4NV2A

C50a mutant of synechococcus vkor, c2221 crystal form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
264
Chain Sequence
RHSRLILAILAGLGSLLTAYLTYTKLTEQPAAFATGDGGCDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPDPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPLEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords VKORC1/thioredoxin domain protein
publication title Structures of an intramembrane vitamin K epoxide reductase homolog reveal control mechanisms for electron transfer.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 82
structure length 264
sequence length 266
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4nv2A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nv2A02
4PURA 3EU4A 1DBYA 3GHAA 1OVNA 3HHVA 4TR3A 2L5OA 1ABAA 1A8YA 5J41A 3D5JA 4E8HA 4HJMA 3QFBC 4N11A 4MABA 3UEMA 4L5OA 4Q5NA 3CMIA 1VF4A 1GSYA 5FWGA 2ZUPA 3E3EA 5KN3A 1VF1A 5AIXA 4YQVA 2V1MA 2AUVA 1J0FA 3HJPA 3KXOA 1TRUA 3UVTA 3BCIA 1DE1A 3TRQA 3GX8A 3E9JB 4YAVA 4I6XA 4AJ6A 4F9ZA 3ZZXA 1KNGA 7GSSA 1JZDA 3UIWA 1NHYA 2HYXA 5ELGA 3PGTA 2FWHA 1GUKA 5ECRB 4GSSA 2HZFA 1EP7A 5AN1A 3IAS2 2L5LA 4MJCA 4KCEA 3IXRA 3TB2A 1V57A 4K6XA 4HQSA 3IAM2 4GCIA 2V6KA 2A2SA 2H6XA 3DKSA 4EDZA 5B6NA 4FH8A 2K9FA 1RQMA 2IWTA 4K7NA 4BWQA 3J7Yk 5DJLA 1XWAA 1U87A 4MPFA 3G7YA 1MD3A 3L4NA 4XS1A 5GSSA 1FOVA 4MZBA 2WDUA 3EE2A 3HCZA 4WEYA 2HRNA 4K8MA 3DIEA 2X8CA 4OCEA 2JADA 4PUAA 2C4JA 1GTAA 2J9HA 3M9KA 3NIVA 3JCML 1MDJA 3LORA 4TXOA 2G0FA 1YKAA 1SENA 1X9SB 1UC7A 3IHQA 2LRTA 3LJRA 1QUWA 1K0DA 2H0GA 3CSHA 3ZIJA 2LSTA 4KDXA 3ZVJA 1TRVA 2JZTA 5AISA 1TKDB 3I9V2 3L9VA 5ECSA 3BD2A 1F3BA 3O3TA 3FK8A 4OD7A 2IPAA 4F82A 4F03A 12GSA 2PVOC 1NHOA 3PR8A 2O87A 2B6MA 4OWYA 5G2ZA 5J9BA 1PQNA 3UL3A 4EVMA 3TKSA 1Z7PA 1GRXA 3TDGA 1Z7RA 2C3TA 4AGSA 4IVFA 3DVWA 2QKEA 4ECBA 4G9HA 1GSFA 1WOUA 2R2JA 4PX1A 1Z6MA 1XVWA 4GQCA 3QOUA 4KSMA 3GV1A 3TKSE 1TJDA 2PBJA 4MA9A 4RI6A 4TN8A 1Z5YE 1SKWB 3FKFA 2HNLA 1TOFA 2WULA 4FYUA 5EVOA 1MTCA 2DJ2A 2OKAA 1GH2A 4DVCA 3CTFA 1PKWA 2MMNA 2RUEA 1EWXA 4N0VA 1J9BA 1CQGA 3KD0A 3QD9A 3KH7A 3TGZA 4MF6A 3VI7A 1JZRA 1O8XA 2BMXA 2FWFA 2LRNA 1Z9HA 4N30A 5LCZA 5CRGA 1XIYA 3UJ1A 1R5AA 2JACA 3G7JA 3RAZA 5J5NA 2NDOA 2DJ3A 5D8IA 4KH7A 3EWLA 1O7UA 5DJMA 3CTGA 5J9CA 2IMDA 5DBQA 2MBTA 1XW6A 1B4QA 4ACSA 3HVSA 3LG6A 3P2AA 3VK9A 2JU5A 2K8VA 5DVBA 1GSUA 4O5RA 1YEXA 4PNGA 4EF0A 4TR1B 1T7PB 3HD5A 4IQAA 4HQZA 4IP6A 1JLVA 3HXSA 4PXOA 2DJJA 3GA4A 4QL9A 1S3AA 8GSSA 2D2ZA 5ECIB 3H4KA 1GUMA 1PSQA 1ILOA 2DMMA 3Q74A 3D0ZA 2TRXA 3CBUA 1EV4A 2AV4A 1V9WA 4ZB6A 2XHFA 1LJRA 2DJ1A 1HNCA 1GNEA 2BTOT 3Q6OA 2C0EA 2VOCA 1PX7A 2H8LA 4Z7XA 3MDKA 4GTUA 1HQOA 2E7PA 1T00A 1JZOA 3EU3A 2FGXA 1Z6NA 4HJ2A 1EEMA 4MF7A 2J23A 4XTSA 3F3QA 1K3YA 1GTBA 1A2LA 1O73A 2XBQA 1QQ2A 3ZYWA 5CP1A 2F8FA 4IW9A 2H1DA 2H1BA 5IMDA 1F6MC 2RM5A 3FZ9A 4PQHA 2H72A 1TRSA 3NZNA 4XS4B 3GFKA 5IMCA 1O8WA 4MJBA 4MK3A 5IPGA 3FZAA 2V32A 3RPNA 1SJZA 1TTZA 3EURA 2GQMA 1NSWA 3MAKA 2YV7A 1U3IA 3C1SA 2TRCP 1B48A 5ECHB 3QFAC 1OKTA 1U88A 3N5OA 4HEA2 1XXUA 1BX9A 3FY7A 3VPTA 3QAGA 2OBIA 1A23A 2EC4A 1YEPA 2WZ9A 2IMKA 1IYHA 3GKMA 4CHSA 1JHBA 1SL2B 3GN3A 1A0RP 4AJ7A 1WMJA 1ERWA 1GL8A 4YQMA 1WIKA 1GP1A 3H79A 1ZMAA 6GSUA 3F6FA 1XPVA 5G1KA 3KMNA 3U5RE 3FR6A 3LXZA 1JLWA 1SYXA 3W8SA 2B5EA 4FO5A 4ZBBA 4LLRA 5D9XA 1PX6A 2PPTA 2HLSA 3G9BA 3CRUA 1F2EA 3EMPA 1K3OA 1PRXA 19GSA 2I1UA 3D4MA 5HFKA 3I69A 3AY8A 1HNAA 4V2MA 4PGTA 2OE3A 5HR3A 3M9JA 2FWEA 2B3SA 4HDEA 3VWWA 1G7EA 5A4VA 5B7CA 1TK5B 3W8JA 1FB0A 1XWBA 5D93A 3A3TA 5J3RA 2A4VA 2FUG2 2KP2A 2GT5A 4L5LA 1F9MA 2N5BA 1YY7A 1UA5A 1R26A 5EY6A 9GSSA 1SL0B 3TJGA 1DE2A 2CV4A 2VO4A 2ALBA 2DLXA 2R6KA 5L71A 3C8EA 1A0FA 5H5QA 3VPQA 3I6AA 2CZ3A 1MEKA 1G7OA 2HFDA 4YAPA 2P0GA 4TRXA 1YJ6A 4BA7A 3GMFA 3HDCA 3D6IA 1ML6A 4OFNA 1V2AA 5G5EA 5C04A 5HQPA 5CRWA 1I9DA 1B8XA 3IA1A 4HI7A 3US3A 4TW5A 2VM2A 1THXA 4IELA 3F6DA 1V98A 3VLNA 3ZTLA 2CA8A 2GSTA 2H66A 22GSA 2KLXA 1M99A 4XCSA 4NV5A 3RBTA 2DJ0A 20GSA 3CSJA 3GURA 3HY2A 5E4WA 6GSXA 3UBKA 3HKRA 5ECQB 3RPPA 3DGQA 2WS2A 4G10A 2MMZA 5HFGA 2FA4A 4TR1A 4ZB8A 3EYTA 4POKA 5G5FA 5B8BA 2QC7A 3TUEA 2AJQB 2IMFA 5KN0A 2IL3A 1VGLA 5E59A 1TU7A 2VCZA 1ZYEA 1TK8B 4JRRA 2XPDA 2GSRA 2V2GA 3CXGA 5ECPB 2H01A 1N8JA 4WXTA 3LWAA 4BPYA 2YZHA 3F4TA 4NMUA 2H30A 4YH2A 2X8HA 1AQWA 1I5GA 3TRPA 2R5GA 2BJXA 1UN2A 1GTIA 4F2IA 3ZFLA 4OO4A 2OA7A 3GYKA 3DVXA 2VLTA 3LQ7A 4LL1B 2F8AA 1GLQA 1GTUA 1M2BA 1GLPA 4X43A 3IK7A 1G6YA 2YNXA 4GXZA 1AIUA 4KNDA 1MDKA 1QMVA 5CRDA 2FLSA 4MF5A 2H74A 3KZQA 3FYGA 3KIJA 3ZMLA 1EP8A 4I97A 3F9UA 4K0NA 1GSQA 3HZ4A 1K0NA 1QXHA 4O92A 5JWOB 3BBYA 3VWVA 4FIWA 4NWYA 4IJ3A 2I4AA 4Q5RA 3FEUA 4EXJA 2H1GA 1K3LA 1B9YC 2C3NA 1DSBA 4XS4A 2KUCA 3UVHA 2NPBA 2VM1A 2O85A 5G1LA 1NW2A 4ZBAA 5CNWA 2H76A 2E0QA 2R4VA 4KGIA 5IMAA 3R2QA 1WE0A 5IQYA 3IDVA 1GNWA 4G19A 4RI7A 4KA0A 2RM6A 1G0TA 1YKCA 3CSIA 2MMOA 2OJLA 4JU5A 2FA8A 1ON4A 2GSSA 3GX0A 4MJAA 4IHUA 2FD3A 1RK4A 1BAYA 1WWJA 4NPBA 3LGCA 1XW9A 3KP9A 1SD9A 3ZRDA 5GSTA 1FHEA 3RHCA 3ZREA 4HUAA 4Q5FA 4MCUA 4WF4A 2L4QA 5IPHA 2YJHA 1VRSD 2H19A 3UMAA 4PNFA 3GUSA 4J2FA 5IM9A 1VF2A 3F8UA 2GQKA 1YDKA 1TI1A 2CX4A 4IS0A 3Q18A 5B8AA 3FZ4A 5GAND 3ZIVA 2XC2A 4HZ2A 4ECJA 4KDUA 2E2GA 2DIZA 5GAPD 3MNGA 1ACVA 5KN2A 3UARA 3GRXA 4JE1A 1SK0A 5CAXA 3GTUB 4Q5QA 4LMVA 3WYWA 1Q4JA 2LRCA 4XS6A 2GZYA 1TDIA 3NOFA 2JZSA 3RHBA 14GSA 3WGEA 4POBA 5AIVA 2O7KA 3KM6A 1XOAA 2CVKA 2MMAA 2N5AA 5COHA 4KAEA 4ZIJA 2PWJA 3LXTA 4GSNA 2GZZA 3GKXA 1A24A 2JSYA 4DSQA 16GSA 3ERFA 3ERGA 1E2YA 2RIIA 2F3MA 3SWLA 4IP1A 4TR4A 2B5YA 1Q98A 1X5EA 2RLIA 3ZFBA 2A2RA 2H1AA 2TIRA 4WF5A 4J57E 1H75A 3IC4A 1URMA 2HXKA 5ECMB 3PINA 4WKWA 1XBSA 3F4SA 1LU4A 3A5WA 4WR4A 2H6ZA 5D96A 5F07A 4ULXA 2GTUA 4NV2A 4TXVA 3VURA 4MH3A 2P5RA 4N10A 2MYGA 5DQSA 1QFNA 5IO0A 4NAXA 3VWUA 1SL1B 3M8NA 4K7OA 2VD0A 1XWGA 3ZITA 2YZUA 1UVZA 2M46A 4I2TA 4IJIA 4X0XA 2H0HA 4K7IA 2KOKA 1O81A 4P3YB 4BVYA 5ABRA 3IR4A 1HNBA 2YOIA 3PH9A 2Z9SA 1WRYA 3QAWA 3H8QA 2I9HA 3TJBA 3ZLPA 2CAIA 3F3RA 2DC5A 3GSTA 3GNJA 3TRXA 1BJXA 2H6YA 2VL9A 1SD8A 2VLUA 2DJKA 4GRFA 2LNTA 2CZ2A 1OC8A 5ECNB 1EOGA 3LFLA 2C8UA 1X9MB 1W89A 2VAFA 4WBJA 2O8VB 2C3QA 6GSWA 2CVDA 1T4YA 2YWOA 2PUKC 1WP0A 1GWCA 4IN0A 4MH2A 2QSIA 2HZEA 2V6OA 3DEXA 3DD3A 2C0GA 3FRCA 3APQA 1JZWA 5H5SA 4K1FA 2C1YA 4KX4A 2LV3A 2OE0A 3KH9A 1X0RA 1OE8A 2GSQA 3GH9A 5G30A 3WGDA 1YF0A 4ZILA 2M72A 1FVJA 4GWRA 6GSTA 4OMVA 1AAZA 1TRWA 3GL3A 5GZZB 3HVVA 5FHIA 1YF1A 4CDOA 3DRNA 1AXDA 2FHEA 3F63A 2QGVA 3V1WA 2EIQA 5DALB 2VCQA 3GL5A 2HE3A 2LQQA 2P31A 2X64A 2NBSA 1SK1A 1TU8A 4V2NA 