA 1ABAA 4GWRA 1XWAA 5H5RA 3IK9A 4WETA 2YZUA 2AJQB 4ISDA 2C3NA 3CXGA 1K3OA 3IBHA 1ZCPA 4FYBA 4X1UA 2JZTA 3ME7A 5ECOB 4U6RA 1JFUA 4PGTA 3CRTA 2DJ2A 5D9VA 3LJRA 3A5IA 5LNK1 2BJXA 1XW9A 4KSOA 4PUFC 3VK9A 1A24A 2ZNMA 2OACA 5COHA 3ZVJD 4CY8A 1MEKA 2WGRA 1A8YA 2YNXA 3FKFA 4ZBAA 2FWEA 5ECHB 3HA9A 1HD2A 4G10A 2OE1A 3NIVA 3EPTA 5KN0A 1WPIA 2NBSA 3C71A 1Z3EA 1GSUA 1YEXA 4MZWA 1T4ZA 5HR2A 2JZSA 4OO4A 3IA1A 4JR4A 1X0RA 3TKRA 1VRSD 4F0CA 3TCOA 3FRCA 2DLXA 2VM2A 4HJ2A 5JWOB 4IP1A 2R0CA 3C1SA 2DIZA 3VFIA 5F07A 4K5SA 1AUCA 1BEDA 3VWXA 3U6VA 3IV4A 1PSQA 1ML6A 5GZZB 3G7JA 1HQOA 1TRSA 4GQCA 1TJDA 13GSA 3TOUA 2VL9A 3ZMLA 3MDKA 4WEYA 4EDYA 3HHVA 4RI6A 3CSHA 5LD0A 3IC4A 2YWNA 2LJKA 1YJ6A 1W89A 3K8NA 5FT3A 3WGDA 2VLUA 1JZWA 4IQAA 2I4AA 2H01A 3GIXA 1GLQA 4IJ3A 1A2LA 5KOXA 3RAZA 3GURA 1ZOFA 2HZEA 1SU9A 2L5OA 3DO9A 3BCKA 4I5QA 4G9HA 1G7EA 2H66A 2VD0A 3QMXA 1ST9A 4KCAA 3ZIVA 1GSYA 2TRCP 1G7OA 2V6OA 5IM9A 3B55A 1NHYA 3EMXA 2K9FA 1AQWA 1MDIA 2B3SA 2LTKA 2V1MA 3W8JA 4MJBA 4MF6A 3CSJA 4PURA 2VCQA 1XWBA 1W3SA 5L71A 3ZZXA 4XS4A 3S9FA 3ERGA 2X64A 3QAVA 5HR3A 4KE3A 2F8FA 1J0FA 4CY6A 2BMXA 4F03A 4ML6A 2ON5A 9GSSA 1AW9A 2EIRA 4FO5A 2IP6A 2MMZA 3ME8A 3L9UA 4O1OA 5IMCA 5DBQA 4PQIA 3N5OA 3GRXA 4DWLA 1B9YC 5EPFA 5G2ZA 4F0BA 2K19A 4AS2A 1IYIA 5J9BA 4F9ZA 1K0MA 1XWCA 2PPTA 5DCGA 4TOPA 3TKPA 4BIKA 3KMOA 4BA7A 2HT9A 2RLDA 2R6KA 3DWVA 4G0KA 2R37A 4G75A 1DBYA 1Y25A 2O89A 2WRTA 4N11A 4PQHA 2R2JA 1NSWA 4ZILA 4XS6A 3LJ0A 4MA9A 4EVMA 5CAXA 4IW9A 1V57A 4IJIA 5DAKB 7GSSA 4KAEA 2F51A 2MMNA 1B9XC 4JE1A 3J7Yk 1T00A 3I6AA 5D9WA 5J5NA 2AV4A 4MJCA 20GSA 5B8AA 4N10A 2CAZB 4RQXA 3CRUA 4BWSA 2RADA 1BX9A 4MPGA 5IIZA 4WKWA 4OFNA 6GSTA 2E0QA 3R3EA 4DSRA 5DVBA 2R5GA 3KP9A 4DEJA 1XW5A 1XVWA 3TJJA 1JZRA 2ZW3A 2GGTA 1ON4A 4OMVA 4HZ2A 4HU7A 4BPYA 1GSSA 2VCXA 4IBPA 3Q18A 5JCUA 3DD3A 2WJUA 2VUPA 2HZFA 1HYUA 4ICYA 2A2RA 2GZZA 1NM3A 1Z7PA 3P90A 4WR4A 2QA1A 2JSZA 4ECIA 4JBBA 2K6VA 2C4JA 8GSSA 1BJXA 3WGEA 4LL4B 3F8UA 2PVOC 5IMVA 2DJJA 4FYCA 4TW5A 4MZCA 4PQ1A 1WWJA 4DSSA 3FR3A 4OWYA 3KH9A 2HRAA 5IMAA 4TRXA 4XTSA 2XPEA 3CSIA 4NMUA 1XOBA 1SKWB 1FVJA 1SJ8A 1FB0A 2OJLA 2MBTA 3ERFA 2ALBA 1JLWA 1WP0A 3SDJA 4TXOB 3I9V1 2IMDA 1GSFA 4JCVE 1UVZA 5ECIB 1YKCA 5A5KA 3HVSA 3FY7A 2C0DA 4KB3A 3FR6A 4X43A 1HNAA 4HS1A 2PMTA 6GSSA 3IAM2 2YJHA 5G1KA 2FWGA 2QSIA 3F4RA 4MLYA 1CQGA 2RM6A 2FY6A 4KW6A 2AHEA 4TR1B 1SD8A 1SJZA 2H1AA 2FU2A 3APQA 4O5UA 1ZGNA 1WMJA 5DALA 2OKAA 3KGKA 2JAEA 5HR0A 2WDUA 4BL7B 1Y6EA 3L0IA 1TI1A 4GXTA 4IELA 2NVLA 2LNTA 4KA0A 1A8LA 2C0FA 2REMA 2FUG1 1EV9A 1MD3A 1V58A 4AJ7A 6GSYA 4K8MA 3UARA 5J9CA 2H0IA 3MIXA 4YZ9A 3FZ4A 4MJAA 4K6XA 2ON7A 4G0LA 4HUAA 2EC4A 3KJYA 2N5AA 1YDKA 4E8EA 3IAM1 1KBNA 5A4WA 2MMOA 1X5DA 3LYPA 3DA3A 4POKA 1JLVA 4GLTA 1ZYNA 5D8IA 2H1BA 5IMDA 4L0UA 2FWFA 1K0OA 4O92A 4EIQA 2JADA 4POLA 3VA9A 1QUWA 1EZKA 1C72A 2TIRA 2YV9A 1Z7RA 4MP4A 2ZCTA 1X5CA 4AJ8A 4NXIA 2GZYA 2A2PA 4LMVA 1OC9A 5CP1A 1XPVA 2L6CA 5AIVA 4EUYA 1K3YA 2CX4A 5ECLB 3H93A 3F63A 2CA8A 5G5EA 4Z7HA 4Q9VA 2GLRA 1IYHA 4PTSA 1GTUA 1O7UA 3L78A 1DSBA 4CW9A 1R5AA 1X9WB 2VL2C 4PNGA 3QAGA 3KIJA 4EF0A 1V40A 3UITA 2XBIA 4KDUA 1QXHA 1E6BA 1M0UA 2L4CA 1PRXA 3WGXA 4V2NA 1XZOA 3UOMA 2UZ8A 4EDZA 3RPPA 4TR3A 4YH2A 1PL2A 4E8HA 2Z9SA 4PXOA 1Z6NA 3GYKA 1CQHA 1DUGA 1KEBA 4EKZA 2C3QA 4GXZA 4AS3A 4NPBA 1ACVA 1W4VA 5EY6A 2OBIA 2MJFB 1M7TA 1OVNA 2YWOA 2K8VA 3D21A 4KDYA 5DCHA 2BTOT 1V9WA 2ZUPA 3FBVA 4PX1A 3FZAA 1SYXA 3QPMA 2C0EA 3UBKA 2GQLA 4Q5FA 2H8LA 4HQZA 2VLVA 2R3XA 2HGKA 2R4VA 2C80A 3ED3A 2OADA 4GQFA 1N2AA 2K8SA 2RUFA 3I69A 3BCIA 1XWGA 4IS0A 12GSA 11GSA 2F9SA 3UJ1A 3LXZA 4L0WA 3ZMKA 2A4HA 4FQUA 1U5KA 5FHIA 1GUHA 2C1YA 4ULXA 4ZL9A 5GSSA 3DRNA 5JWQB 4KCEA 1PX6A 1M2AA 2I81A 2GT6A 1MDJA 4ZB9A 1FHEA 2GQMA 2WS2A 1GRXA 4DSQA 2E7PA 3GTUA 1EV4A 5B8BA 1R26A 1YF1A 1F6MC 1A23A 1TTZA 4TXVA 3ZLPA 2X8HA 3QFBC 3FW2A 4EXJA 4OAUC 1QFNA 1SK0A 3KM6A 4I2UA 2WZ9A 3TJFA 6GSWA 3FR9A 3DXBA 1K3LA 2QZGA 1SJ6A 2J9HA 3DGQA 2L57A 2C3TA 3TRPA 2GVPA 4G0IA 1SK1A 4ZXGA 1YQ1A 5B6MA 1GLPA 1TKDB 1JZDA 3ZRDA 3LSZA 3L9SA 2VL2A 1Q98A 1FG4A 3F4TA 3GH6A 1AIUA 1NW2A 2MZCA 3QD9A 5HFIA 3P7XA 2E8GA 4KX4A 3SWLA 5DQSA 5A4UA 2K18A 3I43A 3EU3A 1FOHA 1LBKA 2A2DA 4D73A 5IO0A 2B1LA 4K7NA 1YKAA 1PD21 4HFVA 5ID2B 4TXOA 2IWTA 1K0NA 3APSA 5ECRB 1S3DA 5LCZA 4HDEA 1ZYEA 2O87A 1QGVA 5CRDA 5LNKe 4USSA 1GTBA 3DA4A 1AQXA 1M9BA 5CRHA 2CVDA 1PA3A 1ZYPA 3C73A 5G1LA 2TRXA 3TJKA 2FEFA 1K0CA 3W6GA 3UIWA 1WE0A 3RHBA 2DJKA 4TR1A 2OE0A 2LQQA 2HSYA 4LA1A 4X0XA 5INYA 5IMFA 1JHBA 1PMTA 2IPAA 4QL9A 2LRNA 3HJMA 5ECMB 1GNWA 1YO7A 2X8GA 2B5EA 4ECJA 1U6TA 2E2MA 3HYPA 3GKXA 3CMIA 4K0GA 5G31A 3GL5A 4J2FA 1FO5A 2RIIA 4O5RA 2HNLA 2L59A 3ERWA 3IOSA 3IRAA 3KH7A 2ES7A 3C1RA 2P22B 3J7Yb 2YPMA 3P23A 4YKGA 1UA5A 2HRNA 4O7HA 3BBYA 5B6NA 1M3IA 2MBSA 2F66B 3GN3A 2GSQA 3GV1A 2HFDA 3O76A 1SKSB 1GWCA 1DE2A 2PWJA 2GTUA 1GTIA 3C8EA 2H1DA 1ZL9A 2FD3A 3A2VA 3KD0A 2WULA 4PL5A 2GS3A 4ML1A 1FAAA 3PH9A 4IGJA 2BL7A 3R2QA 2VL3A 4MABA 3DKSA 2JZRA 4ZB6A 4TR0A 5JWRB 2VCTA 3ZFLA 3W8SA 4MH3A 1M9AA 4L8EA 3LFLA 3TKSC 5J3RA 1GH2A 5D73A 3ZTLA 5EVOA 3Q19A 3D0ZA 4ZL8A 3EVIA 4NV5A 4LMWA 4LL1B 1E2YA 1FOVA 5F8BA 2FA4A 4N30A 3M9KA 2LNSA 1EOGA 3EURA 5D93A 5IOXA 1SL0B 1FVKA 2IFQB 1JZOA 2DSAA 2H1GA 1OE7A 4TKYA 1TDIA 5HFKA 2VO4A 2NPBA 3M0FA 2FLSA 2B7JA 3M9JA 3LYKA 1O8WA 14GSA 1GSDA 3LJ1A 2JACA 5ABRA 1EP8A 4HI7A 4BVYB 2LRCA 3TKQA 1OKTA 1RW1A 4EC0A 2AYTA 3I9V2 4Z7XA 2GSRA 3BJ5A 4K7IA 6GSXA 5HQPA 2CVKA 4TR4A 3H4KA 2L5LA 2MMAA 2BL8A 1OYJA 3L9VA 1F3AA 3VI7A 2FWHA 2CAQA 4RUVA 3GH9A 2WCIA 4JR6A 1X9MB 3VURA 3OR5A 2I3YA 3TDGA 4KF9A 1OC8A 4RQRA 3N9JA 4EIPA 2H0HA 4N0VA 5KN2A 3VLNA 3LJ2A 2I1UA 5B7CA 2YOIA 3IDVA 2QA2A 3KXOA 4OD7A 3UAPA 1TK0B 2FUG2 1T3BA 1O85A 4JRRA 1GSEA 3ZL5A 2KUCA 4G2EA 5ELAA 4OAVB 4HQSA 1EEMA 4ZIJA 1FW1A 3PPUA 3Q74A 4V2LA 3QR6A 1YY7A 4QL7A 1K0BA 4F82A 1EWXA 2QSBA 2I9HA 2ETDA 5DQYA 1TOFA 2H0GA 2RUEA 2M80A 1OC3A 5JCWA 3IR4A 2GZPA 1G6YA 3UBLA 3VWUA 1U3IA 4YQMA 2IIYA 2KP1A 2L1LB 1EGOA 3G9BA 1A0RP 2JBWA 2FA8A 3LEFA 2N5BA 2EIQA 4EE0A 4X4JA 1OAZA 3GSSA 2WB9A 2DMLA 2AUVA 3SBCA 4MZBA 1TDPA 1YEPA 4OO5A 2VLTA 5F06A 4I2TA 1X5EA 2YV7A 3CBUA 1Q4JA 3FHKA 2R0PA 1B4QA 2XC2A 5ID2A 1XCCA 2B6MA 2FGXA 5D9TA 1TP9A 2H6XA 4XIHA 1ZMAA 1GL8A 2H74A 3F9UA 2GQKA 3UL3A 4KH7A 4PNFA 3O3TA 3D4MA 1U87A 4L5OA 3JSBA 2XBQA 5A4VA 4POBA 4HSCX 2VCWA 3D22A 3V1WA 2H30A 1O8XA 3E3EA 3RBTA 1YF0A 5BRTA 2GT5A 2VOCA 3VWWA 4GSSA 1BG5A 3UMAA 3LWAA 3EU4A 2LJAA 5CO3A 3GKNA 4PL3A 3Q6OA 2PU9C 3UVHA 2VCZA 4GSNA 2DJ3A 2GSCA 2CQ9A 2P31A 5E59A 2F6MB 2GSTA 2X8CA 3E9JB 1TK5B 2V32A 2B5XA 1EP7A 4PUAA 4IN0A 1TRVA 3WD6A 2IJYA 1PL1A 1Z6MA 4YZCA 2XHFA 1BQ7A 5ENUA 4K2XA
chains in the Genus database with same CATH topology
2VCVA 4JU5A 1HNBA 2B5YA 3KTBA 3KTLA 3TKSE 4IVFA 5CRWA 5DJLA 1SK2A 3U5RE 4EL1A 2A4VA 1AC1A 3GKMA 1SKRB 2LSTA 1S3AA 1SJIA 2YP6A 3A5WA 2L6DA 1R4WA 3QOUA 2DKHA 1TK8B 3HZ4A 5KN3A 1GULA 2CT6A 3UVTA 2AAWA 1ZZYA 3F3QA 4IQ1A 3G7YA 4WXTA 1G0TA 5ECSA 1VF3A 2HI7A 5HFGA 2OBKA 3C7MA 2CZ2A 3TUEA 2DIYA 3GHAA 2H73A 5DAKA 2LEGA 4I1TA 1PX7A 2PN8A 2KP2A 4WBRD 2F3MA 2YZHA 2PGTA 1WOUA 3GMFA 1A2MA 1R5PA 1VF2A 1O6JA 2C0GA 1PN9A 3TRXA 4ECBA 3LXTA 2H70A 4ID0A 4BVYA 2J23A 5IQYA 4ZBDA 5IPHA 4DSSB 2YWMA 5AISA 2XTRA 1UC7A 2LUSA 3ZREA 2A2SA 1SYRA 5IMZA 1T7PB 2QC7A 5IOWA 5AGYA 4A5PA 1TI3A 1LJRA 2C8UA 1XW6A 4XRDA 4KUNA 2H76A 2GDRA 1ERUA 2CVBA 1WJKA 3EINA 4PL4A 3HCZA 3GL3A 3AY8A 4NHZA 3FYGA 2PBJA 1XBSA 2O85A 3TJGA 5J41A 4Q5QA 3PINA 3LORA 3FK8A 2YN1A 3HDCA 3P2AA 3KMNA 1SL2B 4CDOA 5DALB 1PKWA 2A2CA 1RK4A 3WT1A 1HNCA 3QDNA 3F6FA 1GSQA 1UN2A 2CAIA 2FNOA 4Q5NA 2AB6A 2EIOA 3DVXA 4MPFA 3VI5A 3IAS2 4MMMA 5J4UA 3KEBA 4TVEA 3F4SA 5IO2A 2R0GA 1F3BA 4NHWA 2QKEA 1H75A 2P5RA 4BWQA 1ZYQB 5ECPB 2O8VB 4J56E 3TJBA 1XOAA 1WRYA 2IMEA 2P0GA 1I5GA 2V2GA 1GUMA 4FYUA 4I6XA 1MD4A 1TRWA 3IK7A 1F9MA 3H8QA 3QCPA 4MJEA 5E4WA 2H71A 4BL7A 1THXA 5GAPD 5JCGA 3GSTA 1GTAA 4K0NA 2ZRRA 3IXRA 