2K19A

Nmr solution structure of pisi
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'MGKLKWFSGGKERSNQAENIITDLLDDLKTDLDNESLKKVLENYLEELKQKSASVPLILSRMNLDISKAIRNDGVTLSDYQSKKLKELTSISNIRYGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative piscicolin 126 immunity protein
publication title Nuclear magnetic resonance solution structure of PisI, a group B immunity protein that provides protection against the type IIa bacteriocin piscicolin 126, PisA.
pubmed doi rcsb
source organism Carnobacterium maltaromaticum
molecule tags Antimicrobial protein
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08951 EntA_Immun Enterocin A Immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.140 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2k19A00
2K19A 2ZRRA 2IP6A
chains in the Genus database with same CATH superfamily
2E8GA 2RADA 4GXTA 2FU2A 3AJFA 2IP6A 2JB2A 4Z7GA 1JQOA 3FBVA 2YFBA 2ETDA 2BL7A 1YO7A 2QSBA 4DWLA 3FVVA 4Q9VA 3FNBA 2V1CC 2GSCA 2P22B 4O1PA 3IAS1 1TDPA 3KP9A 2ZRRA 2FUG1 2XTQA 4YZCA 2XMXA 2FEFA 3IAM1 4HFVA 2CAZB 4U6RA 4HEA1 4PL4A 3Q8DA 2KKMA 2QGMA 5HGIA 3UITA 1SJ8A 2MJFB 2HGKA 4NV5A 2JBWA 2YFAA 3DA3A 2F6MB 4OAUC 4YZDA 4AS2A 2V6EA 2BL8A 2RLDA 2K19A 4Z7HA 4AS3A 4PL3A 2L1LB 4G75A 4OAVB 4JCVE 3JSBA 3L0IA 4O1OA 3SDJA 2QZGA 3DO9A 3LJ1A 2JAEA 3I9V1 3B55A 2ZW3A 1W3SA 4NV2A 2RIOA 1U5KA 3LJ2A 2A2DA 4I1TA 2F66B 2JB3A 3P23A 4YZ9A 5LNK1 4PL5A 3VA9A 3LJ0A 3F4MA 2JB1A 3DA4A 2XTRA 2A2CA 4G76A
chains in the Genus database with same CATH topology
2E8GA 4GXTA 3AJFA 2IP6A 2JB2A 4Z7GA 3FBVA 2YFBA 1YO7A 4DWLA 4Q9VA 2V1CC 2P22B 4O1PA 3IAS1 3KP9A 2ZRRA 2FUG1 2XTQA 4YZCA 2XMXA 3IAM1 4HFVA 2CAZB 4U6RA 4HEA1 4PL4A 3Q8DA 2KKMA 5HGIA 3UITA 1SJ8A 2MJFB 4NV5A 2YFAA 3DA3A 2F6MB 4OAUC 4YZDA 4AS2A 2V6EA 2K19A 4Z7HA 4AS3A 4PL3A 2L1LB 4G75A 4OAVB 4JCVE 3JSBA 3L0IA 4O1OA 3SDJA 3DO9A 3LJ1A 2JAEA 3I9V1 1W3SA 4NV2A 2RIOA 1U5KA 3LJ2A 2A2DA 4I1TA 2F66B 2JB3A 3P23A 4YZ9A 5LNK1 4PL5A 3VA9A 3LJ0A 3F4MA 2JB1A 3DA4A 2XTRA 2A2CA 4G76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K19 A;  2ZRR A;  2IP6 A; 
#chains in the Genus database with same CATH topology
 2E8G A;  2RAD A;  4GXT A;  2FU2 A;  3AJF A;  2IP6 A;  2JB2 A;  4Z7G A;  1JQO A;  3FBV A;  2YFB A;  2ETD A;  2BL7 A;  1YO7 A;  2QSB A;  4DWL A;  3FVV A;  4Q9V A;  3FNB A;  2V1C C;  2GSC A;  2P22 B;  4O1P A;  3IAS 1;  1TDP A;  3KP9 A;  2ZRR A;  2FUG 1;  2XTQ A;  4YZC A;  2XMX A;  2FEF A;  3IAM 1;  4HFV A;  2CAZ B;  4U6R A;  4HEA 1;  4PL4 A;  3Q8D A;  2KKM A;  2QGM A;  5HGI A;  3UIT A;  1SJ8 A;  2MJF B;  2HGK A;  4NV5 A;  2JBW A;  2YFA A;  3DA3 A;  2F6M B;  4OAU C;  4YZD A;  4AS2 A;  2V6E A;  2BL8 A;  2RLD A;  2K19 A;  4Z7H A;  4AS3 A;  4PL3 A;  2L1L B;  4G75 A;  4OAV B;  4JCV E;  3JSB A;  3L0I A;  4O1O A;  3SDJ A;  2QZG A;  3DO9 A;  3LJ1 A;  2JAE A;  3I9V 1;  3B55 A;  2ZW3 A;  1W3S A;  4NV2 A;  2RIO A;  1U5K A;  3LJ2 A;  2A2D A;  4I1T A;  2F66 B;  2JB3 A;  3P23 A;  4YZ9 A;  5LNK 1;  4PL5 A;  3VA9 A;  3LJ0 A;  3F4M A;  2JB1 A;  3DA4 A;  2XTR A;  2A2C A;  4G76 A; 
#chains in the Genus database with same CATH homology
 2E8G A;  4GXT A;  3AJF A;  2IP6 A;  2JB2 A;  4Z7G A;  3FBV A;  2YFB A;  1YO7 A;  4DWL A;  4Q9V A;  2V1C C;  2P22 B;  4O1P A;  3IAS 1;  3KP9 A;  2ZRR A;  2FUG 1;  2XTQ A;  4YZC A;  2XMX A;  3IAM 1;  4HFV A;  2CAZ B;  4U6R A;  4HEA 1;  4PL4 A;  3Q8D A;  2KKM A;  5HGI A;  3UIT A;  1SJ8 A;  2MJF B;  4NV5 A;  2YFA A;  3DA3 A;  2F6M B;  4OAU C;  4YZD A;  4AS2 A;  2V6E A;  2K19 A;  4Z7H A;  4AS3 A;  4PL3 A;  2L1L B;  4G75 A;  4OAV B;  4JCV E;  3JSB A;  3L0I A;  4O1O A;  3SDJ A;  3DO9 A;  3LJ1 A;  2JAE A;  3I9V 1;  1W3S A;  4NV2 A;  2RIO A;  1U5K A;  3LJ2 A;  2A2D A;  4I1T A;  2F66 B;  2JB3 A;  3P23 A;  4YZ9 A;  5LNK 1;  4PL5 A;  3VA9 A;  3LJ0 A;  3F4M A;  2JB1 A;  3DA4 A;  2XTR A;  2A2C A;  4G76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...