3P8WA 2PMTA 2VCVA 4POLA 2I3YA 18GSA 4ZL9A 2AHEA 4I8BA 1GSSA 2R37A 1ERVA 2YJ7A 4ZB9A 2ON7A 2GZPA 3DXBA 5KEJA 2MBSA 2VCTA 2C0DA 2NVLA 3OR5A 2OADA 4AF2A 1M9BA 3HA9A 3APSA 4POMA 2PN8A 2GS3A 2H73A 3LEFA 1KEBA 1V40A 2HT9A 1SJIA 1YZXA 3IBHA 2F9SA 2DSAA 5D73A 2IFQB 5CREA 3P7XA 2YWNA 3HZ8A 4MJEA 4NHZA 3IE3A 1TI3A 4TR0A 3HYPA 2DMLA 1KBNA 1OC9B 2NTOA 1E6BA 4XRDA 2B7JA 4WETA 1CQHA 2YWMA 1OE7A 1XCCA 2DIYA 2HI7A 2YP6A 2ZCTA 4HS1A 5H5RA 2B7KA 1EOHA 3TKSC 2FNOA 4G2EA 1Y25A 2L4CA 5ENUA 2L6DA 4MZCA 3L9SA 1OYJA 2R3XA 4MP4A 1RW1A 4OFMA 3D21A 4EO3A 1W4VA 2I81A 1SYRA 1T4ZA 3KP8A 2WB9A 3IV4A 4N0ZA 3GTUA 3TKPA 2O89A 1NM3A 2GDRA 3FZ5A 4ECIA 2GVPA 2OACA 2EIRA 1B9XC 1TW9A 3LYKA 4F0CA 1R7HA 2OE1A 5D9WA 3QMXA 4ML1A 3N9JA 5A4WA 3FW2A 4MPGA 5DAKB 4CW9A 3DYRA 4GQFA 2GLRA 3ERWA 5JWQB 4WR5A 1PD21 4V2LA 1FG4A 5JCUA 3KMOA 1ZYQB 3L0HA 4K2DA 1PL1A 2YPMA 5HR0A 2VD1A 4ISDA 2AB6A 3A2VA 2H0IA 4IKHA 4J56E 2L59A 2FCHA 3U6VA 1SKSB 4HU7A 4K9ZA 4MDCA 2C0FA 4TVEA 2B1LA 2HZEB 4FYCA 1K0MA 1USBA 3VFIA 1T3BA 3TOUA 5IO2A 2H70A 1QGVA 3D22A 1THOA 4RQXA 1ZZYA 1DUGA 2CVBA 4F0BA 4ZXGA 13GSA 4GSTA 3P90A 17GSA 2VUPA 1SJ6A 3KGKA 2WCIA 1MDIA 4LA1A 1F37A 3FR3A 3MSZA 5ECOB 2PVQA 1Z3EA 1U6TA 5D9VA 1S3DA 3DWVA 1PL2A 3IOSA 2F51A 1T1VA 1AUCA 3H93A 3IPZA 4KUNA 5CRHA 1XZOA 4EUYA 4EC0A 5ID2B 2IJYA 1X9WB 5D9TA 4MLYA 3WGXA 2HRFA 1GULA 4JR6A 2FY6A 4BVXA 2N5FA 4L0WA 4XIHA 4X1UA 4TKYA 4DSSB 3HJOA 4ZBDA 1A8LA 2LKUA 2HSHA 4L8EA 1R4WA 5JCGA 1G6WA 3KCMA 4L0UA 2LS5A 2HSYA 1EGOA 4BWSA 5AGYA 3IK9A 1JFUA 1M2DA 5A4UA 4OO5A 1J08A 1OAZA 3L78A 4V1Ag 4EL1A 3J7Yb 1AQVA 2AAWA 5LNKe 3WT2A 3BJ5A 2VCWA 4BL7A 3TJKA 2M80A 4KCAA 5HFIA 1PMTA 2JL4A 5ELAA 2WRTA 4H86A 5JWRB 1BQ7A 1ZCPA 4ILFA 2CAQA 1O85A 4JBBA 5IOXA 4I5QA 3EVIA 4KE3A 3A2XA 1XVQA 5DALA 1M7TA 2ZNMA 4PQ1A 4I2UA 3RDWA 3A2WA 4YQUA 3HJMA 1BYEA 2K8SA 1ZGNA 1KTEA 5J4UA 2X99A 3KEBA 3WT1A 1H4OA 3L9UA 3S9FA 5FT3A 1ERTA 3QAVA 3E0UA 2ON5A 2IIYA 2WGRA 2C80A 1FVKA 1XWCA 2B5XA 4IBPA 1N2AA 3ME7A 5INYA 4XHMA 4IQ1A 2P5QA 5G31A 2CT6A 2PU9C 2FWGA 2REMA 1M9AA 4JEDA 3UAPA 1K0AA 3MWHA 2IMEA 4WBRD 3HVXA 1BG5A 3CRTA 2CX3A 4OCFA 3C73A 4ML6A 2VCXA 2RUFA 5HR2A 1EZKA 1K0CA 4RQRA 3VI5A 2MZCA 2IFQA 4MZWA 2KP1A 2H75A 4DSRA 1O6JA 3VWXA 1SK2A 4OFTA 2LJAA 1OC9A 1M0UA 3GKNA 4EKZA 4QQ7A 1ZL9A 1T8EB 5IOWA 4D73A 2E2MA 1ZOFA 2LNSA 3EC3A 5EL8A 4ECCA 2XPEA 4PQIA 2LQOA 2H71A 1V58A 1AW9A 3EINA 3KTBA 1BEDA 5EPFA 2LTKA 1IYIA 5A5KA 1HD2A 4TOPA 1TK0B 1X5DA 1FAAA 4EDYA 4KDYA 5F06A 1FB6A 2VL2C 2X8GA 3ME8A 4LMWA 4MMMA 3I43A 6GSYA 2GQLA 3O6TA 3EMXA 4EE0A 2EIOA 3M0FA 2L57A 3QDNA 5DQYA 3FHKA 5DAKA 3C71A 2VLVA 3C7MA 1EGRA 1TXXA 4NHWA 1HYUA 4JR4A 1XWKA 2WJUA 3ZL5A 3TKRA 1SKRB 3M1GA 4QL7A 2LJKA 5DCGA 1MD4A 3DMLA 2G2QA 1AC1A 1U3AA 3GSSA 2ES7A 1XFLA 2AYTA 2VL3A 1S3CA 2YV9A 5LD0A 11GSA 1ST9A 3BOAA 1QK8A 2LEGA 1XW5A 2GT6A 3ZVJD 4TXOB 1PGTA 3M3MA 2GGTA 3K8NA 3G7IA 2YWIA 1M2AA 1VF3A 3LYPA 2VIMA 4IGJA 5F05A 4ID0A 2K6VA 1K0BA 1WJKA 1XOBA 4O32A 1A2JA 3FR9A 4ZL7A 4GLTA 5F8BA 3D4TA 3TCOA 2IMIA 6GSVA 4K0GA 3ZMKA 1PA3A 3C1RA 3GH6A 5CYYA 5ECKB 4NXIA 5F0GA 1F3AA 4LL4B 3CYNA 1WPIA 4RUVA 2WFCA 3APOA 2K18A 5ID2A 2PERA 2L6CA 5DCHA 2YANA 10GSA 1PN9A 2XBIA 1FO5A 2OBKA 5C00A 4DSSA 4HOJA 5IIZA 2IN3A 3KJYA 4E8EA 1OC3A 3GKKA 2B1KA 4HU9A 3Q19A 3GIXA 1A2MA 1GSDA 4DEJA 3TJFA 4KB3A 6GSSA 4KSOA 3TJJA 4JZQA 4ZL8A 1YQ1A 1GUHA 1Y6EA 2PGTA 5B6MA 5ECLB 4V1Ap 2YCDA 5JCWA 5IMFA 3QCPA 3TOTA 3ISOA 2LJRA 4FYBA 4AJ8A 5CO3A 2V41A 3IRAA 3W6GA 4HZ4A 1X5CA 1EEJA 3UOMA 1PKZA 1SU9A 3F0IA 1ERUA 4D73B 3KTLA 1R5PA 1FW1A 3F4RA 1K0OA 2KHPA 5IMZA 4KW6A 2VL2A 4O7HA 1AQXA 2CQ9A 3WD6A 1B4PA 1C72A 1EV9A 3O76A 3LSZA 5DDLA 1GSEA 1TP9A 5IMVA 1LBKA 4XRAA 5HR1A 1OKDA 3BCKA 3TKQA 4GF0A 3QR6A 2YN1A 5KN1A 4PUFC 2DBCA 3QPMA 3SBCA 2JSZA 3UBLA 2JZRA 3ED3A 2LUSA 3H1NA
chains in the Genus database with same CATH superfamily
4PURA 3EU4A 1DBYA 3GHAA 1OVNA 3HHVA 4BIKA 4TR3A 2L5OA 1ABAA 1A8YA 5J41A 3D5JA 4E8HA 4HJMA 3QFBC 4N11A 4MABA 3UEMA 4L5OA 4Q5NA 3CMIA 1VF4A 1GSYA 5FWGA 2ZUPA 4HFVA 3E3EA 5KN3A 1VF1A 5AIXA 4YQVA 2V1MA 2AUVA 1J0FA 3HJPA 2X4AA 1TRUA 3KXOA 3UVTA 3BCIA 1DE1A 3TRQA 3GX8A 3E9JB 4YAVA 4I6XA 4AJ6A 4F9ZA 3ZZXA 1KNGA 7GSSA 1JZDA 3UIWA 1NHYA 2HYXA 5ELGA 3PGTA 2FWHA 1GUKA 5ECRB 4GSSA 2HZFA 4G0IA 1EP7A 2R0GA 5AN1A 2E8GA 3IAS2 2L5LA 4MJCA 4KCEA 3IXRA 3TB2A 1V57A 4K6XA 4HQSA 3IAM2 4GCIA 2V6KA 2A2SA 2H6XA 3DKSA 4EDZA 5B6NA 4FH8A 2K9FA 1RQMA 2IWTA 4K7NA 4BWQA 3DO9A 3J7Yk 5DJLA 1XWAA 1U87A 4MPFA 3G7YA 1MD3A 3L4NA 4XS1A 5GSSA 1FOVA 4MZBA 2WDUA 3EE2A 4PL5A 3HCZA 4WEYA 2ZW3A 2HRNA 4K8MA 3DIEA 2X8CA 4OCEA 2JADA 4PUAA 2C4JA 1GTAA 2J9HA 3M9KA 3NIVA 3JCML 1MDJA 3LORA 4TXOA 2G0FA 1YKAA 1SENA 1X9SB 1UC7A 3IHQA 2LRTA 3LJRA 1QUWA 1K0DA 3HVNA 2H0GA 3CSHA 3ZIJA 2LSTA 2HGKA 4KDXA 3ZVJA 1TRVA 2JZTA 5AISA 1TKDB 3I9V2 3L9VA 5ECSA 3BD2A 1F3BA 3O3TA 3FK8A 4OD7A 2IPAA 4F82A 4F03A 12GSA 2PVOC 1NHOA 2A2DA 3PR8A 2O87A 2B6MA 4OWYA 5G2ZA 5J9BA 3R3EA 1PQNA 3UL3A 4EVMA 3TKSA 1Z7PA 1GRXA 3TDGA 1Z7RA 2C3TA 4AGSA 4IVFA 3DVWA 4K2XA 2QKEA 4ECBA 4G9HA 1GSFA 1WOUA 2R2JA 4PX1A 1Z6MA 1XVWA 2XTRA 4GQCA 3QOUA 2V1CC 4KSMA 3GV1A 3TKSE 1TJDA 2PBJA 4MA9A 4RI6A 4TN8A 1Z5YE 1SKWB 3FKFA 2HNLA 1TOFA 2WULA 4FYUA 5EVOA 1MTCA 2DJ2A 2OKAA 1GH2A 4DVCA 3CTFA 1PKWA 2MMNA 2RUEA 4Z2RA 1EWXA 4N0VA 1J9BA 1CQGA 3KD0A 3QD9A 3KH7A 3TGZA 4MF6A 3VI7A 1JZRA 1O8XA 2BMXA 2FWFA 2LRNA 1Z9HA 4G0KA 4N30A 5LCZA 5CRGA 1XIYA 1SJ8A 2P22B 3UJ1A 1R5AA 2JACA 3G7JA 3RAZA 5J5NA 2NDOA 2DJ3A 5D8IA 4KH7A 3EWLA 1O7UA 5DJMA 3CTGA 5J9CA 2IMDA 5DBQA 2MBTA 1XW6A 1B4QA 4ACSA 3HVSA 3LG6A 3P2AA 3VK9A 2HSMA 2JU5A 2K8VA 1GSUA 5DVBA 4O5RA 1YEXA 4PNGA 4EF0A 4TR1B 1T7PB 3HD5A 4IQAA 4HQZA 4IP6A 1JLVA 3HXSA 4PXOA 2BL7A 2DJJA 3GA4A 4QL9A 1S3AA 8GSSA 2D2ZA 5ECIB 3H4KA 1GUMA 4MNNA 1PSQA 1ILOA 2DMMA 3Q74A 3SDJA 3D0ZA 2TRXA 3CBUA 1EV4A 2AV4A 1V9WA 4ZB6A 2XHFA 1LJRA 2DJ1A 1HNCA 1GNEA 2BTOT 3Q6OA 2C0EA 2VOCA 1PX7A 2H8LA 4Z7XA 3MDKA 4GTUA 1HQOA 2E7PA 1T00A 1JZOA 3EU3A 2FGXA 1Z6NA 4HJ2A 1EEMA 4AS3A 2F6MB 4MF7A 2J23A 4XTSA 3F3QA 1K3YA 1GTBA 1A2LA 1O73A 2XBQA 1QQ2A 3ZYWA 5CP1A 2F8FA 4IW9A 2H1DA 3B55A 2H1BA 4EIPA 5IMDA 3P23A 1F6MC 2RM5A 3FZ9A 4PQHA 2H72A 1TRSA 3NZNA 4XS4B 3GFKA 5IMCA 1O8WA 4MJBA 4ICYA 4MK3A 5IPGA 2HRAA 3FZAA 2V32A 3RPNA 1SJZA 1TTZA 3EURA 2GQMA 1NSWA 3MAKA 2YV7A 2X49A 1U3IA 3C1SA 2TRCP 1B48A 5ECHB 3QFAC 1OKTA 4OAUC 1U88A 3N5OA 4HEA2 1XXUA 1BX9A 5KOWA 3FY7A 3VPTA 3QAGA 2MJFB 2OBIA 1A23A 4DWLA 2EC4A 1YEPA 2WZ9A 2IMKA 1IYHA 3GKMA 4CHSA 4G76A 1JHBA 1SL2B 3GN3A 1A0RP 4AJ7A 1WMJA 1ERWA 1GL8A 4YQMA 1WIKA 1GP1A 3H79A 1ZMAA 6GSUA 3F6FA 1XPVA 