4Q5RA 2X4AA 4KDXA 4POMA 1N8JA 4MDCA 1XWKA 3DEXA 4HEA2 2HRKA 3H1NA 4O1PA 5HGIA 2H19A 3BOAA 4IP6A 4G76A 3PGTA 4FIWA 4IHUA 1GNEA 3TGZA 3E0UA 3D4TA 3LW9A 4YZDA 3IAS1 18GSA 5H5SA 4F2IA 1OC9B 2JU5A 3F6DA 4GCIA 3IHGA 3GFKA 3M1GA 3WT2A 3HVXA 4BVXB 2E2GA 2HLSA 1TRUA 3GX8A 3Q8DA 1EGRA 3GA4A 2XTQA 4AF2A 2PUKC 1J08A 2H6YA 5IPGA 1J9BA 4O32A 4OCFA 4H86A 2DC5A 2CZ3A 2HSHA 3D6IA 3D5JA 5ECQB 1Z5YE 2G2QA 2RLIA 1THOA 3DIEA 2DBCA 3F0IA 2M46A 5CREA 2OE3A 1SD9A 4O5QA 2JB2A 6GSUA 2D2ZA 3A2XA 5BMUA 5HR1A 2HE3A 3IC8A 4AJ6A 4HEA1 3EE2A 4OCEA 2M72A 2LV3A 2YWIA 1PQNA 4GTUA 1OE8A 1XFLA 2KOKA 5ELGA 3ZFBA 3EC3A 1QK8A 3G7IA 3HJPA 4GF0A 4NAXA 2VM1A 3FZ9A 4MF7A 4L5LA 5FWGA 3GKKA 4YKFA 3DVWA 3TRQA 4EO3A 4WR5A 1LU4A 3A2WA 2HSMA 1K0AA 3TOTA 4FH8A 2B7KA 2H72A 2X49A 1A0FA 2KHPA 3MYDA 5G30A 3HD5A 5ECKB 1H4OA 3CTFA 3ISOA 1AQVA 6GSVA 1QQ2A 4JEDA 4MNNA 4ZB8A 2WFCA 1AXDA 3F4MA 22GSA 4ZBBA 3GTUB 1F37A 1M2DA 4HJMA 3AJFA 2QGVA 1R7HA 2CV4A 1DE1A 3KCMA 3RHCA 2IN3A 3HY2A 3HKRA 1BAYA 2KLXA 3IHQA 3ZITA 2H75A 2V6EA 3RDWA 3MAKA 1ILOA 4HOJA 1KTEA 1EOHA 1VF1A 4Z7GA 2P5QA 2V6KA 3HJOA 19GSA 3EMPA 1T4YA 4G19A 3NOFA 4NWYA 4Z2TA 4WF5A 4Z2RA 4K9ZA 2F8AA 3VPQA 1EEJA 4QQ7A 3WYWA 4N0ZA 1OKDA 3M3MA 5AIXA 4YQUA 5CRGA 4HZ4A 3NZNA 3LGCA 4KSMA 2HYXA 1O81A 4GRFA 4V1Ap 3HZ8A 4TN8A 1ERTA 4D73B 2PERA 4KGIA 1O73A 3F3RA 2FCHA 5EL8A 3MSZA 3TKSA 4WF4A 4OFTA 1U3AA 1TU8A 4MK3A 2CX3A 2IMIA 4K1FA 2GSSA 2H6ZA 4ACSA 2XMXA 1X9SB 5CNWA 17GSA 3P8WA 2RIOA 2YJ7A 1T8EB 2V41A 4ILFA 5C04A 2JB1A 3APOA 3ZVJA 2HZEB 1GP1A 2NDOA 4K7OA 3M8NA 3QFAC 4NV2A 4IKHA 1URMA 3BD2A 2LRTA 2N5FA 2KKMA 4J57E 2V1CC 3ZYWA 2JB3A 3A3TA 4WBJA 4I8BA 3FMWA 1PKZA 4V2MA 5D9XA 1TXXA 5AN1A 2MYGA 2O7KA 4YAVA 2YANA 1KNGA 2L4QA 2VD1A 2NTOA 4XS4B 1MDKA 3US3A 1XXUA 1YZXA 3LG6A 1F2EA 1NHOA 3QAWA 4XS1A 1AAZA 3IPZA 1WIKA 1SL1B 4MH2A 1B48A 3DMLA 2DMMA 3RPNA 1PGTA 5KN1A 4XCSA 4JZQA 4OFMA 3L4NA 2IMFA 3PR8A 10GSA 1TW9A 2B1KA 1SENA 5KOWA 1I9DA 2DJ1A 5C00A 1BYEA 2FHEA 1B4PA 1PN0A 2LQOA 3HXSA 2OA7A 4P3YB 3L0HA 5F0GA 4K2DA 4K5RA 2HRFA 3JCML 5DJMA 5GAND 3HVVA 5F05A 3KP8A 2JL4A 4HU9A 1V98A 1A2JA 5CYYA 2X99A 4BVXA 5G5FA 3MWHA 2VIMA 3H79A 3ZIJA 4Z2UA 1RQMA 3FEUA 4LLRA 2YCDA 2PVQA 3EYTA 4CHSA 4XHMA 3FZ5A 5H5QA 1ERWA 3GUSA 1T1VA 3CTGA 3UEMA 4V1Ag 1FB6A 1GUKA 5KEJA 4ECCA 5GSTA 1XVQA 3GNJA 1V2AA 3MNGA 4AGSA 4RI7A 1USBA 3O6TA 1G6WA 1M2BA 1VGLA 1TU7A 2LKUA 5DDLA 2VAFA 1VF4A 3EWLA 2IMKA 16GSA 2YFAA 1M99A 1Z9HA 2G0FA 1K0DA 3KZQA 4YAPA 3CYNA 2XPDA 4ZL7A 1B8XA 3LQ7A 1S3CA 3TB2A 2DJ0A 4MF5A 4DVCA 1U88A 4YQVA 1MTCA 2DKIA 3DYRA 4KNDA 2RM5A 2LS5A 1XIYA 2IL3A 2YFBA 2JSYA 5ECNB 2IFQA 4I97A 3IE3A 5D96A 2LJRA 4MCUA 1ERVA 2HXKA 3VPTA 4GSTA 3GX0A 4XRAA 1QMVA 3VWVA 1ABAA 4GWRA 1XWAA 5H5RA 3IK9A 4WETA 2YZUA 2AJQB 4ISDA 2C3NA 3CXGA 1K3OA 3IBHA 1ZCPA 4FYBA 4X1UA 2JZTA 3ME7A 5ECOB 4U6RA 1JFUA 4PGTA 3CRTA 2DJ2A 5D9VA 3LJRA 3A5IA 5LNK1 2BJXA 1XW9A 4KSOA 4PUFC 3VK9A 1A24A 2ZNMA 2OACA 5COHA 3ZVJD 4CY8A 1MEKA 2WGRA 1A8YA 2YNXA 3FKFA 4ZBAA 2FWEA 5ECHB 3HA9A 1HD2A 4G10A 2OE1A 3NIVA 3EPTA 5KN0A 1WPIA 2NBSA 3C71A 1Z3EA 1GSUA 1YEXA 4MZWA 1T4ZA 5HR2A 2JZSA 4OO4A 3IA1A 4JR4A 1X0RA 3TKRA 1VRSD 4F0CA 3TCOA 3FRCA 2DLXA 2VM2A 4HJ2A 5JWOB 4IP1A 2R0CA 3C1SA 2DIZA 3VFIA 5F07A 4K5SA 1AUCA 1BEDA 3VWXA 3U6VA 3IV4A 1PSQA 1ML6A 5GZZB 3G7JA 1HQOA 1TRSA 4GQCA 1TJDA 13GSA 3TOUA 2VL9A 3ZMLA 3MDKA 4WEYA 4EDYA 3HHVA 4RI6A 3CSHA 5LD0A 3IC4A 2YWNA 2LJKA 1YJ6A 1W89A 3K8NA 5FT3A 3WGDA 2VLUA 1JZWA 4IQAA 2I4AA 2H01A 3GIXA 1GLQA 4IJ3A 1A2LA 5KOXA 3RAZA 3GURA 1ZOFA 2HZEA 1SU9A 2L5OA 3DO9A 3BCKA 4I5QA 4G9HA 1G7EA 2H66A 2VD0A 3QMXA 1ST9A 4KCAA 3ZIVA 1GSYA 2TRCP 1G7OA 2V6OA 5IM9A 1NHYA 3EMXA 2K9FA 1AQWA 1MDIA 2B3SA 2LTKA 2V1MA 3W8JA 4MJBA 4MF6A 3CSJA 4PURA 2VCQA 1XWBA 1W3SA 5L71A 3ZZXA 4XS4A 3S9FA 3ERGA 2X64A 3QAVA 5HR3A 4KE3A 2F8FA 1J0FA 4CY6A 2BMXA 4F03A 4ML6A 2ON5A 9GSSA 1AW9A 2EIRA 4FO5A 2IP6A 2MMZA 3ME8A 3L9UA 4O1OA 5IMCA 5DBQA 4PQIA 3N5OA 3GRXA 4DWLA 1B9YC 5EPFA 5G2ZA 4F0BA 2K19A 4AS2A 1IYIA 5J9BA 4F9ZA 1K0MA 1XWCA 2PPTA 5DCGA 4TOPA 3TKPA 3KMOA 4BA7A 2HT9A 2R6KA 3DWVA 4G0KA 2R37A 4G75A 1DBYA 1Y25A 2O89A 2WRTA 4N11A 4PQHA 2R2JA 1NSWA 4ZILA 4XS6A 3LJ0A 4MA9A 4EVMA 5CAXA 4IW9A 1V57A 4IJIA 5DAKB 7GSSA 4KAEA 2F51A 2MMNA 1B9XC 4JE1A 3J7Yk 1T00A 3I6AA 5D9WA 5J5NA 2AV4A 4MJCA 20GSA 5B8AA 4N10A 2CAZB 4RQXA 3CRUA 4BWSA 1BX9A 4MPGA 5IIZA 4WKWA 4OFNA 6GSTA 2E0QA 3R3EA 4DSRA 5DVBA 2R5GA 3KP9A 4DEJA 1XW5A 1XVWA 3TJJA 1JZRA 2GGTA 1ON4A 4OMVA 4HZ2A 4HU7A 4BPYA 1GSSA 2VCXA 4IBPA 3Q18A 5JCUA 3DD3A 2WJUA 2VUPA 2HZFA 1HYUA 4ICYA 2A2RA 2GZZA 1NM3A 1Z7PA 3P90A 4WR4A 2QA1A 2JSZA 4ECIA 4JBBA 2K6VA 2C4JA 8GSSA 1BJXA 3WGEA 4LL4B 3F8UA 2PVOC 5IMVA 2DJJA 4FYCA 4TW5A 4MZCA 4PQ1A 1WWJA 4DSSA 3FR3A 4OWYA 3KH9A 2HRAA 5IMAA 4TRXA 4XTSA 2XPEA 3CSIA 4NMUA 1XOBA 1SKWB 1FVJA 1SJ8A 1FB0A 2OJLA 2MBTA 3ERFA 2ALBA 1JLWA 1WP0A 3SDJA 4TXOB 3I9V1 2IMDA 1GSFA 4JCVE 1UVZA 5ECIB 1YKCA 5A5KA 3HVSA 3FY7A 2C0DA 4KB3A 3FR6A 4X43A 1HNAA 4HS1A 2PMTA 6GSSA 3IAM2 2YJHA 5G1KA 2FWGA 2QSIA 3F4RA 4MLYA 1CQGA 2RM6A 2FY6A 4KW6A 2AHEA 4TR1B 1SD8A 1SJZA 2H1AA 3APQA 4O5UA 1ZGNA 1WMJA 5DALA 2OKAA 3KGKA 2JAEA 5HR0A 2WDUA 4BL7B 1Y6EA 3L0IA 1TI1A 4GXTA 4IELA 2NVLA 2LNTA 4KA0A 1A8LA 2C0FA 2REMA 2FUG1 1EV9A 1MD3A 1V58A 4AJ7A 6GSYA 4K8MA 3UARA 5J9CA 2H0IA 3MIXA 4YZ9A 3FZ4A 4MJAA 4K6XA 2ON7A 4G0LA 4HUAA 2EC4A 3KJYA 2N5AA 1YDKA 4E8EA 3IAM1 1KBNA 5A4WA 2MMOA 1X5DA 3LYPA 3DA3A 4POKA 1JLVA 4GLTA 1ZYNA 5D8IA 2H1BA 5IMDA 4L0UA 2FWFA 1K0OA 4O92A 4EIQA 2JADA 4POLA 3VA9A 1QUWA 1EZKA 1C72A 2TIRA 2YV9A 1Z7RA 4MP4A 2ZCTA 1X5CA 4AJ8A 4NXIA 2GZYA 2A2PA 4LMVA 1OC9A 5CP1A 1XPVA 2L6CA 5AIVA 4EUYA 1K3YA 2CX4A 5ECLB 3H93A 3F63A 2CA8A 5G5EA 4Z7HA 4Q9VA 2GLRA 1IYHA 4PTSA 1GTUA 1O7UA 3L78A 1DSBA 4CW9A 1R5AA 1X9WB 2VL2C 4PNGA 3QAGA 3KIJA 4EF0A 1V40A 3UITA 2XBIA 4KDUA 1QXHA 1E6BA 1M0UA 2L4CA 1PRXA 3WGXA 4V2NA 1XZOA 3UOMA 2UZ8A 4EDZA 3RPPA 4TR3A 4YH2A 1PL2A 4E8HA 2Z9SA 4PXOA 1Z6NA 3GYKA 1CQHA 1DUGA 1KEBA 4EKZA 2C3QA 4GXZA 4AS3A 4NPBA 1ACVA 1W4VA 5EY6A 2OBIA 2MJFB 1M7TA 1OVNA 2YWOA 2K8VA 3D21A 4KDYA 5DCHA 2BTOT 1V9WA 2ZUPA 3FBVA 4PX1A 3FZAA 1SYXA 3QPMA 2C0EA 3UBKA 2GQLA 4Q5FA 2H8LA 4HQZA 2VLVA 2R3XA 2R4VA 2C80A 3ED3A 2OADA 4GQFA 1N2AA 2K8SA 2RUFA 3I69A 3BCIA 1XWGA 4IS0A 12GSA 11GSA 2F9SA 3UJ1A 3LXZA 4L0WA 3ZMKA 2A4HA 4FQUA 1U5KA 5FHIA 1GUHA 2C1YA 4ULXA 4ZL9A 5GSSA 3DRNA 5JWQB 4KCEA 1PX6A 1M2AA 2I81A 2GT6A 1MDJA 4ZB9A 1FHEA 2GQMA 2WS2A 1GRXA 4DSQA 2E7PA 3GTUA 1EV4A 5B8BA 1R26A 1YF1A 1F6MC 1A23A 1TTZA 4TXVA 3ZLPA 2X8HA 3QFBC 3FW2A 4EXJA 4OAUC 1QFNA 1SK0A 3KM6A 4I2UA 2WZ9A 3TJFA 6GSWA 3FR9A 3DXBA 1K3LA 1SJ6A 2J9HA 3DGQA 2L57A 2C3TA 3TRPA 2GVPA 4G0IA 1SK1A 4ZXGA 1YQ1A 5B6MA 1GLPA 1TKDB 1JZDA 3ZRDA 3LSZA 3L9SA 2VL2A 1Q98A 1FG4A 3F4TA 3GH6A 1AIUA 1NW2A 2MZCA 3QD9A 5HFIA 3P7XA 2E8GA 4KX4A 3SWLA 5DQSA 5A4UA 2K18A 3I43A 3EU3A 1FOHA 1LBKA 2A2DA 4D73A 5IO0A 2B1LA 4K7NA 1YKAA 1PD21 4HFVA 5ID2B 4TXOA 2IWTA 1K0NA 3APSA 5ECRB 1S3DA 5LCZA 4HDEA 1ZYEA 2O87A 1QGVA 5CRDA 5LNKe 4USSA 1GTBA 3DA4A 1AQXA 1M9BA 5CRHA 2CVDA 1PA3A 1ZYPA 3C73A 5G1LA 2TRXA 3TJKA 1K0CA 3W6GA 3UIWA 1WE0A 3RHBA 2DJKA 4TR1A 2OE0A 2LQQA 2HSYA 4LA1A 4X0XA 5INYA 5IMFA 1JHBA 1PMTA 2IPAA 4QL9A 2LRNA 3HJMA 5ECMB 1GNWA 1YO7A 2X8GA 2B5EA 4ECJA 1U6TA 2E2MA 3HYPA 3GKXA 3CMIA 4K0GA 5G31A 3GL5A 4J2FA 1FO5A 2RIIA 4O5RA 2HNLA 2L59A 3ERWA 3IOSA 3IRAA 3KH7A 2ES7A 3C1RA 2P22B 3J7Yb 2YPMA 3P23A 4YKGA 1UA5A 2HRNA 4O7HA 3BBYA 5B6NA 2MBSA 2F66B 3GN3A 2GSQA 3GV1A 2HFDA 3O76A 1SKSB 1GWCA 1DE2A 2PWJA 2GTUA 1GTIA 3C8EA 2H1DA 1ZL9A 2FD3A 3A2VA 3KD0A 2WULA 4PL5A 2GS3A 4ML1A 1FAAA 3PH9A 4IGJA 3R2QA 2VL3A 4MABA 3DKSA 2JZRA 4ZB6A 4TR0A 5JWRB 2VCTA 3ZFLA 3W8SA 4MH3A 1M9AA 4L8EA 3LFLA 3TKSC 5J3RA 1GH2A 5D73A 3ZTLA 5EVOA 3Q19A 3D0ZA 4ZL8A 3EVIA 4NV5A 4LMWA 4LL1B 1E2YA 1FOVA 5F8BA 2FA4A 4N30A 3M9KA 2LNSA 1EOGA 3EURA 5D93A 5IOXA 1SL0B 1FVKA 2IFQB 1JZOA 2DSAA 2H1GA 1OE7A 4TKYA 1TDIA 5HFKA 2VO4A 2NPBA 3M0FA 2FLSA 2B7JA 