2K19A

Nmr solution structure of pisi
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
MGKLKWFSGGKERSNQAENIITDLLDDLKTDLDNESLKKVLENYLEELKQKSASVPLILSRMNLDISKAIRNDGVTLSDYQSKKLKELTSISNIRYGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance solution structure of PisI, a group B immunity protein that provides protection against the type IIa bacteriocin piscicolin 126, PisA.
pubmed doi rcsb
source organism Carnobacterium maltaromaticum
molecule tags Antimicrobial protein
molecule keywords Putative piscicolin 126 immunity protein
total genus 25
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08951 EntA_Immun Enterocin A Immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.140 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2k19A00
2K19A 2IP6A 2ZRRA
chains in the Genus database with same CATH superfamily
2QGMA 2A2CA 3FBVA 4PL3A 2HGKA 2BL7A 2FUG1 3LJ2A 3P23A 1TDPA 4G75A 2E8GA 4PL4A 4HFVA 2RIOA 2YFAA 4G76A 2JBWA 3DA4A 3FNBA 4Q9VA 3AJFA 4GXTA 3DO9A 4Z7GA 2FU2A 4OAUC 2P22B 2FEFA 3L0IA 4I1TA 4NV2A 2JB2A 2IP6A 2XTRA 2ETDA 4DWLA 2V6EA 2JB1A 2ZW3A 4NV5A 2BL8A 2YFBA 3VA9A 2GSCA 3KP9A 3DA3A 3SDJA 4YZ9A 4Z7HA 5HGIA 3IAS1 4AS3A 4YZCA 4O1OA 3I9V1 1W3SA 1YO7A 3B55A 2XMXA 3JSBA 2RADA 2A2DA 2CAZB 2F66B 3UITA 2KKMA 4HEA1 2QSBA 5LNK1 4U6RA 2ZRRA 4PL5A 2K19A 2V1CC 2RLDA 4AS2A 4OAVB 1JQOA 3FVVA 2JAEA 3LJ1A 4O1PA 1U5KA 2L1LB 3Q8DA 2XTQA 3IAM1 3LJ0A 2QZGA 4JCVE 4YZDA 2MJFB 1SJ8A 3F4MA 2JB3A 2F6MB
chains in the Genus database with same CATH topology
2K19A 2V1CC 4YZ9A 2P22B 4Z7HA 5HGIA 3IAS1 4AS2A 4OAVB 3L0IA 4AS3A 2A2CA 3FBVA 4PL3A 4I1TA 2JAEA 4YZCA 2FUG1 3LJ1A 3LJ2A 3I9V1 4O1OA 4O1PA 1U5KA 1W3SA 3P23A 4NV2A 1YO7A 2L1LB 2JB2A 2XMXA 2IP6A 2XTRA 3JSBA 3Q8DA 2XTQA 4G75A 2E8GA 4PL4A 4DWLA 4Z7GA 2A2DA 2CAZB 2F66B 3KP9A 3IAM1 3LJ0A 3UITA 4HFVA 2RIOA 2V6EA 2JB1A 2KKMA 2YFAA 4HEA1 4JCVE 4YZDA 4G76A 4NV5A 4Q9VA 2MJFB 3DA4A 5LNK1 2YFBA 1SJ8A 3AJFA 3F4MA 4GXTA 2ZRRA 3DA3A 4U6RA 3VA9A 2JB3A 3DO9A 4PL5A 4OAUC 2F6MB 3SDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K19 A;  2IP6 A;  2ZRR A; 
#chains in the Genus database with same CATH topology
 2QGM A;  2A2C A;  3FBV A;  4PL3 A;  2HGK A;  2BL7 A;  2FUG 1;  3LJ2 A;  3P23 A;  1TDP A;  4G75 A;  2E8G A;  4PL4 A;  4HFV A;  2RIO A;  2YFA A;  4G76 A;  2JBW A;  3DA4 A;  3FNB A;  4Q9V A;  3AJF A;  4GXT A;  3DO9 A;  4Z7G A;  2FU2 A;  4OAU C;  2P22 B;  2FEF A;  3L0I A;  4I1T A;  4NV2 A;  2JB2 A;  2IP6 A;  2XTR A;  2ETD A;  4DWL A;  2V6E A;  2JB1 A;  2ZW3 A;  4NV5 A;  2BL8 A;  2YFB A;  3VA9 A;  2GSC A;  3KP9 A;  3DA3 A;  3SDJ A;  4YZ9 A;  4Z7H A;  5HGI A;  3IAS 1;  4AS3 A;  4YZC A;  4O1O A;  3I9V 1;  1W3S A;  1YO7 A;  3B55 A;  2XMX A;  3JSB A;  2RAD A;  2A2D A;  2CAZ B;  2F66 B;  3UIT A;  2KKM A;  4HEA 1;  2QSB A;  5LNK 1;  4U6R A;  2ZRR A;  4PL5 A;  2K19 A;  2V1C C;  2RLD A;  4AS2 A;  4OAV B;  1JQO A;  3FVV A;  2JAE A;  3LJ1 A;  4O1P A;  1U5K A;  2L1L B;  3Q8D A;  2XTQ A;  3IAM 1;  3LJ0 A;  2QZG A;  4JCV E;  4YZD A;  2MJF B;  1SJ8 A;  3F4M A;  2JB3 A;  2F6M B; 
#chains in the Genus database with same CATH homology
 2K19 A;  2V1C C;  4YZ9 A;  2P22 B;  4Z7H A;  5HGI A;  3IAS 1;  4AS2 A;  4OAV B;  3L0I A;  4AS3 A;  2A2C A;  3FBV A;  4PL3 A;  4I1T A;  2JAE A;  4YZC A;  2FUG 1;  3LJ1 A;  3LJ2 A;  3I9V 1;  4O1O A;  4O1P A;  1U5K A;  1W3S A;  3P23 A;  4NV2 A;  1YO7 A;  2L1L B;  2JB2 A;  2XMX A;  2IP6 A;  2XTR A;  3JSB A;  3Q8D A;  2XTQ A;  4G75 A;  2E8G A;  4PL4 A;  4DWL A;  4Z7G A;  2A2D A;  2CAZ B;  2F66 B;  3KP9 A;  3IAM 1;  3LJ0 A;  3UIT A;  4HFV A;  2RIO A;  2V6E A;  2JB1 A;  2KKM A;  2YFA A;  4HEA 1;  4JCV E;  4YZD A;  4G76 A;  4NV5 A;  4Q9V A;  2MJF B;  3DA4 A;  5LNK 1;  2YFB A;  1SJ8 A;  3AJF A;  3F4M A;  4GXT A;  2ZRR A;  3DA3 A;  4U6R A;  3VA9 A;  2JB3 A;  3DO9 A;  4PL5 A;  4OAU C;  2F6M B;  3SDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...