5G1KA 3KMNA 3U5RE 3FR6A 3LXZA 1JLWA 2K19A 1SYXA 3W8SA 2B5EA 4O5UA 4FO5A 4ZBBA 4HSCX 4LLRA 5D9XA 1PX6A 2PPTA 2HLSA 3G9BA 3CRUA 1F2EA 3EMPA 1K3OA 1PRXA 19GSA 2I1UA 3D4MA 5HFKA 3I69A 3AY8A 1HNAA 4V2MA 4PGTA 2OE3A 5HR3A 3M9JA 2FWEA 2B3SA 4HDEA 3VWWA 1G7EA 5A4VA 5B7CA 1TK5B 3W8JA 2GSCA 1FB0A 1XWBA 5D93A 3A3TA 5J3RA 2A4VA 2FUG2 2KP2A 2GT5A 4L5LA 1F9MA 2N5BA 1YY7A 1UA5A 1R26A 3PPUA 5EY6A 9GSSA 1SL0B 3TJGA 1DE2A 2CV4A 2VO4A 2ALBA 2DLXA 2R6KA 5L71A 3C8EA 1A0FA 2DKIA 5H5QA 3I6AA 3VPQA 2CZ3A 1MEKA 1G7OA 2HFDA 4YAPA 2P0GA 4TRXA 1YJ6A 4BA7A 3GMFA 3FNBA 3HDCA 2XTQA 3D6IA 1ML6A 4OFNA 1V2AA 5G5EA 5C04A 5HQPA 5CRWA 1I9DA 1B8XA 3IA1A 4HI7A 3US3A 4TW5A 2VM2A 1THXA 4IELA 3F6DA 4BVYB 2R0PA 1V98A 3VLNA 3ZTLA 2CA8A 2GSTA 2H66A 22GSA 2KLXA 1M99A 4XCSA 4NV5A 3RBTA 2DJ0A 20GSA 3CSJA 3GURA 3HY2A 5E4WA 6GSXA 3UBKA 3HKRA 5ECQB 3RPPA 3DGQA 2WS2A 4G10A 3EPTA 2MMZA 3UITA 5HFGA 2FA4A 4TR1A 4ZB8A 3EYTA 4POKA 5G5FA 5B8BA 2QC7A 3TUEA 2AJQB 2IMFA 5KN0A 2IL3A 1VGLA 5E59A 1TU7A 2VCZA 1ZYEA 1TK8B 3DA3A 4G75A 4JRRA 2XPDA 4CY8A 2GSRA 2V2GA 3CXGA 5ECPB 2ZRRA 2H01A 1N8JA 4WXTA 3LWAA 4BPYA 2YZHA 3F4TA 4NMUA 2IP6A 2H30A 4YH2A 2X8HA 1AQWA 1I5GA 3AJFA 3TRPA 2R5GA 2BJXA 1UN2A 1GTIA 4F2IA 3ZFLA 4OO4A 4Q9VA 2OA7A 3GYKA 3DVXA 2VLTA 3LQ7A 4LL1B 2F8AA 1GLQA 1GTUA 1M2BA 1GLPA 4X43A 3IK7A 1G6YA 2YNXA 4GXZA 4K5SA 1AIUA 4KNDA 1MDKA 1QMVA 5CRDA 2FLSA 4MF5A 2H74A 3KZQA 3FYGA 3KIJA 3ZMLA 1EP8A 1PN0A 4I97A 3F9UA 4K0NA 1GSQA 3HZ4A 1U5KA 1K0NA 1QXHA 4O92A 5JWOB 3BBYA 3VWVA 4FIWA 4NWYA 4IJ3A 2I4AA 3FVVA 4X4JA 4Q5RA 3FEUA 4EXJA 2H1GA 1K3LA 1B9YC 2C3NA 1DSBA 4XS4A 2KUCA 3UVHA 2NPBA 2VM1A 2O85A 5G1LA 1NW2A 4ZBAA 5CNWA 2H76A 2E0QA 2R4VA 4KGIA 5IMAA 3R2QA 1WE0A 5IQYA 3IDVA 1GNWA 4G19A 3A5IA 4RI7A 4KA0A 2RM6A 1G0TA 1YKCA 3CSIA 2MMOA 2OJLA 4JU5A 2FA8A 1ON4A 2GSSA 4PL4A 3GX0A 2KKMA 4MJAA 4JCVE 4IHUA 1XG8A 2FD3A 1RK4A 1BAYA 1WWJA 4NPBA 3LGCA 1XW9A 3KP9A 1SD9A 3ZRDA 5GSTA 1FHEA 3RHCA 3ZREA 4HUAA 4Q5FA 4MCUA 4WF4A 2L4QA 5IPHA 3CQFA 2YJHA 3FBVA 1VRSD 2H19A 3UMAA 4PNFA 3GUSA 4J2FA 5IM9A 1VF2A 3F8UA 2GQKA 1YDKA 1TI1A 2CX4A 4IS0A 3Q18A 5B8AA 3FZ4A 5GAND 2BL8A 3ZIVA 2RIOA 2XC2A 4HZ2A 4ECJA 3IAS1 4KDUA 2E2GA 3DA4A 2DIZA 5GAPD 2QZGA 3MNGA 1ACVA 5KN2A 3UARA 3IAM1 2JB1A 1M3IA 3GRXA 4JE1A 1SK0A 4A5PA 2JB2A 5CAXA 3GTUB 4Q5QA 4LMVA 3WYWA 1Q4JA 2LRCA 4XS6A 2GZYA 1TDIA 3NOFA 2JZSA 3RHBA 14GSA 3WGEA 4POBA 5AIVA 2O7KA 3KM6A 1XOAA 2CVKA 2MMAA 2N5AA 5COHA 4KAEA 4ZIJA 2PWJA 3LXTA 4GSNA 2GZZA 3GKXA 1A24A 2JSYA 4DSQA 16GSA 3ERFA 3ERGA 1E2YA 2RIIA 2F3MA 3SWLA 4IP1A 4TR4A 2B5YA 1Q98A 4I1TA 1X5EA 2RADA 2RLIA 3ZFBA 2A2RA 2H1AA 2TIRA 4WF5A 4U6RA 4J57E 1H75A 3IC4A 1URMA 2HXKA 5ECMB 3PINA 4WKWA 1XBSA 3F4SA 1LU4A 3A5WA 4WR4A 2H6ZA 5D96A 5F07A 3I9V1 4ULXA 2GTUA 4NV2A 4TXVA 3VURA 4MH3A 2P5RA 4N10A 2MYGA 5DQSA 1QFNA 5IO0A 4NAXA 3VWUA 1SL1B 3M8NA 4K7OA 2VD0A 1XWGA 3ZITA 2YZUA 1UVZA 2M46A 4I2TA 4IJIA 4X0XA 2H0HA 4K7IA 2KOKA 1O81A 4P3YB 4BVYA 5ABRA 3IR4A 1HNBA 2YOIA 3PH9A 2Z9SA 1WRYA 1S3RA 3QAWA 3H8QA 3L0IA 2I9HA 3TJBA 3ZLPA 2CAIA 3F3RA 2DC5A 3GSTA 3GNJA 3TRXA 3LJ0A 1BJXA 2H6YA 2VL9A 1SD8A 2VLUA 2DJKA 4GRFA 2LNTA 4BVXB 2CZ2A 1OC8A 5ECNB 1EOGA 5LNK1 3LFLA 2C8UA 1X9MB 1W89A 2VAFA 4WBJA 2O8VB 2C3QA 2FEFA 6GSWA 3JSBA 2CVDA 1T4YA 2YWOA 2PUKC 1WP0A 1GWCA 4IN0A 4MH2A 2QSIA 2HZEA 2V6OA 3DEXA 3IC8A 3DD3A 2C0GA 3FRCA 3APQA 1JZWA 5H5SA 4K1FA 2C1YA 4KX4A 2LV3A 2OE0A 3KH9A 1X0RA 1OE8A 2GSQA 3GH9A 4BL7B 5G30A 3WGDA 1YF0A 4ZILA 3F4MA 2M72A 1FVJA 4GWRA 6GSTA 4OMVA 2A2CA 1AAZA 1TRWA 3GL3A 5GZZB 3HVVA 5FHIA 1YF1A 4CDOA 3DRNA 1AXDA 2FHEA 3F63A 2QGVA 3V1WA 2EIQA 5DALB 2VCQA 3GL5A 2HE3A 2LQQA 2P31A 2X64A 2NBSA 1SK1A 1TU8A 4V2NA 3P8WA 2PMTA 2VCVA 4POLA 2I3YA 18GSA 4ZL9A 2AHEA 4I8BA 1GSSA 4OAVB 2UZ8A 2R37A 1ERVA 2YJ7A 4ZB9A 2ON7A 2GZPA 3DXBA 5KEJA 2MBSA 2VCTA 2C0DA 2NVLA 3OR5A 2OADA 4AF2A 1M9BA 3HA9A 3APSA 4POMA 2PN8A 2GS3A 4Z2TA 3MYDA 2H73A 3LEFA 1KEBA 1V40A 2HT9A 1SJIA 4G0LA 1YZXA 3IBHA 2F9SA 2FU2A 2DSAA 5D73A 2IFQB 5CREA 3P7XA 2YWNA 3HZ8A 4MJEA 4NHZA 3IE3A 1TI3A 4TR0A 3HYPA 2DMLA 1KBNA 1OC9B 2NTOA 1E6BA 4XRDA 2B7JA 4WETA 1CQHA 2YWMA 1OE7A 1XCCA 2DIYA 2HI7A 2YP6A 2ZCTA 4HS1A 5H5RA 2B7KA 1EOHA 3TKSC 2FNOA 4G2EA 1Y25A 2L4CA 5ENUA 3IHGA 2JBWA 2L6DA 4MZCA 3L9SA 1OYJA 2R3XA 4MP4A 1RW1A 4OFMA 3D21A 4EO3A 1W4VA 2I81A 1SYRA 1T4ZA 3KP8A 2WB9A 3IV4A 4N0ZA 3GTUA 3TKPA 2O89A 1NM3A 1FOHA 2GDRA 3FZ5A 4ECIA 2GVPA 2OACA 2EIRA 1B9XC 1TW9A 3LYKA 4F0CA 1R7HA 2JB3A 4O1PA 2OE1A 4K5RA 4ML1A 3QMXA 5D9WA 3N9JA 5A4WA 3FW2A 4MPGA 5DAKB 4CW9A 2ETDA 3DYRA 4GQFA 2GLRA 3ERWA 5JWQB 4WR5A 1PD21 4V2LA 1FG4A 1YO7A 4HEA1 5JCUA 3KMOA 1ZYQB 3L0HA 4K2DA 1PL1A 2YPMA 5HR0A 2VD1A 4ISDA 2AB6A 3A2VA 2H0IA 4IKHA 4J56E 2L59A 2FCHA 3U6VA 1SKSB 2RLDA 4HU7A 4K9ZA 4MDCA 2C0FA 4TVEA 2B1LA 2HZEB 4FYCA 1K0MA 1USBA 3VFIA 1T3BA 3TOUA 5IO2A 2H70A 4KF9A 1QGVA 3D22A 1THOA 4RQXA 1ZZYA 1DUGA 2CVBA 4F0BA 4ZXGA 13GSA 4GSTA 3P90A 17GSA 4USSA 2VUPA 1SJ6A 3KGKA 2WCIA 1MDIA 4LA1A 1F37A 3FR3A 3MSZA 5ECOB 2PVQA 1Z3EA 1U6TA 1S3DA 3DWVA 1PL2A 5D9VA 3IOSA 2F51A 1T1VA 1AUCA 3H93A 3IPZA 4KUNA 5CRHA 1XZOA 2FUG1 4EUYA 4EC0A 5ID2B 2IJYA 1X9WB 5D9TA 4MLYA 3WGXA 2HRFA 1GULA 4JR6A 2FY6A 4BVXA 2N5FA 4L0WA 4XIHA 4X1UA 4TKYA 4DSSB 3HJOA 4O1OA 4ZBDA 1A8LA 2LKUA 2HSHA 4L8EA 1R4WA 5JCGA 1G6WA 3KCMA 4L0UA 2LS5A 2HSYA 1EGOA 4BWSA 5AGYA 4YZCA 3IK9A 1JFUA 1M2DA 2L1LB 2DKHA 5A4UA 1J08A 4OO5A 1OAZA 3L78A 4V1Ag 4EL1A 3J7Yb 1AQVA 2AAWA 5LNKe 3WT2A 2QA1A 3BJ5A 2QA2A 2VCWA 4BL7A 3TJKA 2M80A 4KCAA 5HFIA 1PMTA 2JL4A 5ELAA 2WRTA 4YZ9A 4H86A 5JWRB 1BQ7A 1ZCPA 4ILFA 2CAQA 1O85A 4JBBA 2QSBA 5IOXA 4I5QA 3EVIA 4KE3A 3A2XA 1XVQA 5DALA 1M7TA 2ZNMA 4PQ1A 4I2UA 3RDWA 3A2WA 4YQUA 3HJMA 1BYEA 5HGIA 1ZGNA 2K8SA 1KTEA 5J4UA 3FMWA 2X99A 3KEBA 3WT1A 1H4OA 3L9UA 3S9FA 4YKFA 5FT3A 1ERTA 3QAVA 3E0UA 2ON5A 2IIYA 2WGRA 2C80A 1FVKA 1XWCA 2B5XA 4IBPA 1N2AA 3ME7A 5INYA 4FQUA 4XHMA 4IQ1A 2P5QA 5G31A 2CT6A 2PU9C 2FWGA 2REMA 1M9AA 4JEDA 3UAPA 1K0AA 4PTSA 3MWHA 2IMEA 4WBRD 3HVXA 1BG5A 3CRTA 2CX3A 4OCFA 4Z2UA 3C73A 4ML6A 2VCXA 2RUFA 5HR2A 1EZKA 1K0CA 4RQRA 3VI5A 2MZCA 2IFQA 4MZWA 2KP1A 2H75A 4DSRA 2YFBA 4AS2A 1O6JA 3VWXA 1SK2A 1JQOA 4OFTA 2LJAA 1OC9A 1M0UA 3GKNA 1W3SA 4EKZA 4QQ7A 1ZL9A 1T8EB 5IOWA 4D73A 3VA9A 2E2MA 1ZOFA 5BMUA 2LNSA 3EC3A 5EL8A 4ECCA 2XPEA 4PQIA 2LQOA 2V6EA 2H71A 4PL3A 1V58A 1AW9A 3EINA 3KTBA 1BEDA 5EPFA 2LTKA 1IYIA 5A5KA 1HD2A 4TOPA 1TK0B 1X5DA 1FAAA 4EDYA 4KDYA 5F06A 1FB6A 2VL2C 2X8GA 3ME8A 1TDPA 4LMWA 4MMMA 3I43A 6GSYA 2GQLA 3O6TA 3EMXA 3MIXA 4EE0A 2EIOA 3M0FA 2L57A 3QDNA 5DQYA 2A2PA 3FHKA 5DAKA 3C71A 2VLVA 3C7MA 1EGRA 