3M9JA 3LYKA 1O8WA 14GSA 1GSDA 3LJ1A 2JACA 5ABRA 1EP8A 4HI7A 4BVYB 2LRCA 3TKQA 1OKTA 1RW1A 4EC0A 2AYTA 3I9V2 4Z7XA 2GSRA 3BJ5A 4K7IA 6GSXA 5HQPA 2CVKA 4TR4A 3H4KA 2L5LA 2MMAA 1OYJA 3L9VA 1F3AA 3VI7A 2FWHA 2CAQA 4RUVA 3GH9A 2WCIA 4JR6A 1X9MB 3VURA 3OR5A 2I3YA 3TDGA 4KF9A 1OC8A 4RQRA 3N9JA 4EIPA 2H0HA 4N0VA 5KN2A 3VLNA 3LJ2A 2I1UA 5B7CA 2YOIA 3IDVA 2QA2A 3KXOA 4OD7A 3UAPA 1TK0B 2FUG2 1T3BA 1O85A 4JRRA 1GSEA 3ZL5A 2KUCA 4G2EA 5ELAA 4OAVB 4HQSA 1EEMA 4ZIJA 1FW1A 3PPUA 3Q74A 4V2LA 3QR6A 1YY7A 4QL7A 1K0BA 4F82A 1EWXA 2I9HA 5DQYA 1TOFA 2H0GA 2RUEA 2M80A 1OC3A 5JCWA 3IR4A 2GZPA 1G6YA 3UBLA 3VWUA 1U3IA 4YQMA 2IIYA 2KP1A 2L1LB 1EGOA 3G9BA 1A0RP 2FA8A 3LEFA 2N5BA 2EIQA 4EE0A 4X4JA 1OAZA 3GSSA 2WB9A 2DMLA 2AUVA 3SBCA 4MZBA 1YEPA 4OO5A 2VLTA 5F06A 4I2TA 1X5EA 2YV7A 3CBUA 1Q4JA 3FHKA 2R0PA 1B4QA 2XC2A 5ID2A 1XCCA 2B6MA 2FGXA 5D9TA 1TP9A 2H6XA 4XIHA 1ZMAA 1GL8A 2H74A 3F9UA 2GQKA 3UL3A 4KH7A 4PNFA 3O3TA 3D4MA 1U87A 4L5OA 3JSBA 2XBQA 5A4VA 4POBA 2VCWA 3D22A 3V1WA 2H30A 1O8XA 3E3EA 3RBTA 1YF0A 5BRTA 2GT5A 2VOCA 3VWWA 4GSSA 1BG5A 3UMAA 3LWAA 3EU4A 2LJAA 5CO3A 3GKNA 4PL3A 3Q6OA 2PU9C 3UVHA 2VCZA 4GSNA 2DJ3A 2CQ9A 2P31A 5E59A 2F6MB 2GSTA 2X8CA 3E9JB 1TK5B 2V32A 2B5XA 1EP7A 4PUAA 4IN0A 1TRVA 3WD6A 2IJYA 1PL1A 1Z6MA 4YZCA 2XHFA 1BQ7A 5ENUA 4K2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCV A;  4JU5 A;  1HNB A;  2B5Y A;  3KTB A;  3KTL A;  3TKS E;  4IVF A;  5CRW A;  5DJL A;  1SK2 A;  3U5R E;  4EL1 A;  2A4V A;  1AC1 A;  3GKM A;  1SKR B;  2LST A;  1S3A A;  1SJI A;  2YP6 A;  3A5W A;  2L6D A;  1R4W A;  3QOU A;  1TK8 B;  3HZ4 A;  5KN3 A;  1GUL A;  2CT6 A;  3UVT A;  2AAW A;  1ZZY A;  3F3Q A;  4IQ1 A;  3G7Y A;  4WXT A;  1G0T A;  5ECS A;  1VF3 A;  2HI7 A;  5HFG A;  2OBK A;  3C7M A;  2CZ2 A;  3TUE A;  2DIY A;  3GHA A;  2H73 A;  5DAK A;  2LEG A;  1PX7 A;  2PN8 A;  2KP2 A;  4WBR D;  2F3M A;  2YZH A;  2PGT A;  1WOU A;  3GMF A;  1A2M A;  1R5P A;  1VF2 A;  1O6J A;  2C0G A;  1PN9 A;  3TRX A;  4ECB A;  3LXT A;  2H70 A;  4ID0 A;  4BVY A;  2J23 A;  5IQY A;  4ZBD A;  5IPH A;  4DSS B;  2YWM A;  5AIS A;  1UC7 A;  2LUS A;  3ZRE A;  2A2S A;  1SYR A;  5IMZ A;  1T7P B;  2QC7 A;  5IOW A;  5AGY A;  1TI3 A;  1LJR A;  2C8U A;  1XW6 A;  4XRD A;  4KUN A;  2H76 A;  2GDR A;  1ERU A;  2CVB A;  1WJK A;  3EIN A;  3HCZ A;  3GL3 A;  3AY8 A;  4NHZ A;  3FYG A;  2PBJ A;  1XBS A;  2O85 A;  3TJG A;  5J41 A;  4Q5Q A;  3PIN A;  3LOR A;  3FK8 A;  2YN1 A;  3HDC A;  3P2A A;  3KMN A;  1SL2 B;  4CDO A;  5DAL B;  1PKW A;  1RK4 A;  3WT1 A;  1HNC A;  3QDN A;  3F6F A;  1GSQ A;  1UN2 A;  2CAI A;  2FNO A;  4Q5N A;  2AB6 A;  2EIO A;  3DVX A;  4MPF A;  3VI5 A;  3IAS 2;  4MMM A;  5J4U A;  3KEB A;  4TVE A;  3F4S A;  5IO2 A;  1F3B A;  4NHW A;  2QKE A;  1H75 A;  2P5R A;  4BWQ A;  1ZYQ B;  5ECP B;  2O8V B;  4J56 E;  3TJB A;  1XOA A;  1WRY A;  2IME A;  2P0G A;  1I5G A;  2V2G A;  1GUM A;  4FYU A;  4I6X A;  1MD4 A;  1TRW A;  3IK7 A;  1F9M A;  3H8Q A;  3QCP A;  4MJE A;  5E4W A;  2H71 A;  4BL7 A;  1THX A;  5GAP D;  5JCG A;  3GST A;  1GTA A;  4K0N A;  3IXR A;  4Q5R A;  4KDX A;  4POM A;  1N8J A;  4MDC A;  1XWK A;  3DEX A;  4HEA 2;  3H1N A;  2H19 A;  3BOA A;  4IP6 A;  3PGT A;  4FIW A;  4IHU A;  1GNE A;  3TGZ A;  3E0U A;  3D4T A;  18GS A;  5H5S A;  4F2I A;  1OC9 B;  2JU5 A;  3F6D A;  4GCI A;  3GFK A;  3M1G A;  3WT2 A;  3HVX A;  2E2G A;  2HLS A;  1TRU A;  3GX8 A;  1EGR A;  3GA4 A;  4AF2 A;  2PUK C;  1J08 A;  2H6Y A;  5IPG A;  1J9B A;  4O32 A;  4OCF A;  4H86 A;  2DC5 A;  2CZ3 A;  2HSH A;  3D6I A;  5ECQ B;  3D5J A;  1Z5Y E;  2G2Q A;  2RLI A;  1THO A;  3DIE A;  2DBC A;  3F0I A;  2M46 A;  5CRE A;  2OE3 A;  1SD9 A;  6GSU A;  2D2Z A;  3A2X A;  5HR1 A;  2HE3 A;  4AJ6 A;  3EE2 A;  4OCE A;  2M72 A;  2LV3 A;  2YWI A;  1PQN A;  4GTU A;  1OE8 A;  1XFL A;  2KOK A;  5ELG A;  3ZFB A;  3EC3 A;  1QK8 A;  3G7I A;  3HJP A;  4GF0 A;  4NAX A;  2VM1 A;  3FZ9 A;  4MF7 A;  4L5L A;  5FWG A;  3GKK A;  3DVW A;  3TRQ A;  4EO3 A;  4WR5 A;  1LU4 A;  3A2W A;  1K0A A;  3TOT A;  4FH8 A;  2B7K A;  2H72 A;  1A0F A;  2KHP A;  5G30 A;  3HD5 A;  5ECK B;  1H4O A;  3CTF A;  3ISO A;  1AQV A;  6GSV A;  1QQ2 A;  4JED A;  4ZB8 A;  2WFC A;  1AXD A;  22GS A;  4ZBB A;  3GTU B;  1F37 A;  1M2D A;  4HJM A;  2QGV A;  1R7H A;  2CV4 A;  1DE1 A;  3KCM A;  3RHC A;  2IN3 A;  3HY2 A;  3HKR A;  1BAY A;  2KLX A;  3IHQ A;  3ZIT A;  2H75 A;  3RDW A;  3MAK A;  1ILO A;  4HOJ A;  1KTE A;  1EOH A;  1VF1 A;  3HJO A;  2P5Q A;  2V6K A;  19GS A;  3EMP A;  1T4Y A;  4G19 A;  3NOF A;  4NWY A;  4WF5 A;  4K9Z A;  2F8A A;  3VPQ A;  1EEJ A;  4QQ7 A;  3WYW A;  4N0Z A;  1OKD A;  3M3M A;  5AIX A;  4YQU A;  5CRG A;  4HZ4 A;  3NZN A;  3LGC A;  4KSM A;  2HYX A;  1O81 A;  4GRF A;  4V1A p;  3HZ8 A;  4TN8 A;  1ERT A;  4D73 B;  2PER A;  4KGI A;  1O73 A;  3F3R A;  2FCH A;  5EL8 A;  3MSZ A;  3TKS A;  4WF4 A;  4OFT A;  1U3A A;  1TU8 A;  4MK3 A;  2CX3 A;  2IMI A;  4K1F A;  2GSS A;  2H6Z A;  4ACS A;  1X9S B;  5CNW A;  17GS A;  3P8W A;  2YJ7 A;  1T8E B;  2V41 A;  4ILF A;  5C04 A;  3APO A;  3ZVJ A;  2HZE B;  1GP1 A;  2NDO A;  4K7O A;  3M8N A;  3QFA C;  4NV2 A;  4IKH A;  1URM A;  3BD2 A;  2LRT A;  2N5F A;  4J57 E;  3ZYW A;  3A3T A;  4WBJ A;  4I8B A;  1PKZ A;  4V2M A;  5D9X A;  1TXX A;  5AN1 A;  2MYG A;  2O7K A;  4YAV A;  2YAN A;  1KNG A;  2L4Q A;  2VD1 A;  2NTO A;  4XS4 B;  1MDK A;  3US3 A;  1XXU A;  1YZX A;  3LG6 A;  1F2E A;  1NHO A;  3QAW A;  4XS1 A;  1AAZ A;  3IPZ A;  1WIK A;  1SL1 B;  4MH2 A;  1B48 A;  3DML A;  2DMM A;  3RPN A;  1PGT A;  5KN1 A;  4XCS A;  4JZQ A;  4OFM A;  3L4N A;  2IMF A;  3PR8 A;  10GS A;  1TW9 A;  2B1K A;  1SEN A;  1I9D A;  2DJ1 A;  5C00 A;  1BYE A;  2FHE A;  1B4P A;  2LQO A;  3HXS A;  2OA7 A;  4P3Y B;  3L0H A;  5F0G A;  4K2D A;  2HRF A;  3JCM L;  5DJM A;  5GAN D;  3HVV A;  5F05 A;  3KP8 A;  2JL4 A;  4HU9 A;  1V98 A;  1A2J A;  5CYY A;  2X99 A;  4BVX A;  5G5F A;  3MWH A;  2VIM A;  3H79 A;  3ZIJ A;  1RQM A;  3FEU A;  4LLR A;  2YCD A;  2PVQ A;  3EYT A;  4CHS A;  4XHM A;  3FZ5 A;  5H5Q A;  1ERW A;  3GUS A;  1T1V A;  3CTG A;  3UEM A;  4V1A g;  1FB6 A;  1GUK A;  5KEJ A;  4ECC A;  5GST A;  1XVQ A;  3GNJ A;  1V2A A;  3MNG A;  4AGS A;  4RI7 A;  1USB A;  3O6T A;  1G6W A;  1M2B A;  1VGL A;  1TU7 A;  2LKU A;  5DDL A;  2VAF A;  1VF4 A;  3EWL A;  2IMK A;  16GS A;  1M99 A;  1Z9H A;  2G0F A;  1K0D A;  3KZQ A;  4YAP A;  3CYN A;  2XPD A;  4ZL7 A;  1B8X A;  3LQ7 A;  1S3C A;  3TB2 A;  2DJ0 A;  4MF5 A;  4DVC A;  1U88 A;  4YQV A;  1MTC A;  3DYR A;  4KND A;  2RM5 A;  2LS5 A;  1XIY A;  2IL3 A;  2JSY A;  5ECN B;  2IFQ A;  4I97 A;  3IE3 A;  5D96 A;  2LJR A;  4MCU A;  1ERV A;  2HXK A;  3VPT A;  4GST A;  3GX0 A;  4XRA A;  1QMV A;  3VWV A;  1ABA A;  4GWR A;  1XWA A;  5H5R A;  3IK9 A;  4WET A;  2YZU A;  2AJQ B;  4ISD A;  2C3N A;  3CXG A;  1K3O A;  3IBH A;  1ZCP A;  4FYB A;  4X1U A;  2JZT A;  3ME7 A;  5ECO B;  1JFU A;  4PGT A;  3CRT A;  2DJ2 A;  5D9V A;  3LJR A;  2BJX A;  1XW9 A;  4KSO A;  4PUF C;  3VK9 A;  1A24 A;  2ZNM A;  2OAC A;  5COH A;  3ZVJ D;  1MEK A;  2WGR A;  1A8Y A;  2YNX A;  3FKF A;  4ZBA A;  2FWE A;  5ECH B;  3HA9 A;  1HD2 A;  4G10 A;  2OE1 A;  3NIV A;  5KN0 A;  1WPI A;  2NBS A;  3C71 A;  1Z3E A;  1GSU A;  1YEX A;  4MZW A;  1T4Z A;  5HR2 A;  2JZS A;  4OO4 A;  3IA1 A;  4JR4 A;  1X0R A;  3TKR A;  1VRS D;  4F0C A;  3TCO A;  3FRC A;  2DLX A;  2VM2 A;  4HJ2 A;  5JWO B;  4IP1 A;  3C1S A;  2DIZ A;  3VFI A;  5F07 A;  1AUC A;  1BED A;  3VWX A;  3U6V A;  3IV4 A;  1PSQ A;  1ML6 A;  5GZZ B;  3G7J A;  1HQO A;  1TRS A;  4GQC A;  1TJD A;  13GS A;  3TOU A;  2VL9 A;  3ZML A;  3MDK A;  4WEY A;  4EDY A;  3HHV A;  4RI6 A;  3CSH A;  5LD0 A;  3IC4 A;  2YWN A;  2LJK A;  1YJ6 A;  1W89 A;  3K8N A;  5FT3 A;  3WGD A;  2VLU A;  1JZW A;  4IQA A;  2I4A A;  2H01 A;  3GIX A;  1GLQ A;  4IJ3 A;  1A2L A;  3RAZ A;  3GUR A;  1ZOF A;  2HZE A;  1SU9 A;  2L5O A;  3BCK A;  4I5Q A;  4G9H A;  1G7E A;  2H66 A;  2VD0 A;  3QMX A;  1ST9 A;  4KCA A;  3ZIV A;  1GSY A;  2TRC P;  1G7O A;  2V6O A;  5IM9 A;  1NHY A;  3EMX A;  2K9F A;  1AQW A;  1MDI A;  2B3S A;  2LTK A;  2V1M A;  3W8J A;  4MJB A;  4MF6 A;  3CSJ A;  4PUR A;  2VCQ A;  1XWB A;  5L71 A;  3ZZX A;  4XS4 A;  3S9F A;  3ERG A;  2X64 A;  3QAV A;  5HR3 A;  4KE3 A;  2F8F A;  1J0F A;  2BMX A;  4F03 A;  4ML6 A;  2ON5 A;  9GSS A;  1AW9 A;  2EIR A;  4FO5 A;  2MMZ A;  3ME8 A;  3L9U A;  5IMC A;  5DBQ A;  4PQI A;  3N5O A;  3GRX A;  1B9Y C;  5EPF A;  5G2Z A;  4F0B A;  1IYI A;  5J9B A;  4F9Z A;  1K0M A;  1XWC A;  2PPT A;  5DCG A;  4TOP A;  3TKP A;  3KMO A;  4BA7 A;  2HT9 A;  2R6K A;  3DWV A;  2R37 A;  1DBY A;  1Y25 A;  2O89 A;  2WRT A;  4N11 A;  4PQH A;  2R2J A;  1NSW A;  4ZIL A;  4XS6 A;  4MA9 A;  4EVM A;  5CAX A;  4IW9 A;  1V57 A;  4IJI A;  5DAK B;  7GSS A;  4KAE A;  2F51 A;  2MMN A;  1B9X C;  4JE1 A;  3J7Y k;  1T00 A;  3I6A A;  5D9W A;  5J5N A;  2AV4 A;  4MJC A;  20GS A;  5B8A A;  4N10 A;  4RQX A;  3CRU A;  4BWS A;  1BX9 A;  4MPG A;  5IIZ A;  4WKW A;  4OFN A;  6GST A;  2E0Q A;  4DSR A;  5DVB A;  2R5G A;  3KP9 A;  4DEJ A;  1XW5 A;  1XVW A;  3TJJ A;  1JZR A;  2GGT A;  1ON4 A;  4OMV A;  4HZ2 A;  4HU7 A;  4BPY A;  1GSS A;  2VCX A;  4IBP A;  3Q18 A;  5JCU A;  3DD3 A;  2WJU A;  2VUP A;  2HZF A;  1HYU A;  2A2R A;  2GZZ A;  1NM3 A;  1Z7P A;  3P90 A;  4WR4 A;  2JSZ A;  4ECI A;  4JBB A;  2K6V A;  2C4J A;  8GSS A;  1BJX A;  3WGE A;  4LL4 B;  3F8U A;  2PVO C;  5IMV A;  2DJJ A;  4FYC A;  4TW5 A;  4MZC A;  4PQ1 A;  1WWJ A;  4DSS A;  3FR3 A;  4OWY A;  3KH9 A;  5IMA A;  4TRX A;  4XTS A;  2XPE A;  3CSI A;  4NMU A;  1XOB A;  1SKW B;  1FVJ A;  1FB0 A;  2OJL A;  2MBT A;  3ERF A;  2ALB A;  1JLW A;  1WP0 A;  4TXO B;  2IMD A;  1GSF A;  1UVZ A;  5ECI B;  1YKC A;  5A5K A;  3HVS A;  3FY7 A;  2C0D A;  4KB3 A;  3FR6 A;  4X43 A;  1HNA A;  4HS1 A;  2PMT A;  6GSS A;  3IAM 2;  2YJH A;  5G1K A;  2FWG A;  2QSI A;  3F4R A;  4MLY A;  1CQG A;  2RM6 A;  2FY6 A;  4KW6 A;  2AHE A;  4TR1 B;  1SD8 A;  1SJZ A;  2H1A A;  3APQ A;  1ZGN A;  1WMJ A;  5DAL A;  2OKA A;  3KGK A;  5HR0 A;  2WDU A;  1Y6E A;  1TI1 A;  4IEL A;  2NVL A;  2LNT A;  4KA0 A;  1A8L A;  2C0F A;  2REM A;  1EV9 A;  1MD3 A;  1V58 A;  4AJ7 A;  6GSY A;  4K8M A;  3UAR A;  5J9C A;  2H0I A;  3FZ4 A;  4MJA A;  4K6X A;  2ON7 A;  4HUA A;  2EC4 A;  3KJY A;  2N5A A;  1YDK A;  4E8E A;  1KBN A;  5A4W A;  2MMO A;  1X5D A;  3LYP A;  4POK A;  1JLV A;  4GLT A;  5D8I A;  2H1B A;  5IMD A;  4L0U A;  2FWF A;  1K0O A;  4O92 A;  2JAD A;  4POL A;  1QUW A;  1EZK A;  1C72 A;  2TIR A;  2YV9 A;  1Z7R A;  4MP4 A;  2ZCT A;  1X5C A;  4AJ8 A;  4NXI A;  2GZY A;  4LMV A;  5CP1 A;  1OC9 A;  1XPV A;  2L6C A;  5AIV A;  4EUY A;  1K3Y A;  2CX4 A;  5ECL B;  3H93 A;  3F63 A;  2CA8 A;  5G5E A;  2GLR A;  1IYH A;  1GTU A;  1O7U A;  3L78 A;  1DSB A;  4CW9 A;  1R5A A;  1X9W B;  2VL2 C;  4PNG A;  3QAG A;  3KIJ A;  4EF0 A;  1V40 A;  2XBI A;  4KDU A;  1QXH A;  1E6B A;  1M0U A;  2L4C A;  1PRX A;  3WGX A;  4V2N A;  1XZO A;  3UOM A;  4EDZ A;  3RPP A;  4TR3 A;  4YH2 A;  1PL2 A;  4E8H A;  2Z9S A;  4PXO A;  1Z6N A;  3GYK A;  1CQH A;  1DUG A;  1KEB A;  4EKZ A;  2C3Q A;  4GXZ A;  4NPB A;  1ACV A;  1W4V A;  5EY6 A;  2OBI A;  1M7T A;  1OVN A;  2YWO A;  2K8V A;  3D21 A;  4KDY A;  5DCH A;  2BTO T;  1V9W A;  2ZUP A;  4PX1 A;  3FZA A;  1SYX A;  3QPM A;  2C0E A;  3UBK A;  2GQL A;  4Q5F A;  2H8L A;  4HQZ A;  2VLV A;  2R3X A;  2R4V A;  2C80 A;  3ED3 A;  2OAD A;  4GQF A;  1N2A A;  2K8S A;  2RUF A;  3I69 A;  3BCI A;  1XWG A;  4IS0 A;  12GS A;  11GS A;  2F9S A;  3UJ1 A;  3LXZ A;  4L0W A;  3ZMK A;  5FHI A;  1GUH A;  2C1Y A;  4ULX A;  4ZL9 A;  5GSS A;  3DRN A;  5JWQ B;  4KCE A;  1PX6 A;  1M2A A;  2I81 A;  2GT6 A;  1MDJ A;  4ZB9 A;  1FHE A;  2GQM A;  2WS2 A;  1GRX A;  4DSQ A;  2E7P A;  3GTU A;  1EV4 A;  5B8B A;  1R26 A;  1YF1 A;  1F6M C;  1A23 A;  1TTZ A;  4TXV A;  3ZLP A;  2X8H A;  3QFB C;  3FW2 A;  4EXJ A;  1QFN A;  1SK0 A;  3KM6 A;  4I2U A;  2WZ9 A;  3TJF A;  6GSW A;  3FR9 A;  3DXB A;  1K3L A;  1SJ6 A;  2J9H A;  3DGQ A;  2L57 A;  2C3T A;  3TRP A;  2GVP A;  1SK1 A;  4ZXG A;  1YQ1 A;  5B6M A;  1GLP A;  1TKD B;  1JZD A;  3ZRD A;  3LSZ A;  3L9S A;  2VL2 A;  1Q98 A;  1FG4 A;  3F4T A;  3GH6 A;  1AIU A;  1NW2 A;  2MZC A;  3QD9 A;  5HFI A;  3P7X A;  4KX4 A;  3SWL A;  5DQS A;  5A4U A;  2K18 A;  3I43 A;  3EU3 A;  1LBK A;  4D73 A;  5IO0 A;  2B1L A;  4K7N A;  1YKA A;  1PD2 1;  5ID2 B;  4TXO A;  2IWT A;  1K0N A;  3APS A;  5ECR B;  1S3D A;  5LCZ A;  4HDE A;  1ZYE A;  2O87 A;  1QGV A;  5CRD A;  5LNK e;  1GTB A;  1AQX A;  1M9B A;  5CRH A;  2CVD A;  1PA3 A;  3C73 A;  5G1L A;  2TRX A;  3TJK A;  1K0C A;  3W6G A;  3UIW A;  1WE0 A;  3RHB A;  2DJK A;  4TR1 A;  2OE0 A;  2LQQ A;  2HSY A;  4LA1 A;  4X0X A;  5INY A;  5IMF A;  1JHB A;  1PMT A;  2IPA A;  4QL9 A;  2LRN A;  3HJM A;  5ECM B;  1GNW A;  2X8G A;  2B5E A;  4ECJ A;  1U6T A;  2E2M A;  3HYP A;  3GKX A;  3CMI A;  4K0G A;  5G31 A;  3GL5 A;  4J2F A;  1FO5 A;  2RII A;  4O5R A;  2HNL A;  2L59 A;  3ERW A;  3IOS A;  3IRA A;  3KH7 A;  2ES7 A;  3C1R A;  3J7Y b;  2YPM A;  1UA5 A;  2HRN A;  4O7H A;  3BBY A;  5B6N A;  2MBS A;  3GN3 A;  2GSQ A;  3GV1 A;  2HFD A;  3O76 A;  1SKS B;  1GWC A;  1DE2 A;  2PWJ A;  2GTU A;  1GTI A;  3C8E A;  2H1D A;  1ZL9 A;  2FD3 A;  3A2V A;  3KD0 A;  2WUL A;  2GS3 A;  4ML1 A;  1FAA A;  3PH9 A;  4IGJ A;  3R2Q A;  2VL3 A;  4MAB A;  3DKS A;  2JZR A;  4ZB6 A;  4TR0 A;  5JWR B;  2VCT A;  3ZFL A;  3W8S A;  4MH3 A;  1M9A A;  4L8E A;  3LFL A;  3TKS C;  5J3R A;  1GH2 A;  5D73 A;  3ZTL A;  5EVO A;  3Q19 A;  3D0Z A;  4ZL8 A;  3EVI A;  4NV5 A;  4LMW A;  4LL1 B;  1E2Y A;  1FOV A;  5F8B A;  2FA4 A;  4N30 A;  3M9K A;  2LNS A;  1EOG A;  3EUR A;  5D93 A;  5IOX A;  1SL0 B;  1FVK A;  2IFQ B;  1JZO A;  2DSA A;  2H1G A;  1OE7 A;  4TKY A;  1TDI A;  5HFK A;  2VO4 A;  2NPB A;  3M0F A;  2FLS A;  2B7J A;  3M9J A;  3LYK A;  1O8W A;  14GS A;  1GSD A;  2JAC A;  5ABR A;  1EP8 A;  4HI7 A;  2LRC A;  3TKQ A;  1OKT A;  1RW1 A;  4EC0 A;  2AYT A;  3I9V 2;  4Z7X A;  2GSR A;  3BJ5 A;  4K7I A;  6GSX A;  5HQP A;  2CVK A;  4TR4 A;  3H4K A;  2L5L A;  2MMA A;  1OYJ A;  3L9V A;  1F3A A;  3VI7 A;  2FWH A;  2CAQ A;  4RUV A;  3GH9 A;  2WCI A;  4JR6 A;  1X9M B;  3VUR A;  3OR5 A;  2I3Y A;  3TDG A;  1OC8 A;  4RQR A;  3N9J A;  2H0H A;  4N0V A;  5KN2 A;  3VLN A;  2I1U A;  5B7C A;  2YOI A;  3IDV A;  3KXO A;  4OD7 A;  3UAP A;  1TK0 B;  2FUG 2;  1T3B A;  1O85 A;  1GSE A;  4JRR A;  3ZL5 A;  2KUC A;  4G2E A;  5ELA A;  4HQS A;  1EEM A;  4ZIJ A;  1FW1 A;  3Q74 A;  4V2L A;  3QR6 A;  1YY7 A;  4QL7 A;  1K0B A;  4F82 A;  1EWX A;  2I9H A;  5DQY A;  1TOF A;  2H0G A;  2RUE A;  2M80 A;  1OC3 A;  5JCW A;  3IR4 A;  2GZP A;  1G6Y A;  3UBL A;  3VWU A;  1U3I A;  4YQM A;  2IIY A;  2KP1 A;  1EGO A;  3G9B A;  1A0R P;  2FA8 A;  3LEF A;  2N5B A;  2EIQ A;  4EE0 A;  1OAZ A;  3GSS A;  2WB9 A;  2DML A;  2AUV A;  3SBC A;  4MZB A;  1YEP A;  4OO5 A;  2VLT A;  5F06 A;  4I2T A;  1X5E A;  2YV7 A;  3CBU A;  1Q4J A;  3FHK A;  1B4Q A;  2XC2 A;  5ID2 A;  1XCC A;  2B6M A;  2FGX A;  5D9T A;  1TP9 A;  2H6X A;  4XIH A;  1ZMA A;  1GL8 A;  2H74 A;  3F9U A;  2GQK A;  3UL3 A;  4KH7 A;  4PNF A;  3O3T A;  3D4M A;  1U87 A;  4L5O A;  2XBQ A;  5A4V A;  4POB A;  2VCW A;  3D22 A;  3V1W A;  2H30 A;  1O8X A;  3E3E A;  3RBT A;  1YF0 A;  2GT5 A;  2VOC A;  3VWW A;  4GSS A;  1BG5 A;  3UMA A;  3LWA A;  3EU4 A;  2LJA A;  5CO3 A;  3GKN A;  3Q6O A;  2PU9 C;  3UVH A;  2VCZ A;  4GSN A;  2DJ3 A;  2CQ9 A;  2P31 A;  5E59 A;  2GST A;  2X8C A;  3E9J B;  1TK5 B;  2V32 A;  2B5X A;  1EP7 A;  4PUA A;  4IN0 A;  1TRV A;  3WD6 A;  2IJY A;  1PL1 A;  1Z6M A;  2XHF A;  1BQ7 A;  5ENU A; 
#chains in the Genus database with same CATH topology