1TXXA 4NHWA 1HYUA 2R0CA 4JR4A 1XWKA 2WJUA 3ZL5A 3TKRA 1SKRB 4YZDA 3M1GA 4QL7A 2LJKA 5DCGA 2JAEA 4YKGA 1MD4A 3DMLA 2G2QA 1AC1A 1U3AA 3GSSA 2ES7A 1XFLA 2AYTA 2VL3A 1S3CA 2YV9A 5LD0A 11GSA 1ST9A 3BOAA 1QK8A 2LEGA 1XW5A 2GT6A 3ZVJD 4TXOB 1PGTA 3M3MA 2GGTA 3K8NA 3G7IA 2YWIA 1M2AA 1VF3A 3LYPA 2VIMA 4IGJA 5F05A 4ID0A 2K6VA 1K0BA 1WJKA 1XOBA 4O32A 1A2JA 3FR9A 4CY6A 4ZL7A 4GLTA 5F8BA 3D4TA 3TCOA 2IMIA 6GSVA 4K0GA 3ZMKA 1PA3A 3C1RA 3GH6A 5CYYA 5ECKB 4NXIA 5F0GA 1F3AA 3Q8DA 4LL4B 3CYNA 1WPIA 4RUVA 2WFCA 3APOA 2K18A 5ID2A 2PERA 2L6CA 5DCHA 2YANA 3LW9A 10GSA 1PN9A 2XBIA 1FO5A 2OBKA 5C00A 4DSSA 4HOJA 5IIZA 2IN3A 3KJYA 4E8EA 1OC3A 3GKKA 2B1KA 4HU9A 3Q19A 3GIXA 1A2MA 1ZYNA 1GSDA 4DEJA 4Z7HA 3TJFA 4KB3A 6GSSA 2A4HA 4KSOA 3TJJA 4JZQA 4ZL8A 1YQ1A 1GUHA 1Y6EA 2PGTA 5B6MA 5ECLB 4V1Ap 2YCDA 5JCWA 5IMFA 1ZYPA 3QCPA 3LJ1A 4Z7GA 3TOTA 3ISOA 2LJRA 3LJ2A 4FYBA 2QGMA 2YFAA 4AJ8A 5CO3A 2V41A 3IRAA 3W6GA 4HZ4A 1X5CA 1EEJA 3UOMA 4GXTA 1PKZA 1SU9A 4O5QA 3F0IA 5BRTA 1ERUA 4D73B 3KTLA 2F66B 2HRKA 1R5PA 1FW1A 3F4RA 1K0OA 2KHPA 2XMXA 5IMZA 4KW6A 2VL2A 4O7HA 1AQXA 2CQ9A 3WD6A 1B4PA 1C72A 1EV9A 3O76A 3LSZA 5DDLA 1GSEA 4EIQA 1TP9A 5IMVA 1LBKA 4XRAA 5HR1A 1OKDA 3BCKA 3TKQA 4GF0A 3QR6A 2YN1A 5KN1A 4PUFC 2DBCA 3QPMA 3SBCA 2JSZA 3UBLA 5KOXA 2CAZB 1PFOA 2JZRA 3ED3A 2LUSA 3H1NA 1M3JA
chains in the Genus database with same CATH topology
4PURA 3EU4A 1DBYA 3GHAA 1OVNA 3HHVA 4TR3A 2L5OA 1ABAA 1A8YA 5J41A 3D5JA 4E8HA 4HJMA 3QFBC 4N11A 4MABA 3UEMA 4L5OA 4Q5NA 3CMIA 1VF4A 1GSYA 5FWGA 2ZUPA 4HFVA 3E3EA 5KN3A 1VF1A 5AIXA 4YQVA 2V1MA 2AUVA 1J0FA 3HJPA 2X4AA 1TRUA 3KXOA 3UVTA 3BCIA 1DE1A 3TRQA 3GX8A 3E9JB 4YAVA 4I6XA 4AJ6A 4F9ZA 3ZZXA 1KNGA 7GSSA 1JZDA 3UIWA 1NHYA 2HYXA 5ELGA 3PGTA 2FWHA 1GUKA 5ECRB 4GSSA 2HZFA 4G0IA 1EP7A 2R0GA 5AN1A 2E8GA 3IAS2 2L5LA 4MJCA 4KCEA 3IXRA 3TB2A 1V57A 4K6XA 4HQSA 3IAM2 4GCIA 2V6KA 2A2SA 2H6XA 3DKSA 4EDZA 5B6NA 4FH8A 2K9FA 1RQMA 2IWTA 4K7NA 4BWQA 3DO9A 3J7Yk 5DJLA 1XWAA 1U87A 4MPFA 3G7YA 1MD3A 3L4NA 4XS1A 5GSSA 1FOVA 4MZBA 2WDUA 3EE2A 4PL5A 3HCZA 4WEYA 2HRNA 4K8MA 3DIEA 2X8CA 4OCEA 2JADA 4PUAA 2C4JA 1GTAA 2J9HA 3M9KA 3NIVA 3JCML 1MDJA 3LORA 4TXOA 2G0FA 1YKAA 1SENA 1X9SB 1UC7A 3IHQA 2LRTA 3LJRA 1QUWA 1K0DA 2H0GA 3CSHA 3ZIJA 2LSTA 4KDXA 3ZVJA 1TRVA 2JZTA 5AISA 1TKDB 3I9V2 3L9VA 5ECSA 3BD2A 1F3BA 3O3TA 3FK8A 4OD7A 2IPAA 4F82A 4F03A 12GSA 2PVOC 1NHOA 2A2DA 3PR8A 2O87A 2B6MA 4OWYA 5G2ZA 5J9BA 3R3EA 1PQNA 3UL3A 4EVMA 3TKSA 1Z7PA 1GRXA 3TDGA 1Z7RA 2C3TA 4AGSA 4IVFA 3DVWA 4K2XA 2QKEA 4ECBA 4G9HA 1GSFA 1WOUA 2R2JA 4PX1A 1Z6MA 1XVWA 2XTRA 4GQCA 3QOUA 2V1CC 4KSMA 3GV1A 3TKSE 1TJDA 2PBJA 4MA9A 4RI6A 4TN8A 1Z5YE 1SKWB 3FKFA 2HNLA 1TOFA 2WULA 4FYUA 5EVOA 1MTCA 2DJ2A 2OKAA 1GH2A 4DVCA 3CTFA 1PKWA 2MMNA 2RUEA 4Z2RA 1EWXA 4N0VA 1J9BA 1CQGA 3KD0A 3QD9A 3KH7A 3TGZA 4MF6A 3VI7A 1JZRA 1O8XA 2BMXA 2FWFA 2LRNA 1Z9HA 4G0KA 4N30A 5LCZA 5CRGA 1XIYA 1SJ8A 2P22B 3UJ1A 1R5AA 2JACA 3G7JA 3RAZA 5J5NA 2NDOA 2DJ3A 5D8IA 4KH7A 3EWLA 1O7UA 5DJMA 3CTGA 5J9CA 2IMDA 5DBQA 2MBTA 1XW6A 1B4QA 4ACSA 3HVSA 3LG6A 3P2AA 3VK9A 2HSMA 2JU5A 2K8VA 1GSUA 5DVBA 4O5RA 1YEXA 4PNGA 4EF0A 4TR1B 1T7PB 3HD5A 4IQAA 4HQZA 4IP6A 1JLVA 3HXSA 4PXOA 2DJJA 3GA4A 4QL9A 1S3AA 8GSSA 2D2ZA 5ECIB 3H4KA 1GUMA 4MNNA 1PSQA 1ILOA 2DMMA 3Q74A 3SDJA 3D0ZA 2TRXA 3CBUA 1EV4A 2AV4A 1V9WA 4ZB6A 2XHFA 1LJRA 2DJ1A 1HNCA 1GNEA 2BTOT 3Q6OA 2C0EA 2VOCA 1PX7A 2H8LA 4Z7XA 3MDKA 4GTUA 1HQOA 2E7PA 1T00A 1JZOA 3EU3A 2FGXA 1Z6NA 4HJ2A 1EEMA 4AS3A 2F6MB 4MF7A 2J23A 4XTSA 3F3QA 1K3YA 1GTBA 1A2LA 1O73A 2XBQA 1QQ2A 3ZYWA 5CP1A 2F8FA 4IW9A 2H1DA 2H1BA 4EIPA 5IMDA 3P23A 1F6MC 2RM5A 3FZ9A 4PQHA 2H72A 1TRSA 3NZNA 4XS4B 3GFKA 5IMCA 1O8WA 4MJBA 4ICYA 4MK3A 5IPGA 2HRAA 3FZAA 2V32A 3RPNA 1SJZA 1TTZA 3EURA 2GQMA 1NSWA 3MAKA 2YV7A 2X49A 1U3IA 3C1SA 2TRCP 1B48A 5ECHB 3QFAC 1OKTA 4OAUC 1U88A 3N5OA 4HEA2 1XXUA 1BX9A 5KOWA 3FY7A 3VPTA 3QAGA 2MJFB 2OBIA 1A23A 4DWLA 2EC4A 1YEPA 2WZ9A 2IMKA 1IYHA 3GKMA 4CHSA 4G76A 1JHBA 1SL2B 3GN3A 1A0RP 4AJ7A 1WMJA 1ERWA 1GL8A 4YQMA 1WIKA 1GP1A 3H79A 1ZMAA 6GSUA 3F6FA 1XPVA 5G1KA 3KMNA 3U5RE 3FR6A 3LXZA 1JLWA 2K19A 1SYXA 3W8SA 2B5EA 4O5UA 4FO5A 4ZBBA 4LLRA 5D9XA 1PX6A 2PPTA 2HLSA 3G9BA 3CRUA 1F2EA 3EMPA 1K3OA 1PRXA 19GSA 2I1UA 3D4MA 5HFKA 3I69A 3AY8A 1HNAA 4V2MA 4PGTA 2OE3A 5HR3A 3M9JA 2FWEA 2B3SA 4HDEA 3VWWA 1G7EA 5A4VA 5B7CA 1TK5B 3W8JA 1FB0A 1XWBA 5D93A 3A3TA 5J3RA 2A4VA 2FUG2 2KP2A 2GT5A 4L5LA 1F9MA 2N5BA 1YY7A 1UA5A 1R26A 3PPUA 5EY6A 9GSSA 1SL0B 3TJGA 1DE2A 2CV4A 2VO4A 2ALBA 2DLXA 2R6KA 5L71A 3C8EA 1A0FA 2DKIA 5H5QA 3I6AA 3VPQA 2CZ3A 1MEKA 1G7OA 2HFDA 4YAPA 2P0GA 4TRXA 1YJ6A 4BA7A 3GMFA 3HDCA 2XTQA 3D6IA 1ML6A 4OFNA 1V2AA 5G5EA 5C04A 5HQPA 5CRWA 1I9DA 1B8XA 3IA1A 4HI7A 3US3A 4TW5A 2VM2A 1THXA 4IELA 3F6DA 4BVYB 2R0PA 1V98A 3VLNA 3ZTLA 2CA8A 2GSTA 2H66A 22GSA 2KLXA 1M99A 4XCSA 4NV5A 3RBTA 2DJ0A 20GSA 3CSJA 3GURA 3HY2A 5E4WA 6GSXA 3UBKA 3HKRA 5ECQB 3RPPA 3DGQA 2WS2A 4G10A 3EPTA 2MMZA 3UITA 5HFGA 2FA4A 4TR1A 4ZB8A 3EYTA 4POKA 5G5FA 5B8BA 2QC7A 3TUEA 2AJQB 2IMFA 5KN0A 2IL3A 1VGLA 5E59A 1TU7A 2VCZA 1ZYEA 1TK8B 3DA3A 4G75A 4JRRA 2XPDA 4CY8A 2GSRA 2V2GA 3CXGA 5ECPB 2ZRRA 2H01A 1N8JA 4WXTA 3LWAA 4BPYA 2YZHA 3F4TA 4NMUA 2IP6A 2H30A 4YH2A 2X8HA 1AQWA 1I5GA 3AJFA 3TRPA 2R5GA 2BJXA 1UN2A 1GTIA 4F2IA 3ZFLA 4OO4A 4Q9VA 2OA7A 3GYKA 3DVXA 2VLTA 3LQ7A 4LL1B 2F8AA 1GLQA 1GTUA 1M2BA 1GLPA 4X43A 3IK7A 1G6YA 2YNXA 4GXZA 4K5SA 1AIUA 4KNDA 1MDKA 1QMVA 5CRDA 2FLSA 4MF5A 2H74A 3KZQA 3FYGA 3KIJA 3ZMLA 1EP8A 1PN0A 4I97A 3F9UA 4K0NA 1GSQA 3HZ4A 1U5KA 1K0NA 1QXHA 4O92A 5JWOB 3BBYA 3VWVA 4FIWA 4NWYA 4IJ3A 2I4AA 4X4JA 4Q5RA 3FEUA 4EXJA 2H1GA 1K3LA 1B9YC 2C3NA 1DSBA 4XS4A 2KUCA 3UVHA 2NPBA 2VM1A 2O85A 5G1LA 1NW2A 4ZBAA 5CNWA 2H76A 2E0QA 2R4VA 4KGIA 5IMAA 3R2QA 1WE0A 5IQYA 3IDVA 1GNWA 4G19A 3A5IA 4RI7A 4KA0A 2RM6A 1G0TA 1YKCA 3CSIA 2MMOA 2OJLA 4JU5A 2FA8A 1ON4A 2GSSA 4PL4A 3GX0A 2KKMA 4MJAA 4JCVE 4IHUA 2FD3A 1RK4A 1BAYA 1WWJA 4NPBA 3LGCA 1XW9A 3KP9A 1SD9A 3ZRDA 5GSTA 1FHEA 3RHCA 3ZREA 4HUAA 4Q5FA 4MCUA 4WF4A 2L4QA 5IPHA 2YJHA 3FBVA 1VRSD 2H19A 3UMAA 4PNFA 3GUSA 4J2FA 5IM9A 1VF2A 3F8UA 2GQKA 1YDKA 1TI1A 2CX4A 4IS0A 3Q18A 5B8AA 3FZ4A 5GAND 3ZIVA 2RIOA 2XC2A 4HZ2A 4ECJA 3IAS1 4KDUA 2E2GA 3DA4A 2DIZA 5GAPD 3MNGA 1ACVA 5KN2A 3UARA 3IAM1 2JB1A 3GRXA 4JE1A 1SK0A 4A5PA 2JB2A 5CAXA 3GTUB 4Q5QA 4LMVA 3WYWA 1Q4JA 2LRCA 4XS6A 2GZYA 1TDIA 3NOFA 2JZSA 3RHBA 14GSA 3WGEA 4POBA 5AIVA 2O7KA 3KM6A 1XOAA 2CVKA 2MMAA 2N5AA 5COHA 4KAEA 4ZIJA 2PWJA 3LXTA 4GSNA 2GZZA 3GKXA 1A24A 2JSYA 4DSQA 16GSA 3ERFA 3ERGA 1E2YA 2RIIA 2F3MA 3SWLA 