 2VCV A;  4JU5 A;  1HNB A;  2B5Y A;  3KTB A;  3KTL A;  3TKS E;  4IVF A;  5CRW A;  5DJL A;  1SK2 A;  3U5R E;  4EL1 A;  2A4V A;  1AC1 A;  3GKM A;  1SKR B;  2LST A;  1S3A A;  1SJI A;  2YP6 A;  3A5W A;  2QGM A;  2L6D A;  1R4W A;  3QOU A;  2DKH A;  1TK8 B;  3HZ4 A;  5KN3 A;  1GUL A;  2CT6 A;  3UVT A;  2AAW A;  1ZZY A;  3F3Q A;  4IQ1 A;  3G7Y A;  4WXT A;  1G0T A;  5ECS A;  1VF3 A;  2HI7 A;  5HFG A;  2OBK A;  3C7M A;  2CZ2 A;  3TUE A;  2DIY A;  3GHA A;  2H73 A;  5DAK A;  2LEG A;  4I1T A;  1PX7 A;  2PN8 A;  2KP2 A;  4WBR D;  2F3M A;  2YZH A;  2PGT A;  1XG8 A;  1WOU A;  3GMF A;  1A2M A;  1R5P A;  1VF2 A;  1O6J A;  2C0G A;  1PN9 A;  3TRX A;  4ECB A;  3LXT A;  2H70 A;  3FVV A;  4ID0 A;  4BVY A;  2J23 A;  5IQY A;  4ZBD A;  5IPH A;  4DSS B;  2YWM A;  5AIS A;  2XTR A;  1UC7 A;  2LUS A;  3ZRE A;  2A2S A;  1SYR A;  5IMZ A;  1T7P B;  2QC7 A;  5IOW A;  5AGY A;  4A5P A;  1TI3 A;  1LJR A;  2C8U A;  1XW6 A;  4XRD A;  4KUN A;  2H76 A;  2GDR A;  1ERU A;  2CVB A;  1WJK A;  3EIN A;  4PL4 A;  3HCZ A;  3GL3 A;  3AY8 A;  4NHZ A;  3FYG A;  2PBJ A;  1XBS A;  2O85 A;  3TJG A;  5J41 A;  4Q5Q A;  3PIN A;  3LOR A;  3FK8 A;  2YN1 A;  3HDC A;  3P2A A;  3KMN A;  1SL2 B;  4CDO A;  5DAL B;  1PKW A;  1S3R A;  2A2C A;  1RK4 A;  3WT1 A;  1HNC A;  3QDN A;  3F6F A;  1GSQ A;  1UN2 A;  2CAI A;  2FNO A;  4Q5N A;  2AB6 A;  2EIO A;  3DVX A;  4MPF A;  3VI5 A;  3IAS 2;  4MMM A;  5J4U A;  3KEB A;  4TVE A;  3F4S A;  5IO2 A;  2R0G A;  1F3B A;  4NHW A;  2QKE A;  1H75 A;  2P5R A;  4BWQ A;  1ZYQ B;  5ECP B;  2O8V B;  4J56 E;  3TJB A;  1XOA A;  1WRY A;  2IME A;  2P0G A;  1I5G A;  2V2G A;  1GUM A;  4FYU A;  4I6X A;  1MD4 A;  1TRW A;  3IK7 A;  1F9M A;  3H8Q A;  3QCP A;  4MJE A;  5E4W A;  2H71 A;  4BL7 A;  1THX A;  5GAP D;  5JCG A;  3GST A;  1GTA A;  4K0N A;  2ZRR A;  3IXR A;  4Q5R A;  2X4A A;  4KDX A;  4POM A;  1N8J A;  4MDC A;  1XWK A;  3DEX A;  4HEA 2;  2HRK A;  3H1N A;  4O1P A;  5HGI A;  2H19 A;  3BOA A;  4IP6 A;  4G76 A;  3PGT A;  4FIW A;  4IHU A;  1GNE A;  3TGZ A;  3E0U A;  3D4T A;  3LW9 A;  4YZD A;  3IAS 1;  18GS A;  5H5S A;  4F2I A;  1OC9 B;  3FNB A;  2JU5 A;  3F6D A;  4GCI A;  3IHG A;  3GFK A;  3M1G A;  3WT2 A;  3HVX A;  4BVX B;  2E2G A;  2HLS A;  1TRU A;  3GX8 A;  3Q8D A;  1EGR A;  3GA4 A;  2XTQ A;  4AF2 A;  2PUK C;  1J08 A;  2H6Y A;  5IPG A;  1J9B A;  4O32 A;  4OCF A;  4H86 A;  2DC5 A;  2CZ3 A;  2HSH A;  3D6I A;  3D5J A;  5ECQ B;  1Z5Y E;  2G2Q A;  2RLI A;  1THO A;  3DIE A;  2DBC A;  3F0I A;  2M46 A;  5CRE A;  2OE3 A;  1SD9 A;  4O5Q A;  2JB2 A;  6GSU A;  2D2Z A;  3A2X A;  5BMU A;  5HR1 A;  2HE3 A;  3IC8 A;  4AJ6 A;  4HEA 1;  3EE2 A;  4OCE A;  2M72 A;  2LV3 A;  2YWI A;  1PQN A;  4GTU A;  1OE8 A;  1XFL A;  2KOK A;  5ELG A;  3ZFB A;  3EC3 A;  1QK8 A;  3G7I A;  3HJP A;  4GF0 A;  4NAX A;  2VM1 A;  3FZ9 A;  4MF7 A;  4L5L A;  5FWG A;  3GKK A;  4YKF A;  3DVW A;  3TRQ A;  4EO3 A;  4WR5 A;  1LU4 A;  3A2W A;  2HSM A;  1K0A A;  3TOT A;  4FH8 A;  2B7K A;  2H72 A;  2X49 A;  1A0F A;  2KHP A;  3MYD A;  5G30 A;  3HD5 A;  5ECK B;  1H4O A;  3CTF A;  3ISO A;  1AQV A;  6GSV A;  1QQ2 A;  4JED A;  4MNN A;  4ZB8 A;  2WFC A;  1AXD A;  3F4M A;  22GS A;  4ZBB A;  3GTU B;  1M3J A;  1F37 A;  1M2D A;  4HJM A;  3AJF A;  2QGV A;  1R7H A;  2CV4 A;  1DE1 A;  3KCM A;  3RHC A;  2IN3 A;  3HY2 A;  3HKR A;  1BAY A;  2KLX A;  3IHQ A;  3ZIT A;  2H75 A;  2V6E A;  3RDW A;  3MAK A;  1ILO A;  4HOJ A;  1KTE A;  1EOH A;  1VF1 A;  4Z7G A;  2P5Q A;  2V6K A;  3HJO A;  19GS A;  3EMP A;  1T4Y A;  4G19 A;  3NOF A;  4NWY A;  4Z2T A;  4WF5 A;  4Z2R A;  4K9Z A;  2F8A A;  3VPQ A;  1EEJ A;  4QQ7 A;  3WYW A;  4N0Z A;  1OKD A;  3M3M A;  5AIX A;  4YQU A;  5CRG A;  4HZ4 A;  3NZN A;  3LGC A;  4KSM A;  2HYX A;  1O81 A;  4GRF A;  4V1A p;  3HZ8 A;  4TN8 A;  1ERT A;  4D73 B;  2PER A;  4KGI A;  1O73 A;  3F3R A;  2FCH A;  5EL8 A;  3MSZ A;  3TKS A;  4WF4 A;  4OFT A;  1U3A A;  1TU8 A;  4MK3 A;  2CX3 A;  2IMI A;  4K1F A;  2GSS A;  2H6Z A;  4ACS A;  2XMX A;  1X9S B;  5CNW A;  17GS A;  3P8W A;  2RIO A;  2YJ7 A;  1T8E B;  2V41 A;  4ILF A;  5C04 A;  1PFO A;  2JB1 A;  3APO A;  3ZVJ A;  2HZE B;  1GP1 A;  2NDO A;  4K7O A;  3M8N A;  3QFA C;  4NV2 A;  4IKH A;  1URM A;  3BD2 A;  2LRT A;  2N5F A;  2KKM A;  4J57 E;  2V1C C;  3ZYW A;  2JB3 A;  3A3T A;  4WBJ A;  4I8B A;  3FMW A;  1PKZ A;  4V2M A;  5D9X A;  1TXX A;  5AN1 A;  2MYG A;  2O7K A;  4YAV A;  2YAN A;  1KNG A;  2L4Q A;  2VD1 A;  2NTO A;  4XS4 B;  1MDK A;  3US3 A;  1XXU A;  1YZX A;  3LG6 A;  1F2E A;  1NHO A;  3QAW A;  4XS1 A;  1AAZ A;  3IPZ A;  1WIK A;  1SL1 B;  4MH2 A;  1B48 A;  3DML A;  2DMM A;  3RPN A;  1PGT A;  5KN1 A;  4XCS A;  4JZQ A;  4OFM A;  3L4N A;  2IMF A;  3PR8 A;  10GS A;  1TW9 A;  2B1K A;  1SEN A;  5KOW A;  1I9D A;  2DJ1 A;  5C00 A;  1BYE A;  2FHE A;  1B4P A;  1PN0 A;  2LQO A;  3HXS A;  2OA7 A;  4P3Y B;  3L0H A;  5F0G A;  4K2D A;  4K5R A;  2HRF A;  3JCM L;  5DJM A;  5GAN D;  3HVV A;  5F05 A;  3KP8 A;  1JQO A;  2JL4 A;  4HU9 A;  1V98 A;  1A2J A;  5CYY A;  2X99 A;  4BVX A;  5G5F A;  3MWH A;  2VIM A;  3H79 A;  3ZIJ A;  4Z2U A;  1RQM A;  3FEU A;  4LLR A;  2YCD A;  2PVQ A;  3EYT A;  4CHS A;  4XHM A;  3FZ5 A;  5H5Q A;  1ERW A;  3GUS A;  1T1V A;  3CTG A;  3UEM A;  4V1A g;  1FB6 A;  1GUK A;  3CQF A;  5KEJ A;  4ECC A;  5GST A;  1XVQ A;  3GNJ A;  1V2A A;  3MNG A;  4AGS A;  4RI7 A;  1USB A;  3O6T A;  1G6W A;  1M2B A;  1VGL A;  1TU7 A;  2LKU A;  5DDL A;  2VAF A;  1VF4 A;  3EWL A;  2IMK A;  16GS A;  2YFA A;  1M99 A;  1Z9H A;  2G0F A;  1K0D A;  3KZQ A;  4YAP A;  3CYN A;  2XPD A;  4ZL7 A;  1B8X A;  3LQ7 A;  1S3C A;  3TB2 A;  2DJ0 A;  4MF5 A;  4DVC A;  1U88 A;  4YQV A;  1MTC A;  2DKI A;  3DYR A;  4KND A;  2RM5 A;  2LS5 A;  1XIY A;  2IL3 A;  2YFB A;  2JSY A;  5ECN B;  2IFQ A;  4I97 A;  3IE3 A;  5D96 A;  2LJR A;  4MCU A;  1ERV A;  2HXK A;  3VPT A;  4GST A;  3GX0 A;  3HVN A;  4XRA A;  1QMV A;  3VWV A;  1ABA A;  4GWR A;  1XWA A;  5H5R A;  3IK9 A;  4WET A;  2YZU A;  2AJQ B;  4ISD A;  2C3N A;  3CXG A;  1K3O A;  3IBH A;  1ZCP A;  4FYB A;  4X1U A;  2JZT A;  3ME7 A;  5ECO B;  4U6R A;  1JFU A;  4PGT A;  3CRT A;  2DJ2 A;  5D9V A;  3LJR A;  3A5I A;  5LNK 1;  2BJX A;  1XW9 A;  4KSO A;  4PUF C;  3VK9 A;  1A24 A;  2ZNM A;  2OAC A;  5COH A;  3ZVJ D;  4CY8 A;  1MEK A;  2WGR A;  1A8Y A;  2YNX A;  3FKF A;  4ZBA A;  2FWE A;  5ECH B;  3HA9 A;  1HD2 A;  4G10 A;  2OE1 A;  3NIV A;  3EPT A;  5KN0 A;  1WPI A;  2NBS A;  3C71 A;  1Z3E A;  1GSU A;  1YEX A;  4MZW A;  1T4Z A;  5HR2 A;  2JZS A;  4OO4 A;  3IA1 A;  4JR4 A;  1X0R A;  3TKR A;  1VRS D;  4F0C A;  3TCO A;  3FRC A;  2DLX A;  2VM2 A;  4HJ2 A;  5JWO B;  4IP1 A;  2R0C A;  3C1S A;  2DIZ A;  3VFI A;  5F07 A;  4K5S A;  1AUC A;  1BED A;  3VWX A;  3U6V A;  3IV4 A;  1PSQ A;  1ML6 A;  5GZZ B;  3G7J A;  1HQO A;  1TRS A;  4GQC A;  1TJD A;  13GS A;  3TOU A;  2VL9 A;  3ZML A;  3MDK A;  4WEY A;  4EDY A;  3HHV A;  4RI6 A;  3CSH A;  5LD0 A;  3IC4 A;  2YWN A;  2LJK A;  1YJ6 A;  1W89 A;  3K8N A;  5FT3 A;  3WGD A;  2VLU A;  1JZW A;  4IQA A;  2I4A A;  2H01 A;  3GIX A;  1GLQ A;  4IJ3 A;  1A2L A;  5KOX A;  3RAZ A;  3GUR A;  1ZOF A;  2HZE A;  1SU9 A;  2L5O A;  3DO9 A;  3BCK A;  4I5Q A;  4G9H A;  1G7E A;  2H66 A;  2VD0 A;  3QMX A;  1ST9 A;  4KCA A;  3ZIV A;  1GSY A;  2TRC P;  1G7O A;  2V6O A;  5IM9 A;  3B55 A;  1NHY A;  3EMX A;  2K9F A;  1AQW A;  1MDI A;  2B3S A;  2LTK A;  2V1M A;  3W8J A;  4MJB A;  4MF6 A;  3CSJ A;  4PUR A;  2VCQ A;  1XWB A;  1W3S A;  5L71 A;  3ZZX A;  4XS4 A;  3S9F A;  3ERG A;  2X64 A;  3QAV A;  5HR3 A;  4KE3 A;  2F8F A;  1J0F A;  4CY6 A;  2BMX A;  4F03 A;  4ML6 A;  2ON5 A;  9GSS A;  1AW9 A;  2EIR A;  4FO5 A;  2IP6 A;  2MMZ A;  3ME8 A;  3L9U A;  4O1O A;  5IMC A;  5DBQ A;  4PQI A;  3N5O A;  3GRX A;  4DWL A;  1B9Y C;  5EPF A;  5G2Z A;  4F0B A;  2K19 A;  4AS2 A;  1IYI A;  5J9B A;  4F9Z A;  1K0M A;  1XWC A;  2PPT A;  5DCG A;  4TOP A;  3TKP A;  4BIK A;  3KMO A;  4BA7 A;  2HT9 A;  2RLD A;  2R6K A;  3DWV A;  4G0K A;  2R37 A;  4G75 A;  1DBY A;  1Y25 A;  2O89 A;  2WRT A;  4N11 A;  4PQH A;  2R2J A;  1NSW A;  4ZIL A;  4XS6 A;  3LJ0 A;  4MA9 A;  4EVM A;  5CAX A;  4IW9 A;  1V57 A;  4IJI A;  5DAK B;  7GSS A;  4KAE A;  2F51 A;  2MMN A;  1B9X C;  4JE1 A;  3J7Y k;  1T00 A;  3I6A A;  5D9W A;  5J5N A;  2AV4 A;  4MJC A;  20GS A;  5B8A A;  4N10 A;  2CAZ B;  4RQX A;  3CRU A;  4BWS A;  2RAD A;  1BX9 A;  4MPG A;  5IIZ A;  4WKW A;  4OFN A;  6GST A;  2E0Q A;  3R3E A;  4DSR A;  5DVB A;  2R5G A;  3KP9 A;  4DEJ A;  1XW5 A;  1XVW A;  3TJJ A;  1JZR A;  2ZW3 A;  2GGT A;  1ON4 A;  4OMV A;  4HZ2 A;  4HU7 A;  4BPY A;  1GSS A;  2VCX A;  4IBP A;  3Q18 A;  5JCU A;  3DD3 A;  2WJU A;  2VUP A;  2HZF A;  1HYU A;  4ICY A;  2A2R A;  2GZZ A;  1NM3 A;  1Z7P A;  3P90 A;  4WR4 A;  2QA1 A;  2JSZ A;  4ECI A;  4JBB A;  2K6V A;  2C4J A;  8GSS A;  1BJX A;  3WGE A;  4LL4 B;  3F8U A;  2PVO C;  5IMV A;  2DJJ A;  4FYC A;  4TW5 A;  4MZC A;  4PQ1 A;  1WWJ A;  4DSS A;  3FR3 A;  4OWY A;  3KH9 A;  2HRA A;  5IMA A;  4TRX A;  4XTS A;  2XPE A;  3CSI A;  4NMU A;  1XOB A;  1SKW B;  1FVJ A;  1SJ8 A;  1FB0 A;  2OJL A;  2MBT A;  3ERF A;  2ALB A;  1JLW A;  1WP0 A;  3SDJ A;  4TXO B;  3I9V 1;  2IMD A;  1GSF A;  4JCV E;  1UVZ A;  5ECI B;  1YKC A;  5A5K A;  3HVS A;  3FY7 A;  2C0D A;  4KB3 A;  3FR6 A;  4X43 A;  1HNA A;  4HS1 A;  2PMT A;  6GSS A;  3IAM 2;  2YJH A;  5G1K A;  2FWG A;  2QSI A;  3F4R A;  4MLY A;  1CQG A;  2RM6 A;  2FY6 A;  4KW6 A;  2AHE A;  4TR1 B;  1SD8 A;  1SJZ A;  2H1A A;  2FU2 A;  3APQ A;  4O5U A;  1ZGN A;  1WMJ A;  5DAL A;  2OKA A;  3KGK A;  2JAE A;  5HR0 A;  2WDU A;  4BL7 B;  1Y6E A;  3L0I A;  1TI1 A;  4GXT A;  4IEL A;  2NVL A;  2LNT A;  4KA0 A;  1A8L A;  2C0F A;  2REM A;  2FUG 1;  1EV9 A;  1MD3 A;  1V58 A;  4AJ7 A;  6GSY A;  4K8M A;  3UAR A;  5J9C A;  2H0I A;  3MIX A;  4YZ9 A;  3FZ4 A;  4MJA A;  4K6X A;  2ON7 A;  4G0L A;  4HUA A;  2EC4 A;  3KJY A;  2N5A A;  1YDK A;  4E8E A;  3IAM 1;  1KBN A;  5A4W A;  2MMO A;  1X5D A;  3LYP A;  3DA3 A;  4POK A;  1JLV A;  4GLT A;  1ZYN A;  5D8I A;  2H1B A;  5IMD A;  4L0U A;  2FWF A;  1K0O A;  4O92 A;  4EIQ A;  2JAD A;  4POL A;  3VA9 A;  1QUW A;  1EZK A;  1C72 A;  2TIR A;  2YV9 A;  1Z7R A;  4MP4 A;  2ZCT A;  1X5C A;  4AJ8 A;  4NXI A;  2GZY A;  2A2P A;  4LMV A;  1OC9 A;  5CP1 A;  1XPV A;  2L6C A;  5AIV A;  4EUY A;  1K3Y A;  2CX4 A;  5ECL B;  3H93 A;  3F63 A;  2CA8 A;  5G5E A;  4Z7H A;  4Q9V A;  2GLR A;  1IYH A;  4PTS A;  1GTU A;  1O7U A;  3L78 A;  1DSB A;  4CW9 A;  1R5A A;  1X9W B;  2VL2 C;  4PNG A;  3QAG A;  3KIJ A;  4EF0 A;  1V40 A;  3UIT A;  2XBI A;  4KDU A;  1QXH A;  1E6B A;  1M0U A;  2L4C A;  1PRX A;  3WGX A;  4V2N A;  1XZO A;  3UOM A;  2UZ8 A;  4EDZ A;  3RPP A;  4TR3 A;  4YH2 A;  1PL2 A;  4E8H A;  2Z9S A;  4PXO A;  1Z6N A;  3GYK A;  1CQH A;  1DUG A;  1KEB A;  4EKZ A;  2C3Q A;  4GXZ A;  4AS3 A;  4NPB A;  1ACV A;  1W4V A;  5EY6 A;  2OBI A;  2MJF B;  1M7T A;  1OVN A;  2YWO A;  2K8V A;  3D21 A;  4KDY A;  5DCH A;  2BTO T;  1V9W A;  2ZUP A;  3FBV A;  4PX1 A;  3FZA A;  1SYX A;  3QPM A;  2C0E A;  3UBK A;  2GQL A;  4Q5F A;  2H8L A;  4HQZ A;  2VLV A;  2R3X A;  2HGK A;  2R4V A;  2C80 A;  3ED3 A;  2OAD A;  4GQF A;  1N2A A;  2K8S A;  2RUF A;  3I69 A;  3BCI A;  1XWG A;  4IS0 A;  12GS A;  11GS A;  2F9S A;  3UJ1 A;  3LXZ A;  4L0W A;  3ZMK A;  2A4H A;  4FQU A;  1U5K A;  5FHI A;  1GUH A;  2C1Y A;  4ULX A;  4ZL9 A;  5GSS A;  3DRN A;  5JWQ B;  4KCE A;  1PX6 A;  1M2A A;  2I81 A;  2GT6 A;  1MDJ A;  4ZB9 A;  1FHE A;  2GQM A;  2WS2 A;  1GRX A;  4DSQ A;  2E7P A;  3GTU A;  1EV4 A;  5B8B A;  1R26 A;  1YF1 A;  1F6M C;  1A23 A;  1TTZ A;  4TXV A;  3ZLP A;  2X8H A;  3QFB C;  3FW2 A;  4EXJ A;  4OAU C;  1QFN A;  1SK0 A;  3KM6 A;  4I2U A;  2WZ9 A;  3TJF A;  6GSW A;  3FR9 A;  3DXB A;  1K3L A;  2QZG A;  1SJ6 A;  2J9H A;  3DGQ A;  2L57 A;  2C3T A;  3TRP A;  2GVP A;  4G0I A;  1SK1 A;  4ZXG A;  1YQ1 A;  5B6M A;  1GLP A;  1TKD B;  1JZD A;  3ZRD A;  3LSZ A;  3L9S A;  2VL2 A;  1Q98 A;  1FG4 A;  3F4T A;  3GH6 A;  1AIU A;  1NW2 A;  2MZC A;  3QD9 A;  5HFI A;  3P7X A;  2E8G A;  4KX4 A;  3SWL A;  5DQS A;  5A4U A;  2K18 A;  3I43 A;  3EU3 A;  1FOH A;  1LBK A;  2A2D A;  4D73 A;  5IO0 A;  2B1L A;  4K7N A;  1YKA A;  1PD2 1;  4HFV A;  5ID2 B;  4TXO A;  2IWT A;  1K0N A;  3APS A;  5ECR B;  1S3D A;  5LCZ A;  4HDE A;  1ZYE A;  2O87 A;  1QGV A;  5CRD A;  5LNK e;  4USS A;  1GTB A;  3DA4 A;  1AQX A;  1M9B A;  5CRH A;  2CVD A;  1PA3 A;  1ZYP A;  3C73 A;  5G1L A;  2TRX A;  3TJK A;  2FEF A;  1K0C A;  3W6G A;  3UIW A;  1WE0 A;  3RHB A;  2DJK A;  4TR1 A;  2OE0 A;  2LQQ A;  2HSY A;  4LA1 A;  4X0X A;  5INY A;  5IMF A;  1JHB A;  1PMT A;  2IPA A;  4QL9 A;  2LRN A;  3HJM A;  5ECM B;  1GNW A;  1YO7 A;  2X8G A;  2B5E A;  4ECJ A;  1U6T A;  2E2M A;  3HYP A;  3GKX A;  3CMI A;  4K0G A;  5G31 A;  3GL5 A;  4J2F A;  1FO5 A;  2RII A;  4O5R A;  2HNL A;  2L59 A;  3ERW A;  3IOS A;  3IRA A;  3KH7 A;  2ES7 A;  3C1R A;  2P22 B;  3J7Y b;  2YPM A;  3P23 A;  4YKG A;  1UA5 A;  2HRN A;  4O7H A;  3BBY A;  5B6N A;  1M3I A;  2MBS A;  2F66 B;  3GN3 A;  2GSQ A;  3GV1 A;  2HFD A;  3O76 A;  1SKS B;  1GWC A;  1DE2 A;  2PWJ A;  2GTU A;  1GTI A;  3C8E A;  2H1D A;  1ZL9 A;  2FD3 A;  3A2V A;  3KD0 A;  2WUL A;  4PL5 A;  2GS3 A;  4ML1 A;  1FAA A;  3PH9 A;  4IGJ A;  2BL7 A;  3R2Q A;  2VL3 A;  4MAB A;  3DKS A;  2JZR A;  4ZB6 A;  4TR0 A;  5JWR B;  2VCT A;  3ZFL A;  3W8S A;  4MH3 A;  1M9A A;  4L8E A;  3LFL A;  3TKS C;  5J3R A;  1GH2 A;  5D73 A;  3ZTL A;  5EVO A;  3Q19 A;  3D0Z A;  4ZL8 A;  3EVI A;  4NV5 A;  4LMW A;  4LL1 B;  1E2Y A;  1FOV A;  5F8B A;  2FA4 A;  4N30 A;  3M9K A;  2LNS A;  1EOG A;  3EUR A;  5D93 A;  5IOX A;  1SL0 B;  1FVK A;  2IFQ B;  1JZO A;  2DSA A;  2H1G A;  1OE7 A;  4TKY A;  1TDI A;  5HFK A;  2VO4 A;  2NPB A;  3M0F A;  2FLS A;  2B7J A;  3M9J A;  3LYK A;  1O8W A;  14GS A;  1GSD A;  3LJ1 A;  2JAC A;  5ABR A;  1EP8 A;  4HI7 A;  4BVY B;  2LRC A;  3TKQ A;  1OKT A;  1RW1 A;  4EC0 A;  2AYT A;  3I9V 2;  4Z7X A;  2GSR A;  3BJ5 A;  4K7I A;  6GSX A;  5HQP A;  2CVK A;  4TR4 A;  3H4K A;  2L5L A;  2MMA A;  2BL8 A;  1OYJ A;  3L9V A;  1F3A A;  3VI7 A;  2FWH A;  2CAQ A;  4RUV A;  3GH9 A;  2WCI A;  4JR6 A;  1X9M B;  3VUR A;  3OR5 A;  2I3Y A;  3TDG A;  4KF9 A;  1OC8 A;  4RQR A;  3N9J A;  4EIP A;  2H0H A;  4N0V A;  5KN2 A;  3VLN A;  3LJ2 A;  2I1U A;  5B7C A;  2YOI A;  3IDV A;  2QA2 A;  3KXO A;  4OD7 A;  3UAP A;  1TK0 B;  2FUG 2;  1T3B A;  1O85 A;  4JRR A;  1GSE A;  3ZL5 A;  2KUC A;  4G2E A;  5ELA A;  4OAV B;  4HQS A;  1EEM A;  4ZIJ A;  1FW1 A;  3PPU A;  3Q74 A;  4V2L A;  3QR6 A;  1YY7 A;  4QL7 A;  1K0B A;  4F82 A;  1EWX A;  2QSB A;  2I9H A;  2ETD A;  5DQY A;  1TOF A;  2H0G A;  2RUE A;  2M80 A;  1OC3 A;  5JCW A;  3IR4 A;  2GZP A;  1G6Y A;  3UBL A;  3VWU A;  1U3I A;  4YQM A;  2IIY A;  2KP1 A;  2L1L B;  1EGO A;  3G9B A;  1A0R P;  2JBW A;  2FA8 A;  3LEF A;  2N5B A;  2EIQ A;  4EE0 A;  4X4J A;  1OAZ A;  3GSS A;  2WB9 A;  2DML A;  2AUV A;  3SBC A;  4MZB A;  1TDP A;  1YEP A;  4OO5 A;  2VLT A;  5F06 A;  4I2T A;  1X5E A;  2YV7 A;  3CBU A;  1Q4J A;  3FHK A;  2R0P A;  1B4Q A;  2XC2 A;  5ID2 A;  1XCC A;  2B6M A;  2FGX A;  5D9T A;  1TP9 A;  2H6X A;  4XIH A;  1ZMA A;  1GL8 A;  2H74 A;  3F9U A;  2GQK A;  3UL3 A;  4KH7 A;  4PNF A;  3O3T A;  3D4M A;  1U87 A;  4L5O A;  3JSB A;  2XBQ A;  5A4V A;  4POB A;  4HSC X;  2VCW A;  3D22 A;  3V1W A;  2H30 A;  1O8X A;  3E3E A;  3RBT A;  1YF0 A;  5BRT A;  2GT5 A;  2VOC A;  3VWW A;  4GSS A;  1BG5 A;  3UMA A;  3LWA A;  3EU4 A;  2LJA A;  5CO3 A;  3GKN A;  4PL3 A;  3Q6O A;  2PU9 C;  3UVH A;  2VCZ A;  4GSN A;  2DJ3 A;  2GSC A;  2CQ9 A;  2P31 A;  5E59 A;  2F6M B;  2GST A;  2X8C A;  3E9J B;  1TK5 B;  2V32 A;  2B5X A;  1EP7 A;  4PUA A;  4IN0 A;  1TRV A;  3WD6 A;  2IJY A;  1PL1 A;  1Z6M A;  4YZC A;  2XHF A;  1BQ7 A;  5ENU A;  4K2X A; 