4IP1A 4TR4A 2B5YA 1Q98A 4I1TA 1X5EA 2RLIA 3ZFBA 2A2RA 2H1AA 2TIRA 4WF5A 4U6RA 4J57E 1H75A 3IC4A 1URMA 2HXKA 5ECMB 3PINA 4WKWA 1XBSA 3F4SA 1LU4A 3A5WA 4WR4A 2H6ZA 5D96A 5F07A 3I9V1 4ULXA 2GTUA 4NV2A 4TXVA 3VURA 4MH3A 2P5RA 4N10A 2MYGA 5DQSA 1QFNA 5IO0A 4NAXA 3VWUA 1SL1B 3M8NA 4K7OA 2VD0A 1XWGA 3ZITA 2YZUA 1UVZA 2M46A 4I2TA 4IJIA 4X0XA 2H0HA 4K7IA 2KOKA 1O81A 4P3YB 4BVYA 5ABRA 3IR4A 1HNBA 2YOIA 3PH9A 2Z9SA 1WRYA 3QAWA 3H8QA 3L0IA 2I9HA 3TJBA 3ZLPA 2CAIA 3F3RA 2DC5A 3GSTA 3GNJA 3TRXA 3LJ0A 1BJXA 2H6YA 2VL9A 1SD8A 2VLUA 2DJKA 4GRFA 2LNTA 4BVXB 2CZ2A 1OC8A 5ECNB 1EOGA 5LNK1 3LFLA 2C8UA 1X9MB 1W89A 2VAFA 4WBJA 2O8VB 2C3QA 6GSWA 3JSBA 2CVDA 1T4YA 2YWOA 2PUKC 1WP0A 1GWCA 4IN0A 4MH2A 2QSIA 2HZEA 2V6OA 3DEXA 3IC8A 3DD3A 2C0GA 3FRCA 3APQA 1JZWA 5H5SA 4K1FA 2C1YA 4KX4A 2LV3A 2OE0A 3KH9A 1X0RA 1OE8A 2GSQA 3GH9A 4BL7B 5G30A 3WGDA 1YF0A 4ZILA 3F4MA 2M72A 1FVJA 4GWRA 6GSTA 4OMVA 2A2CA 1AAZA 1TRWA 3GL3A 5GZZB 3HVVA 5FHIA 1YF1A 4CDOA 3DRNA 1AXDA 2FHEA 3F63A 2QGVA 3V1WA 2EIQA 5DALB 2VCQA 3GL5A 2HE3A 2LQQA 2P31A 2X64A 2NBSA 1SK1A 1TU8A 4V2NA 3P8WA 2PMTA 2VCVA 4POLA 2I3YA 18GSA 4ZL9A 2AHEA 4I8BA 1GSSA 4OAVB 2UZ8A 2R37A 1ERVA 2YJ7A 4ZB9A 2ON7A 2GZPA 3DXBA 5KEJA 2MBSA 2VCTA 2C0DA 2NVLA 3OR5A 2OADA 4AF2A 1M9BA 3HA9A 3APSA 4POMA 2PN8A 2GS3A 4Z2TA 3MYDA 2H73A 3LEFA 1KEBA 1V40A 2HT9A 1SJIA 4G0LA 1YZXA 3IBHA 2F9SA 2DSAA 5D73A 2IFQB 5CREA 3P7XA 2YWNA 3HZ8A 4MJEA 4NHZA 3IE3A 1TI3A 4TR0A 3HYPA 2DMLA 1KBNA 1OC9B 2NTOA 1E6BA 4XRDA 2B7JA 4WETA 1CQHA 2YWMA 1OE7A 1XCCA 2DIYA 2HI7A 2YP6A 2ZCTA 4HS1A 5H5RA 2B7KA 1EOHA 3TKSC 2FNOA 4G2EA 1Y25A 2L4CA 5ENUA 3IHGA 2L6DA 4MZCA 3L9SA 1OYJA 2R3XA 4MP4A 1RW1A 4OFMA 3D21A 4EO3A 1W4VA 2I81A 1SYRA 1T4ZA 3KP8A 2WB9A 3IV4A 4N0ZA 3GTUA 3TKPA 2O89A 1NM3A 1FOHA 2GDRA 3FZ5A 4ECIA 2GVPA 2OACA 2EIRA 1B9XC 1TW9A 3LYKA 4F0CA 1R7HA 2JB3A 4O1PA 2OE1A 4K5RA 4ML1A 3QMXA 5D9WA 3N9JA 5A4WA 3FW2A 4MPGA 5DAKB 4CW9A 3DYRA 4GQFA 2GLRA 3ERWA 5JWQB 4WR5A 1PD21 4V2LA 1FG4A 1YO7A 4HEA1 5JCUA 3KMOA 1ZYQB 3L0HA 4K2DA 1PL1A 2YPMA 5HR0A 2VD1A 4ISDA 2AB6A 3A2VA 2H0IA 4IKHA 4J56E 2L59A 2FCHA 3U6VA 1SKSB 4HU7A 4K9ZA 4MDCA 2C0FA 4TVEA 2B1LA 2HZEB 4FYCA 1K0MA 1USBA 3VFIA 1T3BA 3TOUA 5IO2A 2H70A 4KF9A 1QGVA 3D22A 1THOA 4RQXA 1ZZYA 1DUGA 2CVBA 4F0BA 4ZXGA 13GSA 4GSTA 3P90A 17GSA 4USSA 2VUPA 1SJ6A 3KGKA 2WCIA 1MDIA 4LA1A 1F37A 3FR3A 3MSZA 5ECOB 2PVQA 1Z3EA 1U6TA 1S3DA 3DWVA 1PL2A 5D9VA 3IOSA 2F51A 1T1VA 1AUCA 3H93A 3IPZA 4KUNA 5CRHA 1XZOA 2FUG1 4EUYA 4EC0A 5ID2B 2IJYA 1X9WB 5D9TA 4MLYA 3WGXA 2HRFA 1GULA 4JR6A 2FY6A 4BVXA 2N5FA 4L0WA 4XIHA 4X1UA 4TKYA 4DSSB 3HJOA 4O1OA 4ZBDA 1A8LA 2LKUA 2HSHA 4L8EA 1R4WA 5JCGA 1G6WA 3KCMA 4L0UA 2LS5A 2HSYA 1EGOA 4BWSA 5AGYA 4YZCA 3IK9A 1JFUA 1M2DA 2L1LB 2DKHA 5A4UA 4OO5A 1J08A 1OAZA 3L78A 4V1Ag 4EL1A 3J7Yb 1AQVA 2AAWA 5LNKe 3WT2A 2QA1A 3BJ5A 2QA2A 2VCWA 4BL7A 3TJKA 2M80A 4KCAA 5HFIA 1PMTA 2JL4A 5ELAA 2WRTA 4YZ9A 4H86A 5JWRB 1BQ7A 1ZCPA 4ILFA 2CAQA 1O85A 4JBBA 5IOXA 4I5QA 3EVIA 4KE3A 3A2XA 1XVQA 5DALA 1M7TA 2ZNMA 4PQ1A 4I2UA 3RDWA 3A2WA 4YQUA 3HJMA 1BYEA 5HGIA 1ZGNA 2K8SA 1KTEA 5J4UA 3FMWA 2X99A 3KEBA 3WT1A 1H4OA 3L9UA 3S9FA 4YKFA 5FT3A 1ERTA 3QAVA 3E0UA 2ON5A 2IIYA 2WGRA 2C80A 1FVKA 1XWCA 2B5XA 4IBPA 1N2AA 3ME7A 5INYA 4FQUA 4XHMA 4IQ1A 2P5QA 5G31A 2CT6A 2PU9C 2FWGA 2REMA 1M9AA 4JEDA 3UAPA 1K0AA 4PTSA 3MWHA 2IMEA 4WBRD 3HVXA 1BG5A 3CRTA 2CX3A 4OCFA 4Z2UA 3C73A 4ML6A 2VCXA 2RUFA 5HR2A 1EZKA 1K0CA 4RQRA 3VI5A 2MZCA 2IFQA 4MZWA 2KP1A 2H75A 4DSRA 2YFBA 4AS2A 1O6JA 3VWXA 1SK2A 4OFTA 2LJAA 1OC9A 1M0UA 3GKNA 1W3SA 4EKZA 4QQ7A 1ZL9A 1T8EB 5IOWA 4D73A 3VA9A 2E2MA 1ZOFA 5BMUA 2LNSA 3EC3A 5EL8A 4ECCA 2XPEA 4PQIA 2LQOA 2V6EA 2H71A 4PL3A 1V58A 1AW9A 3EINA 3KTBA 1BEDA 5EPFA 2LTKA 1IYIA 5A5KA 1HD2A 4TOPA 1TK0B 1X5DA 1FAAA 4EDYA 4KDYA 5F06A 1FB6A 2VL2C 2X8GA 3ME8A 4LMWA 4MMMA 3I43A 6GSYA 2GQLA 3O6TA 3EMXA 3MIXA 4EE0A 2EIOA 3M0FA 2L57A 3QDNA 5DQYA 2A2PA 3FHKA 5DAKA 3C71A 2VLVA 3C7MA 1EGRA 1TXXA 4NHWA 1HYUA 2R0CA 4JR4A 1XWKA 2WJUA 3ZL5A 3TKRA 1SKRB 4YZDA 3M1GA 4QL7A 2LJKA 5DCGA 2JAEA 4YKGA 1MD4A 3DMLA 2G2QA 1AC1A 1U3AA 3GSSA 2ES7A 1XFLA 2AYTA 2VL3A 1S3CA 2YV9A 5LD0A 11GSA 1ST9A 3BOAA 1QK8A 2LEGA 1XW5A 2GT6A 3ZVJD 4TXOB 1PGTA 3M3MA 2GGTA 3K8NA 3G7IA 2YWIA 1M2AA 1VF3A 3LYPA 2VIMA 4IGJA 5F05A 4ID0A 2K6VA 1K0BA 1WJKA 1XOBA 4O32A 1A2JA 3FR9A 4CY6A 4ZL7A 4GLTA 5F8BA 3D4TA 3TCOA 2IMIA 6GSVA 4K0GA 3ZMKA 1PA3A 3C1RA 3GH6A 5CYYA 5ECKB 4NXIA 5F0GA 1F3AA 3Q8DA 4LL4B 3CYNA 1WPIA 4RUVA 2WFCA 3APOA 2K18A 5ID2A 2PERA 2L6CA 5DCHA 2YANA 3LW9A 10GSA 1PN9A 2XBIA 1FO5A 2OBKA 5C00A 4DSSA 4HOJA 5IIZA 2IN3A 3KJYA 4E8EA 1OC3A 3GKKA 2B1KA 4HU9A 3Q19A 3GIXA 1A2MA 1ZYNA 1GSDA 4DEJA 4Z7HA 3TJFA 4KB3A 6GSSA 2A4HA 4KSOA 3TJJA 4JZQA 4ZL8A 1YQ1A 1GUHA 1Y6EA 2PGTA 5B6MA 5ECLB 4V1Ap 2YCDA 5JCWA 5IMFA 1ZYPA 3QCPA 4Z7GA 3LJ1A 3TOTA 3ISOA 2LJRA 3LJ2A 4FYBA 2YFAA 4AJ8A 5CO3A 2V41A 3IRAA 3W6GA 4HZ4A 1X5CA 1EEJA 3UOMA 4GXTA 1PKZA 1SU9A 4O5QA 3F0IA 5BRTA 1ERUA 4D73B 3KTLA 2F66B 2HRKA 1R5PA 1FW1A 3F4RA 1K0OA 2KHPA 2XMXA 5IMZA 4KW6A 2VL2A 4O7HA 1AQXA 2CQ9A 3WD6A 1B4PA 1C72A 1EV9A 3O76A 3LSZA 5DDLA 1GSEA 4EIQA 1TP9A 5IMVA 1LBKA 4XRAA 5HR1A 1OKDA 3BCKA 3TKQA 4GF0A 3QR6A 2YN1A 5KN1A 4PUFC 2DBCA 3QPMA 3SBCA 2JSZA 3UBLA 5KOXA 2CAZB 2JZRA 3ED3A 2LUSA 3H1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUR A;  3EU4 A;  1DBY A;  3GHA A;  1OVN A;  3HHV A;  4TR3 A;  2L5O A;  1ABA A;  1A8Y A;  5J41 A;  3D5J A;  4E8H A;  4HJM A;  3QFB C;  4N11 A;  4MAB A;  3UEM A;  4L5O A;  4Q5N A;  3CMI A;  1VF4 A;  1GSY A;  5FWG A;  2ZUP A;  3E3E A;  5KN3 A;  1VF1 A;  5AIX A;  4YQV A;  2V1M A;  2AUV A;  1J0F A;  3HJP A;  3KXO A;  1TRU A;  3UVT A;  3BCI A;  1DE1 A;  3TRQ A;  3GX8 A;  3E9J B;  4YAV A;  4I6X A;  4AJ6 A;  4F9Z A;  3ZZX A;  1KNG A;  7GSS A;  1JZD A;  3UIW A;  1NHY A;  2HYX A;  5ELG A;  3PGT A;  2FWH A;  1GUK A;  5ECR B;  4GSS A;  2HZF A;  1EP7 A;  5AN1 A;  3IAS 2;  2L5L A;  4MJC A;  4KCE A;  3IXR A;  3TB2 A;  1V57 A;  4K6X A;  4HQS A;  3IAM 2;  4GCI A;  2V6K A;  2A2S A;  2H6X A;  3DKS A;  4EDZ A;  5B6N A;  4FH8 A;  2K9F A;  1RQM A;  2IWT A;  4K7N A;  4BWQ A;  3J7Y k;  5DJL A;  1XWA A;  1U87 A;  4MPF A;  3G7Y A;  1MD3 A;  3L4N A;  4XS1 A;  5GSS A;  1FOV A;  4MZB A;  2WDU A;  3EE2 A;  3HCZ A;  4WEY A;  2HRN A;  4K8M A;  3DIE A;  2X8C A;  4OCE A;  2JAD A;  4PUA A;  2C4J A;  1GTA A;  2J9H A;  3M9K A;  3NIV A;  3JCM L;  1MDJ A;  3LOR A;  4TXO A;  2G0F A;  1YKA A;  1SEN A;  1X9S B;  1UC7 A;  3IHQ A;  2LRT A;  3LJR A;  1QUW A;  1K0D A;  2H0G A;  3CSH A;  3ZIJ A;  2LST