#chains in the Genus database with same CATH homology
 2VCV A;  4JU5 A;  1HNB A;  2B5Y A;  3KTB A;  3KTL A;  3TKS E;  4IVF A;  5CRW A;  5DJL A;  1SK2 A;  3U5R E;  4EL1 A;  2A4V A;  1AC1 A;  3GKM A;  1SKR B;  2LST A;  1S3A A;  1SJI A;  2YP6 A;  3A5W A;  2L6D A;  1R4W A;  3QOU A;  2DKH A;  1TK8 B;  3HZ4 A;  5KN3 A;  1GUL A;  2CT6 A;  3UVT A;  2AAW A;  1ZZY A;  3F3Q A;  4IQ1 A;  3G7Y A;  4WXT A;  1G0T A;  5ECS A;  1VF3 A;  2HI7 A;  5HFG A;  2OBK A;  3C7M A;  2CZ2 A;  3TUE A;  2DIY A;  3GHA A;  2H73 A;  5DAK A;  2LEG A;  4I1T A;  1PX7 A;  2PN8 A;  2KP2 A;  4WBR D;  2F3M A;  2YZH A;  2PGT A;  1WOU A;  3GMF A;  1A2M A;  1R5P A;  1VF2 A;  1O6J A;  2C0G A;  1PN9 A;  3TRX A;  4ECB A;  3LXT A;  2H70 A;  4ID0 A;  4BVY A;  2J23 A;  5IQY A;  4ZBD A;  5IPH A;  4DSS B;  2YWM A;  5AIS A;  2XTR A;  1UC7 A;  2LUS A;  3ZRE A;  2A2S A;  1SYR A;  5IMZ A;  1T7P B;  2QC7 A;  5IOW A;  5AGY A;  4A5P A;  1TI3 A;  1LJR A;  2C8U A;  1XW6 A;  4XRD A;  4KUN A;  2H76 A;  2GDR A;  1ERU A;  2CVB A;  1WJK A;  3EIN A;  4PL4 A;  3HCZ A;  3GL3 A;  3AY8 A;  4NHZ A;  3FYG A;  2PBJ A;  1XBS A;  2O85 A;  3TJG A;  5J41 A;  4Q5Q A;  3PIN A;  3LOR A;  3FK8 A;  2YN1 A;  3HDC A;  3P2A A;  3KMN A;  1SL2 B;  4CDO A;  5DAL B;  1PKW A;  2A2C A;  1RK4 A;  3WT1 A;  1HNC A;  3QDN A;  3F6F A;  1GSQ A;  1UN2 A;  2CAI A;  2FNO A;  4Q5N A;  2AB6 A;  2EIO A;  3DVX A;  4MPF A;  3VI5 A;  3IAS 2;  4MMM A;  5J4U A;  3KEB A;  4TVE A;  3F4S A;  5IO2 A;  2R0G A;  1F3B A;  4NHW A;  2QKE A;  1H75 A;  2P5R A;  4BWQ A;  1ZYQ B;  5ECP B;  2O8V B;  4J56 E;  3TJB A;  1XOA A;  1WRY A;  2IME A;  2P0G A;  1I5G A;  2V2G A;  1GUM A;  4FYU A;  4I6X A;  1MD4 A;  1TRW A;  3IK7 A;  1F9M A;  3H8Q A;  3QCP A;  4MJE A;  5E4W A;  2H71 A;  4BL7 A;  1THX A;  5GAP D;  5JCG A;  3GST A;  1GTA A;  4K0N A;  2ZRR A;  3IXR A;  4Q5R A;  2X4A A;  4KDX A;  4POM A;  1N8J A;  4MDC A;  1XWK A;  3DEX A;  4HEA 2;  2HRK A;  3H1N A;  4O1P A;  5HGI A;  2H19 A;  3BOA A;  4IP6 A;  4G76 A;  3PGT A;  4FIW A;  4IHU A;  1GNE A;  3TGZ A;  3E0U A;  3D4T A;  3LW9 A;  4YZD A;  3IAS 1;  18GS A;  5H5S A;  4F2I A;  1OC9 B;  2JU5 A;  3F6D A;  4GCI A;  3IHG A;  3GFK A;  3M1G A;  3WT2 A;  3HVX A;  4BVX B;  2E2G A;  2HLS A;  1TRU A;  3GX8 A;  3Q8D A;  1EGR A;  3GA4 A;  2XTQ A;  4AF2 A;  2PUK C;  1J08 A;  2H6Y A;  5IPG A;  1J9B A;  4O32 A;  4OCF A;  4H86 A;  2DC5 A;  2CZ3 A;  2HSH A;  3D6I A;  3D5J A;  5ECQ B;  1Z5Y E;  2G2Q A;  2RLI A;  1THO A;  3DIE A;  2DBC A;  3F0I A;  2M46 A;  5CRE A;  2OE3 A;  1SD9 A;  4O5Q A;  2JB2 A;  6GSU A;  2D2Z A;  3A2X A;  5BMU A;  5HR1 A;  2HE3 A;  3IC8 A;  4AJ6 A;  4HEA 1;  3EE2 A;  4OCE A;  2M72 A;  2LV3 A;  2YWI A;  1PQN A;  4GTU A;  1OE8 A;  1XFL A;  2KOK A;  5ELG A;  3ZFB A;  3EC3 A;  1QK8 A;  3G7I A;  3HJP A;  4GF0 A;  4NAX A;  2VM1 A;  3FZ9 A;  4MF7 A;  4L5L A;  5FWG A;  3GKK A;  4YKF A;  3DVW A;  3TRQ A;  4EO3 A;  4WR5 A;  1LU4 A;  3A2W A;  2HSM A;  1K0A A;  3TOT A;  4FH8 A;  2B7K A;  2H72 A;  2X49 A;  1A0F A;  2KHP A;  3MYD A;  5G30 A;  3HD5 A;  5ECK B;  1H4O A;  3CTF A;  3ISO A;  1AQV A;  6GSV A;  1QQ2 A;  4JED A;  4MNN A;  4ZB8 A;  2WFC A;  1AXD A;  3F4M A;  22GS A;  4ZBB A;  3GTU B;  1F37 A;  1M2D A;  4HJM A;  3AJF A;  2QGV A;  1R7H A;  2CV4 A;  1DE1 A;  3KCM A;  3RHC A;  2IN3 A;  3HY2 A;  3HKR A;  1BAY A;  2KLX A;  3IHQ A;  3ZIT A;  2H75 A;  2V6E A;  3RDW A;  3MAK A;  1ILO A;  4HOJ A;  1KTE A;  1EOH A;  1VF1 A;  4Z7G A;  2P5Q A;  2V6K A;  3HJO A;  19GS A;  3EMP A;  1T4Y A;  4G19 A;  3NOF A;  4NWY A;  4Z2T A;  4WF5 A;  4Z2R A;  4K9Z A;  2F8A A;  3VPQ A;  1EEJ A;  4QQ7 A;  3WYW A;  4N0Z A;  1OKD A;  3M3M A;  5AIX A;  4YQU A;  5CRG A;  4HZ4 A;  3NZN A;  3LGC A;  4KSM A;  2HYX A;  1O81 A;  4GRF A;  4V1A p;  3HZ8 A;  4TN8 A;  1ERT A;  4D73 B;  2PER A;  4KGI A;  1O73 A;  3F3R A;  2FCH A;  5EL8 A;  3MSZ A;  3TKS A;  4WF4 A;  4OFT A;  1U3A A;  1TU8 A;  4MK3 A;  2CX3 A;  2IMI A;  4K1F A;  2GSS A;  2H6Z A;  4ACS A;  2XMX A;  1X9S B;  5CNW A;  17GS A;  3P8W A;  2RIO A;  2YJ7 A;  1T8E B;  2V41 A;  4ILF A;  5C04 A;  2JB1 A;  3APO A;  3ZVJ A;  2HZE B;  1GP1 A;  2NDO A;  4K7O A;  3M8N A;  3QFA C;  4NV2 A;  4IKH A;  1URM A;  3BD2 A;  2LRT A;  2N5F A;  2KKM A;  4J57 E;  2V1C C;  3ZYW A;  2JB3 A;  3A3T A;  4WBJ A;  4I8B A;  3FMW A;  1PKZ A;  4V2M A;  5D9X A;  1TXX A;  5AN1 A;  2MYG A;  2O7K A;  4YAV A;  2YAN A;  1KNG A;  2L4Q A;  2VD1 A;  2NTO A;  4XS4 B;  1MDK A;  3US3 A;  1XXU A;  1YZX A;  3LG6 A;  1F2E A;  1NHO A;  3QAW A;  4XS1 A;  1AAZ A;  3IPZ A;  1WIK A;  1SL1 B;  4MH2 A;  1B48 A;  3DML A;  2DMM A;  3RPN A;  1PGT A;  5KN1 A;  4XCS A;  4JZQ A;  4OFM A;  3L4N A;  2IMF A;  3PR8 A;  10GS A;  1TW9 A;  2B1K A;  1SEN A;  5KOW A;  1I9D A;  2DJ1 A;  5C00 A;  1BYE A;  2FHE A;  1B4P A;  1PN0 A;  2LQO A;  3HXS A;  2OA7 A;  4P3Y B;  3L0H A;  5F0G A;  4K2D A;  4K5R A;  2HRF A;  3JCM L;  5DJM A;  5GAN D;  3HVV A;  5F05 A;  3KP8 A;  2JL4 A;  4HU9 A;  1V98 A;  1A2J A;  5CYY A;  2X99 A;  4BVX A;  5G5F A;  3MWH A;  2VIM A;  3H79 A;  3ZIJ A;  4Z2U A;  1RQM A;  3FEU A;  4LLR A;  2YCD A;  2PVQ A;  3EYT A;  4CHS A;  4XHM A;  3FZ5 A;  5H5Q A;  1ERW A;  3GUS A;  1T1V A;  3CTG A;  3UEM A;  4V1A g;  1FB6 A;  1GUK A;  5KEJ A;  4ECC A;  5GST A;  1XVQ A;  3GNJ A;  1V2A A;  3MNG A;  4AGS A;  4RI7 A;  1USB A;  3O6T A;  1G6W A;  1M2B A;  1VGL A;  1TU7 A;  2LKU A;  5DDL A;  2VAF A;  1VF4 A;  3EWL A;  2IMK A;  16GS A;  2YFA A;  1M99 A;  1Z9H A;  2G0F A;  1K0D A;  3KZQ A;  4YAP A;  3CYN A;  2XPD A;  4ZL7 A;  1B8X A;  3LQ7 A;  1S3C A;  3TB2 A;  2DJ0 A;  4MF5 A;  4DVC A;  1U88 A;  4YQV A;  1MTC A;  2DKI A;  3DYR A;  4KND A;  2RM5 A;  2LS5 A;  1XIY A;  2IL3 A;  2YFB A;  2JSY A;  5ECN B;  2IFQ A;  4I97 A;  3IE3 A;  5D96 A;  2LJR A;  4MCU A;  1ERV A;  2HXK A;  3VPT A;  4GST A;  3GX0 A;  4XRA A;  1QMV A;  3VWV A;  1ABA A;  4GWR A;  1XWA A;  5H5R A;  3IK9 A;  4WET A;  2YZU A;  2AJQ B;  4ISD A;  2C3N A;  3CXG A;  1K3O A;  3IBH A;  1ZCP A;  4FYB A;  4X1U A;  2JZT A;  3ME7 A;  5ECO B;  4U6R A;  1JFU A;  4PGT A;  3CRT A;  2DJ2 A;  5D9V A;  3LJR A;  3A5I A;  5LNK 1;  2BJX A;  1XW9 A;  4KSO A;  4PUF C;  3VK9 A;  1A24 A;  2ZNM A;  2OAC A;  5COH A;  3ZVJ D;  4CY8 A;  1MEK A;  2WGR A;  1A8Y A;  2YNX A;  3FKF A;  4ZBA A;  2FWE A;  5ECH B;  3HA9 A;  1HD2 A;  4G10 A;  2OE1 A;  3NIV A;  3EPT A;  5KN0 A;  1WPI A;  2NBS A;  3C71 A;  1Z3E A;  1GSU A;  1YEX A;  4MZW A;  1T4Z A;  5HR2 A;  2JZS A;  4OO4 A;  3IA1 A;  4JR4 A;  1X0R A;  3TKR A;  1VRS D;  4F0C A;  3TCO A;  3FRC A;  2DLX A;  2VM2 A;  4HJ2 A;  5JWO B;  4IP1 A;  2R0C A;  3C1S A;  2DIZ A;  3VFI A;  5F07 A;  4K5S A;  1AUC A;  1BED A;  3VWX A;  3U6V A;  3IV4 A;  1PSQ A;  1ML6 A;  5GZZ B;  3G7J A;  1HQO A;  1TRS A;  4GQC A;  1TJD A;  13GS A;  3TOU A;  2VL9 A;  3ZML A;  3MDK A;  4WEY A;  4EDY A;  3HHV A;  4RI6 A;  3CSH A;  5LD0 A;  3IC4 A;  2YWN A;  2LJK A;  1YJ6 A;  1W89 A;  3K8N A;  5FT3 A;  3WGD A;  2VLU A;  1JZW A;  4IQA A;  2I4A A;  2H01 A;  3GIX A;  1GLQ A;  4IJ3 A;  1A2L A;  5KOX A;  3RAZ A;  3GUR A;  1ZOF A;  2HZE A;  1SU9 A;  2L5O A;  3DO9 A;  3BCK A;  4I5Q A;  4G9H A;  1G7E A;  2H66 A;  2VD0 A;  3QMX A;  1ST9 A;  4KCA A;  3ZIV A;  1GSY A;  2TRC P;  1G7O A;  2V6O A;  5IM9 A;  1NHY A;  3EMX A;  2K9F A;  1AQW A;  1MDI A;  2B3S A;  2LTK A;  2V1M A;  3W8J A;  4MJB A;  4MF6 A;  3CSJ A;  4PUR A;  2VCQ A;  1XWB A;  1W3S A;  5L71 A;  3ZZX A;  4XS4 A;  3S9F A;  3ERG A;  2X64 A;  3QAV A;  5HR3 A;  4KE3 A;  2F8F A;  1J0F A;  4CY6 A;  2BMX A;  4F03 A;  4ML6 A;  2ON5 A;  9GSS A;  1AW9 A;  2EIR A;  4FO5 A;  2IP6 A;  2MMZ A;  3ME8 A;  3L9U A;  4O1O A;  5IMC A;  5DBQ A;  4PQI A;  3N5O A;  3GRX A;  4DWL A;  1B9Y C;  5EPF A;  5G2Z A;  4F0B A;  2K19 A;  4AS2 A;  1IYI A;  5J9B A;  4F9Z