A;  4KDX A;  3ZVJ A;  1TRV A;  2JZT A;  5AIS A;  1TKD B;  3I9V 2;  3L9V A;  5ECS A;  3BD2 A;  1F3B A;  3O3T A;  3FK8 A;  4OD7 A;  2IPA A;  4F82 A;  4F03 A;  12GS A;  2PVO C;  1NHO A;  3PR8 A;  2O87 A;  2B6M A;  4OWY A;  5G2Z A;  5J9B A;  1PQN A;  3UL3 A;  4EVM A;  3TKS A;  1Z7P A;  1GRX A;  3TDG A;  1Z7R A;  2C3T A;  4AGS A;  4IVF A;  3DVW A;  2QKE A;  4ECB A;  4G9H A;  1GSF A;  1WOU A;  2R2J A;  4PX1 A;  1Z6M A;  1XVW A;  4GQC A;  3QOU A;  4KSM A;  3GV1 A;  3TKS E;  1TJD A;  2PBJ A;  4MA9 A;  4RI6 A;  4TN8 A;  1Z5Y E;  1SKW B;  3FKF A;  2HNL A;  1TOF A;  2WUL A;  4FYU A;  5EVO A;  1MTC A;  2DJ2 A;  2OKA A;  1GH2 A;  4DVC A;  3CTF A;  1PKW A;  2MMN A;  2RUE A;  1EWX A;  4N0V A;  1J9B A;  1CQG A;  3KD0 A;  3QD9 A;  3KH7 A;  3TGZ A;  4MF6 A;  3VI7 A;  1JZR A;  1O8X A;  2BMX A;  2FWF A;  2LRN A;  1Z9H A;  4N30 A;  5LCZ A;  5CRG A;  1XIY A;  3UJ1 A;  1R5A A;  2JAC A;  3G7J A;  3RAZ A;  5J5N A;  2NDO A;  2DJ3 A;  5D8I A;  4KH7 A;  3EWL A;  1O7U A;  5DJM A;  3CTG A;  5J9C A;  2IMD A;  5DBQ A;  2MBT A;  1XW6 A;  1B4Q A;  4ACS A;  3HVS A;  3LG6 A;  3P2A A;  3VK9 A;  2JU5 A;  2K8V A;  5DVB A;  1GSU A;  4O5R A;  1YEX A;  4PNG A;  4EF0 A;  4TR1 B;  1T7P B;  3HD5 A;  4IQA A;  4HQZ A;  4IP6 A;  1JLV A;  3HXS A;  4PXO A;  2DJJ A;  3GA4 A;  4QL9 A;  1S3A A;  8GSS A;  2D2Z A;  5ECI B;  3H4K A;  1GUM A;  1PSQ A;  1ILO A;  2DMM A;  3Q74 A;  3D0Z A;  2TRX A;  3CBU A;  1EV4 A;  2AV4 A;  1V9W A;  4ZB6 A;  2XHF A;  1LJR A;  2DJ1 A;  1HNC A;  1GNE A;  2BTO T;  3Q6O A;  2C0E A;  2VOC A;  1PX7 A;  2H8L A;  4Z7X A;  3MDK A;  4GTU A;  1HQO A;  2E7P A;  1T00 A;  1JZO A;  3EU3 A;  2FGX A;  1Z6N A;  4HJ2 A;  1EEM A;  4MF7 A;  2J23 A;  4XTS A;  3F3Q A;  1K3Y A;  1GTB A;  1A2L A;  1O73 A;  2XBQ A;  1QQ2 A;  3ZYW A;  5CP1 A;  2F8F A;  4IW9 A;  2H1D A;  2H1B A;  5IMD A;  1F6M C;  2RM5 A;  3FZ9 A;  4PQH A;  2H72 A;  1TRS A;  3NZN A;  4XS4 B;  3GFK A;  5IMC A;  1O8W A;  4MJB A;  4MK3 A;  5IPG A;  3FZA A;  2V32 A;  3RPN A;  1SJZ A;  1TTZ A;  3EUR A;  2GQM A;  1NSW A;  3MAK A;  2YV7 A;  1U3I A;  3C1S A;  2TRC P;  1B48 A;  5ECH B;  3QFA C;  1OKT A;  1U88 A;  3N5O A;  4HEA 2;  1XXU A;  1BX9 A;  3FY7 A;  3VPT A;  3QAG A;  2OBI A;  1A23 A;  2EC4 A;  1YEP A;  2WZ9 A;  2IMK A;  1IYH A;  3GKM A;  4CHS A;  1JHB A;  1SL2 B;  3GN3 A;  1A0R P;  4AJ7 A;  1WMJ A;  1ERW A;  1GL8 A;  4YQM A;  1WIK A;  1GP1 A;  3H79 A;  1ZMA A;  6GSU A;  3F6F A;  1XPV A;  5G1K A;  3KMN A;  3U5R E;  3FR6 A;  3LXZ A;  1JLW A;  1SYX A;  3W8S A;  2B5E A;  4FO5 A;  4ZBB A;  4LLR A;  5D9X A;  1PX6 A;  2PPT A;  2HLS A;  3G9B A;  3CRU A;  1F2E A;  3EMP A;  1K3O A;  1PRX A;  19GS A;  2I1U A;  3D4M A;  5HFK A;  3I69 A;  3AY8 A;  1HNA A;  4V2M A;  4PGT A;  2OE3 A;  5HR3 A;  3M9J A;  2FWE A;  2B3S A;  4HDE A;  3VWW A;  1G7E A;  5A4V A;  5B7C A;  1TK5 B;  3W8J A;  1FB0 A;  1XWB A;  5D93 A;  3A3T A;  5J3R A;  2A4V A;  2FUG 2;  2KP2 A;  2GT5 A;  4L5L A;  1F9M A;  2N5B A;  1YY7 A;  1UA5 A;  1R26 A;  5EY6 A;  9GSS A;  1SL0 B;  3TJG A;  1DE2 A;  2CV4 A;  2VO4 A;  2ALB A;  2DLX A;  2R6K A;  5L71 A;  3C8E A;  1A0F A;  5H5Q A;  3VPQ A;  3I6A A;  2CZ3 A;  1MEK A;  1G7O A;  2HFD A;  4YAP A;  2P0G A;  4TRX A;  1YJ6 A;  4BA7 A;  3GMF A;  3HDC A;  3D6I A;  1ML6 A;  4OFN A;  1V2A A;  5G5E A;  5C04 A;  5HQP A;  5CRW A;  1I9D A;  1B8X A;  3IA1 A;  4HI7 A;  3US3 A;  4TW5 A;  2VM2 A;  1THX A;  4IEL A;  3F6D A;  1V98 A;  3VLN A;  3ZTL A;  2CA8 A;  2GST A;  2H66 A;  22GS A;  2KLX A;  1M99 A;  4XCS A;  4NV5 A;  3RBT A;  2DJ0 A;  20GS A;  3CSJ A;  3GUR A;  3HY2 A;  5E4W A;  6GSX A;  3UBK A;  3HKR A;  5ECQ B;  3RPP A;  3DGQ A;  2WS2 A;  4G10 A;  2MMZ A;  5HFG A;  2FA4 A;  4TR1 A;  4ZB8 A;  3EYT A;  4POK A;  5G5F A;  5B8B A;  2QC7 A;  3TUE A;  2AJQ B;  2IMF A;  5KN0 A;  2IL3 A;  1VGL A;  5E59 A;  1TU7 A;  2VCZ A;  1ZYE A;  1TK8 B;  4JRR A;  2XPD A;  2GSR A;  2V2G A;  3CXG A;  5ECP B;  2H01 A;  1N8J A;  4WXT A;  3LWA A;  4BPY A;  2YZH A;  3F4T A;  4NMU A;  2H30 A;  4YH2 A;  2X8H A;  1AQW A;  1I5G A;  3TRP A;  2R5G A;  2BJX A;  1UN2 A;  1GTI A;  4F2I A;  3ZFL A;  4OO4 A;  2OA7 A;  3GYK A;  3DVX A;  2VLT A;  3LQ7 A;  4LL1 B;  2F8A A;  1GLQ A;  1GTU A;  1M2B A;  1GLP A;  4X43 A;  3IK7 A;  1G6Y A;  2YNX A;  4GXZ A;  1AIU A;  4KND A;  1MDK A;  1QMV A;  5CRD A;  2FLS A;  4MF5 A;  2H74 A;  3KZQ A;  3FYG A;  3KIJ A;  3ZML A;  1EP8 A;  4I97 A;  3F9U A;  4K0N A;  1GSQ A;  3HZ4 A;  1K0N A;  1QXH A;  4O92 A;  5JWO B;  3BBY A;  3VWV A;  4FIW A;  4NWY A;  4IJ3 A;  2I4A A;  4Q5R A;  3FEU A;  4EXJ A;  2H1G A;  1K3L A;  1B9Y C;  2C3N A;  1DSB A;  4XS4 A;  2KUC A;  3UVH A;  2NPB A;  2VM1 A;  2O85 A;  5G1L A;  1NW2 A;  4ZBA A;  5CNW A;  2H76 A;  2E0Q A;  2R4V A;  4KGI A;  5IMA A;  3R2Q A;  1WE0 A;  5IQY A;  3IDV A;  1GNW A;  4G19 A;  4RI7 A;  4KA0 A;  2RM6 A;  1G0T A;  1YKC A;  3CSI A;  2MMO A;  2OJL A;  4JU5 A;  2FA8 A;  1ON4 A;  2GSS A;  3GX0 A;  4MJA A;  4IHU A;  2FD3 A;  1RK4 A;  1BAY A;  1WWJ A;  4NPB A;  3LGC A;  1XW9 A;  3KP9 A;  1SD9 A;  3ZRD A;  5GST A;  1FHE A;  3RHC A;  3ZRE A;  4HUA A;  4Q5F A;  4MCU A;  4WF4 A;  2L4Q A;  5IPH A;  2YJH A;  1VRS D;  2H19 A;  3UMA A;  4PNF A;  3GUS A;  4J2F A;  5IM9 A;  1VF2 A;  3F8U A;  2GQK A;  1YDK A;  1TI1 A;  2CX4 A;  4IS0 A;  3Q18 A;  5B8A A;  3FZ4 A;  5GAN D;  3ZIV A;  2XC2 A;  4HZ2 A;  4ECJ A;  4KDU A;  2E2G A;  2DIZ A;  5GAP D;  3MNG A;  1ACV A;  5KN2 A;  3UAR A;  3GRX A;  4JE1 A;  1SK0 A;  5CAX A;  3GTU B;  4Q5Q A;  4LMV A;  3WYW A;  1Q4J A;  2LRC A;  4XS6 A;  2GZY A;  1TDI A;  3NOF A;  2JZS A;  3RHB A;  14GS A;  3WGE A;  4POB A;  5AIV A;  2O7K A;  3KM6 A;  1XOA A;  2CVK A;  2MMA A;  2N5A A;  5COH A;  4KAE A;  4ZIJ A;  2PWJ A;  3LXT A;  4GSN A;  2GZZ A;  3GKX A;  1A24 A;  2JSY A;  4DSQ A;  16GS A;  3ERF A;  3ERG A;  1E2Y A;  2RII A;  2F3M A;  3SWL A;  4IP1 A;  4TR4 A;  2B5Y A;  1Q98 A;  1X5E A;  2RLI A;  3ZFB A;  2A2R A;  2H1A A;  2TIR A;  4WF5 A;  4J57 E;  1H75 A;  3IC4 A;  1URM A;  2HXK A;  5ECM B;  3PIN A;  4WKW A;  1XBS A;  3F4S A;  1LU4 A;  3A5W A;  4WR4 A;  2H6Z A;  5D96 A;  5F07 A;  4ULX A;  2GTU A;  4NV2 A;  4TXV A;  3VUR A;  4MH3 A;  2P5R A;  4N10 A;  2MYG A;  5DQS A;  1QFN A;  5IO0 A;  4NAX A;  3VWU A;  1SL1 B;  3M8N A;  4K7O A;  2VD0 A;  1XWG A;  3ZIT A;  2YZU A;  1UVZ A;  2M46 A;  4I2T A;  4IJI A;  4X0X A;  2H0H A;  4K7I A;  2KOK A;  1O81 A;  4P3Y B;  4BVY A;  5ABR A;  3IR4 A;  1HNB A;  2YOI A;  3PH9 A;  2Z9S A;  1WRY A;  3QAW A;  3H8Q A;  2I9H A;  3TJB A;  3ZLP A;  2CAI A;  3F3R A;  2DC5 A;  3GST A;  3GNJ A;  3TRX A;  1BJX A;  2H6Y A;  2VL9 A;  1SD8 A;  2VLU A;  2DJK A;  4GRF A;  2LNT A;  2CZ2 A;  1OC8 A;  5ECN B;  1EOG A;  3LFL A;  2C8U A;  1X9M B;  1W89 A;  2VAF A;  4WBJ A;  2O8V B;  2C3Q A;  6GSW A;  2CVD A;  1T4Y A;  2YWO A;  2PUK C;  1WP0 A;  1GWC A;  4IN0 A;  4MH2 A;  2QSI A;  2HZE A;  2V6O A;  3DEX A;  3DD3 A;  2C0G A;  3FRC A;  3APQ A;  1JZW A;  5H5S A;  4K1F A;  2C1Y A;  4KX4 A;  2LV3 A;  2OE0 A;  3KH9 A;  1X0R A;  1OE8 A;  2GSQ A;  3GH9 A;  5G30 A;  3WGD A;  1YF0 A;  4ZIL A;  2M72 A;  1FVJ A;  4GWR A;  6GST A;  4OMV A;  1AAZ A;  1TRW A;  3GL3 A;  5GZZ B;  3HVV A;  5FHI A;  1YF1 A;  4CDO A;  3DRN A;  1AXD A;  2FHE A;  3F63 A;  2QGV A;  3V1W A;  2EIQ A;  5DAL B;  2VCQ A;  3GL5 A;  2HE3 A;  2LQQ A;  2P31 A;  2X64 A;  2NBS A;  1SK1 A;  1TU8 A;  4V2N A;  3P8W A;  2PMT A;  2VCV A;  4POL A;  2I3Y A;  18GS A;  4ZL9 A;  2AHE A;  4I8B A;  1GSS A;  2R37 A;  1ERV A;  2YJ7 A;  4ZB9 A;  2ON7 A;  2GZP A;  3DXB A;  5KEJ A;  2MBS A;  2VCT A;  2C0D A;  2NVL A;  3OR5 A;  2OAD A;  4AF2 A;  1M9B A;  3HA9 A;  3APS A;  4POM A;  2PN8 A;  2GS3 A;  2H73 A;  3LEF A;  1KEB A;  1V40 A;  2HT9 A;  1SJI A;  1YZX A;  3IBH A;  2F9S A;  2DSA A;  5D73 A;  2IFQ B;  5CRE A;  3P7X A;  2YWN A;  3HZ8 A;  4MJE A;  4NHZ A;  3IE3 A;  1TI3 A;  4TR0 A;  3HYP A;  2DML A;  1KBN A;  1OC9 B;  2NTO A;  1E6B A;  4XRD A;  2B7J A;  4WET A;  1CQH A;  2YWM A;  1OE7 A;  1XCC A;  2DIY A;  2HI7 A;  2YP6 A;  2ZCT A;  4HS1 A;  5H5R A;  2B7K A;  1EOH A;  3TKS C;  2FNO A;  4G2E A;  1Y25 A;  2L4C A;  5ENU A;  2L6D A;  4MZC A;  3L9S A;  1OYJ A;  2R3X A;  4MP4 A;  1RW1 A;  4OFM A;  3D21 A;  4EO3 A;  1W4V A;  2I81 A;  1SYR A;  1T4Z A;  3KP8 A;  2WB9 A;  3IV4 A;  4N0Z A;  3GTU A;  3TKP A;  2O89 A;  1NM3 A;  2GDR A;  3FZ5 A;  4ECI A;  2GVP A;  2OAC A;  2EIR A;  1B9X C;  1TW9 A;  3LYK A;  4F0C A;  1R7H A;  2OE1 A;  5D9W A;  3QMX A;  4ML1 A;  3N9J A;  5A4W A;  3FW2 A;  4MPG A;  5DAK B;  4CW9 A;  3DYR A;  4GQF A;  2GLR A;  3ERW A;  5JWQ B;  4WR5 A;  1PD2 1;  4V2L A;  1FG4 A;  5JCU A;  3KMO A;  1ZYQ B;  3L0H A;  4K2D A;  1PL1 A;  2YPM A;  5HR0 A;  2VD1 A;  4ISD A;  2AB6 A;  3A2V A;  2H0I A;  4IKH A;  4J56 E;  2L59 A;  2FCH A;  3U6V A;  1SKS B;  4HU7 A;  4K9Z A;  4MDC A;  2C0F A;  4TVE A;  2B1L A;  2HZE B;  4FYC A;  1K0M A;  1USB A;  3VFI A;  1T3B A;  3TOU A;  5IO2 A;  2H70 A;  1QGV A;  3D22 A;  1THO A;  4RQX A;  1ZZY A;  1DUG A;  2CVB A;  4F0B A;  4ZXG A;  13GS A;  4GST A;  3P90 A;  17GS A;  2VUP A;  1SJ6 A;  3KGK A;  2WCI A;  1MDI A;  4LA1 A;  1F37 A;  3FR3 A;  3MSZ A;  5ECO B;  2PVQ A;  1Z3E A;  1U6T A;  5D9V A;  1S3D A;  3DWV A;  1PL2 A;  3IOS A;  2F51 A;  1T1V A;  1AUC A;  3H93 A;  3IPZ A;  4KUN A;  5CRH A;  1XZO A;  4EUY A;  4EC0 A;  5ID2 B;  2IJY A;  1X9W B;  5D9T A;  4MLY A;  3WGX A;  2HRF A;  1GUL A;  4JR6 A;  2FY6 A;  4BVX A;  2N5F A;  4L0W A;  4XIH A;  4X1U A;  4TKY A;  4DSS B;  3HJO A;  4ZBD A;  1A8L A;  2LKU A;  2HSH A;  4L8E A;  1R4W A;  5JCG A;  1G6W A;  3KCM A;  4L0U A;  2LS5 A;  2HSY A;  1EGO A;  4BWS A;  5AGY A;  3IK9 A;  1JFU A;  1M2D A;  5A4U A;  4OO5 A;  1J08 A;  1OAZ A;  3L78 A;  4V1A g;  4EL1 A;  3J7Y b;  1AQV A;  2AAW A;  5LNK e;  3WT2 A;  3BJ5 A;  2VCW A;  4BL7 A;  3TJK A;  2M80 A;  4KCA A;  5HFI A;  1PMT A;  2JL4 A;  5ELA A;  2WRT A;  4H86 A;  5JWR B;  1BQ7 A;  1ZCP A;  4ILF A;  2CAQ A;  1O85 A;  4JBB A;  5IOX A;  4I5Q A;  3EVI A;  4KE3 A;  3A2X A;  1XVQ A;  5DAL A;  1M7T A;  2ZNM A;  4PQ1 A;  4I2U A;  3RDW A;  3A2W A;  4YQU A;  3HJM A;  1BYE A;  2K8S A;  1ZGN A;  1KTE A;  5J4U A;  2X99 A;  3KEB A;  3WT1 A;  1H4O A;  3L9U A;  3S9F A;  5FT3 A;  1ERT A;  3QAV A;  3E0U A;  2ON5 A;  2IIY A;  2WGR A;  2C80 A;  1FVK A;  1XWC A;  2B5X A;  4IBP A;  1N2A A;  3ME7 A;  5INY A;  4XHM A;  4IQ1 A;  2P5Q A;  5G31 A;  2CT6 A;  2PU9 C;  2FWG A;  2REM A;  1M9A A;  4JED A;  3UAP A;  1K0A A;  3MWH A;  2IME A;  4WBR D;  3HVX A;  1BG5 A;  3CRT A;  2CX3 A;  4OCF A;  3C73 A;  4ML6 A;  2VCX A;  2RUF A;  5HR2 A;  1EZK A;  1K0C A;  4RQR A;  3VI5 A;  2MZC A;  2IFQ A;  4MZW A;  2KP1 A;  2H75 A;  4DSR A;  1O6J A;  3VWX A;  1SK2 A;  4OFT A;  2LJA A;  1OC9 A;  1M0U A;  3GKN A;  4EKZ A;  4QQ7 A;  1ZL9 A;  1T8E B;  5IOW A;  4D73 A;  2E2M A;  1ZOF A;  2LNS A;  3EC3 A;  5EL8 A;  4ECC A;  2XPE A;  4PQI A;  2LQO A;  2H71 A;  1V58 A;  1AW9 A;  3EIN A;  3KTB A;  1BED A;  5EPF A;  2LTK A;  1IYI A;  5A5K A;  1HD2 A;  4TOP A;  1TK0 B;  1X5D A;  1FAA A;  4EDY A;  4KDY A;  5F06 A;  1FB6 A;  2VL2 C;  2X8G A;  3ME8 A;  4LMW A;  4MMM A;  3I43 A;  6GSY A;  2GQL A;  3O6T A;  3EMX A;  4EE0 A;  2EIO A;  3M0F A;  2L57 A;  3QDN A;  5DQY A;  3FHK A;  5DAK A;  3C71 A;  2VLV A;  3C7M A;  1EGR A;  1TXX A;  4NHW A;  1HYU A;  4JR4 A;  1XWK A;  2WJU A;  3ZL5 A;  3TKR A;  1SKR B;  3M1G A;  4QL7 A;  2LJK A;  5DCG A;  1MD4 A;  3DML A;  2G2Q A;  1AC1 A;  1U3A A;  3GSS A;  2ES7 A;  1XFL A;  2AYT A;  2VL3 A;  1S3C A;  2YV9 A;  5LD0 A;  11GS A;  1ST9 A;  3BOA A;  1QK8 A;  2LEG A;  1XW5 A;  2GT6 A;  3ZVJ D;  4TXO B;  1PGT A;  3M3M A;  2GGT A;  3K8N A;  3G7I A;  2YWI A;  1M2A A;  1VF3 A;  3LYP A;  2VIM A;  4IGJ A;  5F05 A;  4ID0 A;  2K6V A;  1K0B A;  1WJK A;  1XOB A;  4O32 A;  1A2J A;  3FR9 A;  4ZL7 A;  4GLT A;  5F8B A;  3D4T A;  3TCO A;  2IMI A;  6GSV A;  4K0G A;  3ZMK A;  1PA3 A;  3C1R A;  3GH6 A;  5CYY A;  5ECK B;  4NXI A;  5F0G A;  1F3A A;  4LL4 B;  3CYN A;  1WPI A;  4RUV A;  2WFC A;  3APO A;  2K18 A;  5ID2 A;  2PER A;  2L6C A;  5DCH A;  2YAN A;  10GS A;  1PN9 A;  2XBI A;  1FO5 A;  2OBK A;  5C00 A;  4DSS A;  4HOJ A;  5IIZ A;  2IN3 A;  3KJY A;  4E8E A;  1OC3 A;  3GKK A;  2B1K A;  4HU9 A;  3Q19 A;  3GIX A;  1A2M A;  1GSD A;  4DEJ A;  3TJF A;  4KB3 A;  6GSS A;  4KSO A;  3TJJ A;  4JZQ A;  4ZL8 A;  1YQ1 A;  1GUH A;  1Y6E A;  2PGT A;  5B6M A;  5ECL B;  4V1A p;  2YCD A;  5JCW A;  5IMF A;  3QCP A;  3TOT A;  3ISO A;  2LJR A;  4FYB A;  4AJ8 A;  5CO3 A;  2V41 A;  3IRA A;  3W6G A;  4HZ4 A;  1X5C A;  1EEJ A;  3UOM A;  1PKZ A;  1SU9 A;  3F0I A;  1ERU A;  4D73 B;  3KTL A;  1R5P A;  1FW1 A;  3F4R A;  1K0O A;  2KHP A;  5IMZ A;  4KW6 A;  2VL2 A;  4O7H A;  1AQX A;  2CQ9 A;  3WD6 A;  1B4P A;  1C72 A;  1EV9 A;  3O76 A;  3LSZ A;  5DDL A;  1GSE A;  1TP9 A;  5IMV A;  1LBK A;  4XRA A;  5HR1 A;  1OKD A;  3BCK A;  3TKQ A;  4GF0 A;  3QR6 A;  2YN1 A;  5KN1 A;  4PUF C;  2DBC A;  3QPM A;  3SBC A;  2JSZ A;  3UBL A;  2JZR A;  3ED3 A;  2LUS A;  3H1N A; 