A;  1K0M A;  1XWC A;  2PPT A;  5DCG A;  4TOP A;  3TKP A;  3KMO A;  4BA7 A;  2HT9 A;  2R6K A;  3DWV A;  4G0K A;  2R37 A;  4G75 A;  1DBY A;  1Y25 A;  2O89 A;  2WRT A;  4N11 A;  4PQH A;  2R2J A;  1NSW A;  4ZIL A;  4XS6 A;  3LJ0 A;  4MA9 A;  4EVM A;  5CAX A;  4IW9 A;  1V57 A;  4IJI A;  5DAK B;  7GSS A;  4KAE A;  2F51 A;  2MMN A;  1B9X C;  4JE1 A;  3J7Y k;  1T00 A;  3I6A A;  5D9W A;  5J5N A;  2AV4 A;  4MJC A;  20GS A;  5B8A A;  4N10 A;  2CAZ B;  4RQX A;  3CRU A;  4BWS A;  1BX9 A;  4MPG A;  5IIZ A;  4WKW A;  4OFN A;  6GST A;  2E0Q A;  3R3E A;  4DSR A;  5DVB A;  2R5G A;  3KP9 A;  4DEJ A;  1XW5 A;  1XVW A;  3TJJ A;  1JZR A;  2GGT A;  1ON4 A;  4OMV A;  4HZ2 A;  4HU7 A;  4BPY A;  1GSS A;  2VCX A;  4IBP A;  3Q18 A;  5JCU A;  3DD3 A;  2WJU A;  2VUP A;  2HZF A;  1HYU A;  4ICY A;  2A2R A;  2GZZ A;  1NM3 A;  1Z7P A;  3P90 A;  4WR4 A;  2QA1 A;  2JSZ A;  4ECI A;  4JBB A;  2K6V A;  2C4J A;  8GSS A;  1BJX A;  3WGE A;  4LL4 B;  3F8U A;  2PVO C;  5IMV A;  2DJJ A;  4FYC A;  4TW5 A;  4MZC A;  4PQ1 A;  1WWJ A;  4DSS A;  3FR3 A;  4OWY A;  3KH9 A;  2HRA A;  5IMA A;  4TRX A;  4XTS A;  2XPE A;  3CSI A;  4NMU A;  1XOB A;  1SKW B;  1FVJ A;  1SJ8 A;  1FB0 A;  2OJL A;  2MBT A;  3ERF A;  2ALB A;  1JLW A;  1WP0 A;  3SDJ A;  4TXO B;  3I9V 1;  2IMD A;  1GSF A;  4JCV E;  1UVZ A;  5ECI B;  1YKC A;  5A5K A;  3HVS A;  3FY7 A;  2C0D A;  4KB3 A;  3FR6 A;  4X43 A;  1HNA A;  4HS1 A;  2PMT A;  6GSS A;  3IAM 2;  2YJH A;  5G1K A;  2FWG A;  2QSI A;  3F4R A;  4MLY A;  1CQG A;  2RM6 A;  2FY6 A;  4KW6 A;  2AHE A;  4TR1 B;  1SD8 A;  1SJZ A;  2H1A A;  3APQ A;  4O5U A;  1ZGN A;  1WMJ A;  5DAL A;  2OKA A;  3KGK A;  2JAE A;  5HR0 A;  2WDU A;  4BL7 B;  1Y6E A;  3L0I A;  1TI1 A;  4GXT A;  4IEL A;  2NVL A;  2LNT A;  4KA0 A;  1A8L A;  2C0F A;  2REM A;  2FUG 1;  1EV9 A;  1MD3 A;  1V58 A;  4AJ7 A;  6GSY A;  4K8M A;  3UAR A;  5J9C A;  2H0I A;  3MIX A;  4YZ9 A;  3FZ4 A;  4MJA A;  4K6X A;  2ON7 A;  4G0L A;  4HUA A;  2EC4 A;  3KJY A;  2N5A A;  1YDK A;  4E8E A;  3IAM 1;  1KBN A;  5A4W A;  2MMO A;  1X5D A;  3LYP A;  3DA3 A;  4POK A;  1JLV A;  4GLT A;  1ZYN A;  5D8I A;  2H1B A;  5IMD A;  4L0U A;  2FWF A;  1K0O A;  4O92 A;  4EIQ A;  2JAD A;  4POL A;  3VA9 A;  1QUW A;  1EZK A;  1C72 A;  2TIR A;  2YV9 A;  1Z7R A;  4MP4 A;  2ZCT A;  1X5C A;  4AJ8 A;  4NXI A;  2GZY A;  2A2P A;  4LMV A;  1OC9 A;  5CP1 A;  1XPV A;  2L6C A;  5AIV A;  4EUY A;  1K3Y A;  2CX4 A;  5ECL B;  3H93 A;  3F63 A;  2CA8 A;  5G5E A;  4Z7H A;  4Q9V A;  2GLR A;  1IYH A;  4PTS A;  1GTU A;  1O7U A;  3L78 A;  1DSB A;  4CW9 A;  1R5A A;  1X9W B;  2VL2 C;  4PNG A;  3QAG A;  3KIJ A;  4EF0 A;  1V40 A;  3UIT A;  2XBI A;  4KDU A;  1QXH A;  1E6B A;  1M0U A;  2L4C A;  1PRX A;  3WGX A;  4V2N A;  1XZO A;  3UOM A;  2UZ8 A;  4EDZ A;  3RPP A;  4TR3 A;  4YH2 A;  1PL2 A;  4E8H A;  2Z9S A;  4PXO A;  1Z6N A;  3GYK A;  1CQH A;  1DUG A;  1KEB A;  4EKZ A;  2C3Q A;  4GXZ A;  4AS3 A;  4NPB A;  1ACV A;  1W4V A;  5EY6 A;  2OBI A;  2MJF B;  1M7T A;  1OVN A;  2YWO A;  2K8V A;  3D21 A;  4KDY A;  5DCH A;  2BTO T;  1V9W A;  2ZUP A;  3FBV A;  4PX1 A;  3FZA A;  1SYX A;  3QPM A;  2C0E A;  3UBK A;  2GQL A;  4Q5F A;  2H8L A;  4HQZ A;  2VLV A;  2R3X A;  2R4V A;  2C80 A;  3ED3 A;  2OAD A;  4GQF A;  1N2A A;  2K8S A;  2RUF A;  3I69 A;  3BCI A;  1XWG A;  4IS0 A;  12GS A;  11GS A;  2F9S A;  3UJ1 A;  3LXZ A;  4L0W A;  3ZMK A;  2A4H A;  4FQU A;  1U5K A;  5FHI A;  1GUH A;  2C1Y A;  4ULX A;  4ZL9 A;  5GSS A;  3DRN A;  5JWQ B;  4KCE A;  1PX6 A;  1M2A A;  2I81 A;  2GT6 A;  1MDJ A;  4ZB9 A;  1FHE A;  2GQM A;  2WS2 A;  1GRX A;  4DSQ A;  2E7P A;  3GTU A;  1EV4 A;  5B8B A;  1R26 A;  1YF1 A;  1F6M C;  1A23 A;  1TTZ A;  4TXV A;  3ZLP A;  2X8H A;  3QFB C;  3FW2 A;  4EXJ A;  4OAU C;  1QFN A;  1SK0 A;  3KM6 A;  4I2U A;  2WZ9 A;  3TJF A;  6GSW A;  3FR9 A;  3DXB A;  1K3L A;  1SJ6 A;  2J9H A;  3DGQ A;  2L57 A;  2C3T A;  3TRP A;  2GVP A;  4G0I A;  1SK1 A;  4ZXG A;  1YQ1 A;  5B6M A;  1GLP A;  1TKD B;  1JZD A;  3ZRD A;  3LSZ A;  3L9S A;  2VL2 A;  1Q98 A;  1FG4 A;  3F4T A;  3GH6 A;  1AIU A;  1NW2 A;  2MZC A;  3QD9 A;  5HFI A;  3P7X A;  2E8G A;  4KX4 A;  3SWL A;  5DQS A;  5A4U A;  2K18 A;  3I43 A;  3EU3 A;  1FOH A;  1LBK A;  2A2D A;  4D73 A;  5IO0 A;  2B1L A;  4K7N A;  1YKA A;  1PD2 1;  4HFV A;  5ID2 B;  4TXO A;  2IWT A;  1K0N A;  3APS A;  5ECR B;  1S3D A;  5LCZ A;  4HDE A;  1ZYE A;  2O87 A;  1QGV A;  5CRD A;  5LNK e;  4USS A;  1GTB A;  3DA4 A;  1AQX A;  1M9B A;  5CRH A;  2CVD A;  1PA3 A;  1ZYP A;  3C73 A;  5G1L A;  2TRX A;  3TJK A;  1K0C A;  3W6G A;  3UIW A;  1WE0 A;  3RHB A;  2DJK A;  4TR1 A;  2OE0 A;  2LQQ A;  2HSY A;  4LA1 A;  4X0X A;  5INY A;  5IMF A;  1JHB A;  1PMT A;  2IPA A;  4QL9 A;  2LRN A;  3HJM A;  5ECM B;  1GNW A;  1YO7 A;  2X8G A;  2B5E A;  4ECJ A;  1U6T A;  2E2M A;  3HYP A;  3GKX A;  3CMI A;  4K0G A;  5G31 A;  3GL5 A;  4J2F A;  1FO5 A;  2RII A;  4O5R A;  2HNL A;  2L59 A;  3ERW A;  3IOS A;  3IRA A;  3KH7 A;  2ES7 A;  3C1R A;  2P22 B;  3J7Y b;  2YPM A;  3P23 A;  4YKG A;  1UA5 A;  2HRN A;  4O7H A;  3BBY A;  5B6N A;  2MBS A;  2F66 B;  3GN3 A;  2GSQ A;  3GV1 A;  2HFD A;  3O76 A;  1SKS B;  1GWC A;  1DE2 A;  2PWJ A;  2GTU A;  1GTI A;  3C8E A;  2H1D A;  1ZL9 A;  2FD3 A;  3A2V A;  3KD0 A;  2WUL A;  4PL5 A;  2GS3 A;  4ML1 A;  1FAA A;  3PH9 A;  4IGJ A;  3R2Q A;  2VL3 A;  4MAB A;  3DKS A;  2JZR A;  4ZB6 A;  4TR0 A;  5JWR B;  2VCT A;  3ZFL A;  3W8S A;  4MH3 A;  1M9A A;  4L8E A;  3LFL A;  3TKS C;  5J3R A;  1GH2 A;  5D73 A;  3ZTL A;  5EVO A;  3Q19 A;  3D0Z A;  4ZL8 A;  3EVI A;  4NV5 A;  4LMW A;  4LL1 B;  1E2Y A;  1FOV A;  5F8B A;  2FA4 A;  4N30 A;  3M9K A;  2LNS A;  1EOG A;  3EUR A;  5D93 A;  5IOX A;  1SL0 B;  1FVK A;  2IFQ B;  1JZO A;  2DSA A;  2H1G A;  1OE7 A;  4TKY A;  1TDI A;  5HFK A;  2VO4 A;  2NPB A;  3M0F A;  2FLS A;  2B7J A;  3M9J A;  3LYK A;  1O8W A;  14GS A;  1GSD A;  3LJ1 A;  2JAC A;  5ABR A;  1EP8 A;  4HI7 A;  4BVY B;  2LRC A;  3TKQ A;  1OKT A;  1RW1 A;  4EC0 A;  2AYT A;  3I9V 2;  4Z7X A;  2GSR A;  3BJ5 A;  4K7I A;  6GSX A;  5HQP A;  2CVK A;  4TR4 A;  3H4K A;  2L5L A;  2MMA A;  1OYJ A;  3L9V A;  1F3A A;  3VI7 A;  2FWH A;  2CAQ A;  4RUV A;  3GH9 A;  2WCI A;  4JR6 A;  1X9M B;  3VUR A;  3OR5 A;  2I3Y A;  3TDG A;  4KF9 A;  1OC8 A;  4RQR A;  3N9J A;  4EIP A;  2H0H A;  4N0V A;  5KN2 A;  3VLN A;  3LJ2 A;  2I1U A;  5B7C A;  2YOI A;  3IDV A;  2QA2 A;  3KXO A;  4OD7 A;  3UAP A;  1TK0 B;  2FUG 2;  1T3B A;  1O85 A;  4JRR A;  1GSE A;  3ZL5 A;  2KUC A;  4G2E A;  5ELA A;  4OAV B;  4HQS A;  1EEM A;  4ZIJ A;  1FW1 A;  3PPU A;  3Q74 A;  4V2L A;  3QR6 A;  1YY7 A;  4QL7 A;  1K0B A;  4F82 A;  1EWX A;  2I9H A;  5DQY A;  1TOF A;  2H0G A;  2RUE A;  2M80 A;  1OC3 A;  5JCW A;  3IR4 A;  2GZP A;  1G6Y A;  3UBL A;  3VWU A;  1U3I A;  4YQM A;  2IIY A;  2KP1 A;  2L1L B;  1EGO A;  3G9B A;  1A0R P;  2FA8 A;  3LEF A;  2N5B A;  2EIQ A;  4EE0 A;  4X4J A;  1OAZ A;  3GSS A;  2WB9 A;  2DML A;  2AUV A;  3SBC A;  4MZB A;  1YEP A;  4OO5 A;  2VLT A;  5F06 A;  4I2T A;  1X5E A;  2YV7 A;  3CBU A;  1Q4J A;  3FHK A;  2R0P A;  1B4Q A;  2XC2 A;  5ID2 A;  1XCC A;  2B6M A;  2FGX A;  5D9T A;  1TP9 A;  2H6X A;  4XIH A;  1ZMA A;  1GL8 A;  2H74 A;  3F9U A;  2GQK A;  3UL3 A;  4KH7 A;  4PNF A;  3O3T A;  3D4M A;  1U87 A;  4L5O A;  3JSB A;  2XBQ A;  5A4V A;  4POB A;  2VCW A;  3D22 A;  3V1W A;  2H30 A;  1O8X A;  3E3E A;  3RBT A;  1YF0 A;  5BRT A;  2GT5 A;  2VOC A;  3VWW A;  4GSS A;  1BG5 A;  3UMA A;  3LWA A;  3EU4 A;  2LJA A;  5CO3 A;  3GKN A;  4PL3 A;  3Q6O A;  2PU9 C;  3UVH A;  2VCZ A;  4GSN A;  2DJ3 A;  2CQ9 A;  2P31 A;  5E59 A;  2F6M B;  2GST A;  2X8C A;  3E9J B;  1TK5 B;  2V32 A;  2B5X A;  1EP7 A;  4PUA A;  4IN0 A;  1TRV A;  3WD6 A;  2IJY A;  1PL1 A;  1Z6M A;  4YZC A;  2XHF A;  1BQ7 A;  5ENU A;  4K2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...