#chains in the Genus database with same CATH topology
 4PUR A;  3EU4 A;  1DBY A;  3GHA A;  1OVN A;  3HHV A;  4BIK A;  4TR3 A;  2L5O A;  1ABA A;  1A8Y A;  5J41 A;  3D5J A;  4E8H A;  4HJM A;  3QFB C;  4N11 A;  4MAB A;  3UEM A;  4L5O A;  4Q5N A;  3CMI A;  1VF4 A;  1GSY A;  5FWG A;  2ZUP A;  4HFV A;  3E3E A;  5KN3 A;  1VF1 A;  5AIX A;  4YQV A;  2V1M A;  2AUV A;  1J0F A;  3HJP A;  2X4A A;  1TRU A;  3KXO A;  3UVT A;  3BCI A;  1DE1 A;  3TRQ A;  3GX8 A;  3E9J B;  4YAV A;  4I6X A;  4AJ6 A;  4F9Z A;  3ZZX A;  1KNG A;  7GSS A;  1JZD A;  3UIW A;  1NHY A;  2HYX A;  5ELG A;  3PGT A;  2FWH A;  1GUK A;  5ECR B;  4GSS A;  2HZF A;  4G0I A;  1EP7 A;  2R0G A;  5AN1 A;  2E8G A;  3IAS 2;  2L5L A;  4MJC A;  4KCE A;  3IXR A;  3TB2 A;  1V57 A;  4K6X A;  4HQS A;  3IAM 2;  4GCI A;  2V6K A;  2A2S A;  2H6X A;  3DKS A;  4EDZ A;  5B6N A;  4FH8 A;  2K9F A;  1RQM A;  2IWT A;  4K7N A;  4BWQ A;  3DO9 A;  3J7Y k;  5DJL A;  1XWA A;  1U87 A;  4MPF A;  3G7Y A;  1MD3 A;  3L4N A;  4XS1 A;  5GSS A;  1FOV A;  4MZB A;  2WDU A;  3EE2 A;  4PL5 A;  3HCZ A;  4WEY A;  2ZW3 A;  2HRN A;  4K8M A;  3DIE A;  2X8C A;  4OCE A;  2JAD A;  4PUA A;  2C4J A;  1GTA A;  2J9H A;  3M9K A;  3NIV A;  3JCM L;  1MDJ A;  3LOR A;  4TXO A;  2G0F A;  1YKA A;  1SEN A;  1X9S B;  1UC7 A;  3IHQ A;  2LRT A;  3LJR A;  1QUW A;  1K0D A;  3HVN A;  2H0G A;  3CSH A;  3ZIJ A;  2LST A;  2HGK A;  4KDX A;  3ZVJ A;  1TRV A;  2JZT A;  5AIS A;  1TKD B;  3I9V 2;  3L9V A;  5ECS A;  3BD2 A;  1F3B A;  3O3T A;  3FK8 A;  4OD7 A;  2IPA A;  4F82 A;  4F03 A;  12GS A;  2PVO C;  1NHO A;  2A2D A;  3PR8 A;  2O87 A;  2B6M A;  4OWY A;  5G2Z A;  5J9B A;  3R3E A;  1PQN A;  3UL3 A;  4EVM A;  3TKS A;  1Z7P A;  1GRX A;  3TDG A;  1Z7R A;  2C3T A;  4AGS A;  4IVF A;  3DVW A;  4K2X A;  2QKE A;  4ECB A;  4G9H A;  1GSF A;  1WOU A;  2R2J A;  4PX1 A;  1Z6M A;  1XVW A;  2XTR A;  4GQC A;  3QOU A;  2V1C C;  4KSM A;  3GV1 A;  3TKS E;  1TJD A;  2PBJ A;  4MA9 A;  4RI6 A;  4TN8 A;  1Z5Y E;  1SKW B;  3FKF A;  2HNL A;  1TOF A;  2WUL A;  4FYU A;  5EVO A;  1MTC A;  2DJ2 A;  2OKA A;  1GH2 A;  4DVC A;  3CTF A;  1PKW A;  2MMN A;  2RUE A;  4Z2R A;  1EWX A;  4N0V A;  1J9B A;  1CQG A;  3KD0 A;  3QD9 A;  3KH7 A;  3TGZ A;  4MF6 A;  3VI7 A;  1JZR A;  1O8X A;  2BMX A;  2FWF A;  2LRN A;  1Z9H A;  4G0K A;  4N30 A;  5LCZ A;  5CRG A;  1XIY A;  1SJ8 A;  2P22 B;  3UJ1 A;  1R5A A;  2JAC A;  3G7J A;  3RAZ A;  5J5N A;  2NDO A;  2DJ3 A;  5D8I A;  4KH7 A;  3EWL A;  1O7U A;  5DJM A;  3CTG A;  5J9C A;  2IMD A;  5DBQ A;  2MBT A;  1XW6 A;  1B4Q A;  4ACS A;  3HVS A;  3LG6 A;  3P2A A;  3VK9 A;  2HSM A;  2JU5 A;  2K8V A;  1GSU A;  5DVB A;  4O5R A;  1YEX A;  4PNG A;  4EF0 A;  4TR1 B;  1T7P B;  3HD5 A;  4IQA A;  4HQZ A;  4IP6 A;  1JLV A;  3HXS A;  4PXO A;  2BL7 A;  2DJJ A;  3GA4 A;  4QL9 A;  1S3A A;  8GSS A;  2D2Z A;  5ECI B;  3H4K A;  1GUM A;  4MNN A;  1PSQ A;  1ILO A;  2DMM A;  3Q74 A;  3SDJ A;  3D0Z A;  2TRX A;  3CBU A;  1EV4 A;  2AV4 A;  1V9W A;  4ZB6 A;  2XHF A;  1LJR A;  2DJ1 A;  1HNC A;  1GNE A;  2BTO T;  3Q6O A;  2C0E A;  2VOC A;  1PX7 A;  2H8L A;  4Z7X A;  3MDK A;  4GTU A;  1HQO A;  2E7P A;  1T00 A;  1JZO A;  3EU3 A;  2FGX A;  1Z6N A;  4HJ2 A;  1EEM A;  4AS3 A;  2F6M B;  4MF7 A;  2J23 A;  4XTS A;  3F3Q A;  1K3Y A;  1GTB A;  1A2L A;  1O73 A;  2XBQ A;  1QQ2 A;  3ZYW A;  5CP1 A;  2F8F A;  4IW9 A;  2H1D A;  3B55 A;  2H1B A;  4EIP A;  5IMD A;  3P23 A;  1F6M C;  2RM5 A;  3FZ9 A;  4PQH A;  2H72 A;  1TRS A;  3NZN A;  4XS4 B;  3GFK A;  5IMC A;  1O8W A;  4MJB A;  4ICY A;  4MK3 A;  5IPG A;  2HRA A;  3FZA A;  2V32 A;  3RPN A;  1SJZ A;  1TTZ A;  3EUR A;  2GQM A;  1NSW A;  3MAK A;  2YV7 A;  2X49 A;  1U3I A;  3C1S A;  2TRC P;  1B48 A;  5ECH B;  3QFA C;  1OKT A;  4OAU C;  1U88 A;  3N5O A;  4HEA 2;  1XXU A;  1BX9 A;  5KOW A;  3FY7 A;  3VPT A;  3QAG A;  2MJF B;  2OBI A;  1A23 A;  4DWL A;  2EC4 A;  1YEP A;  2WZ9 A;  2IMK A;  1IYH A;  3GKM A;  4CHS A;  4G76 A;  1JHB A;  1SL2 B;  3GN3 A;  1A0R P;  4AJ7 A;  1WMJ A;  1ERW A;  1GL8 A;  4YQM A;  1WIK A;  1GP1 A;  3H79 A;  1ZMA A;  6GSU A;  3F6F A;  1XPV A;  5G1K A;  3KMN A;  3U5R E;  3FR6 A;  3LXZ A;  1JLW A;  2K19 A;  1SYX A;  3W8S A;  2B5E A;  4O5U A;  4FO5 A;  4ZBB A;  4HSC X;  4LLR A;  5D9X A;  1PX6 A;  2PPT A;  2HLS A;  3G9B A;  3CRU A;  1F2E A;  3EMP A;  1K3O A;  1PRX A;  19GS A;  2I1U A;  3D4M A;  5HFK A;  3I69 A;  3AY8 A;  1HNA A;  4V2M A;  4PGT A;  2OE3 A;  5HR3 A;  3M9J A;  2FWE A;  2B3S A;  4HDE A;  3VWW A;  1G7E A;  5A4V A;  5B7C A;  1TK5 B;  3W8J A;  2GSC A;  1FB0 A;  1XWB A;  5D93 A;  3A3T A;  5J3R A;  2A4V A;  2FUG 2;  2KP2 A;  2GT5 A;  4L5L A;  1F9M A;  2N5B A;  1YY7 A;  1UA5 A;  1R26 A;  3PPU A;  5EY6 A;  9GSS A;  1SL0 B;  3TJG A;  1DE2 A;  2CV4 A;  2VO4 A;  2ALB A;  2DLX A;  2R6K A;  5L71 A;  3C8E A;  1A0F A;  2DKI A;  5H5Q A;  3I6A A;  3VPQ A;  2CZ3 A;  1MEK A;  1G7O A;  2HFD A;  4YAP A;  2P0G A;  4TRX A;  1YJ6 A;  4BA7 A;  3GMF A;  3FNB A;  3HDC A;  2XTQ A;  3D6I A;  1ML6 A;  4OFN A;  1V2A A;  5G5E A;  5C04 A;  5HQP A;  5CRW A;  1I9D A;  1B8X A;  3IA1 A;  4HI7 A;  3US3 A;  4TW5 A;  2VM2 A;  1THX A;  4IEL A;  3F6D A;  4BVY B;  2R0P A;  1V98 A;  3VLN A;  3ZTL A;  2CA8 A;  2GST A;  2H66 A;  22GS A;  2KLX A;  1M99 A;  4XCS A;  4NV5 A;  3RBT A;  2DJ0 A;  20GS A;  3CSJ A;  3GUR A;  3HY2 A;  5E4W A;  6GSX A;  3UBK A;  3HKR A;  5ECQ B;  3RPP A;  3DGQ A;  2WS2 A;  4G10 A;  3EPT A;  2MMZ A;  3UIT A;  5HFG A;  2FA4 A;  4TR1 A;  4ZB8 A;  3EYT A;  4POK A;  5G5F A;  5B8B A;  2QC7 A;  3TUE A;  2AJQ B;  2IMF A;  5KN0 A;  2IL3 A;  1VGL A;  5E59 A;  1TU7 A;  2VCZ A;  1ZYE A;  1TK8 B;  3DA3 A;  4G75 A;  4JRR A;  2XPD A;  4CY8 A;  2GSR A;  2V2G A;  3CXG A;  5ECP B;  2ZRR A;  2H01 A;  1N8J A;  4WXT A;  3LWA A;  4BPY A;  2YZH A;  3F4T A;  4NMU A;  2IP6 A;  2H30 A;  4YH2 A;  2X8H A;  1AQW A;  1I5G A;  3AJF A;  3TRP A;  2R5G A;  2BJX A;  1UN2 A;  1GTI A;  4F2I A;  3ZFL A;  4OO4 A;  4Q9V A;  2OA7 A;  3GYK A;  3DVX A;  2VLT A;  3LQ7 A;  4LL1 B;  2F8A A;  1GLQ A;  1GTU A;  1M2B A;  1GLP A;  4X43 A;  3IK7 A;  1G6Y A;  2YNX A;  4GXZ A;  4K5S A;  1AIU A;  4KND A;  1MDK A;  1QMV A;  5CRD A;  2FLS A;  4MF5 A;  2H74 A;  3KZQ A;  3FYG A;  3KIJ A;  3ZML A;  1EP8 A;  1PN0 A;  4I97 A;  3F9U A;  4K0N A;  1GSQ A;  3HZ4 A;  1U5K A;  1K0N A;  1QXH A;  4O92 A;  5JWO B;  3BBY A;  3VWV A;  4FIW A;  4NWY A;  4IJ3 A;  2I4A A;  3FVV A;  4X4J A;  4Q5R A;  3FEU A;  4EXJ A;  2H1G A;  1K3L A;  1B9Y C;  2C3N A;  1DSB A;  4XS4 A;  2KUC A;  3UVH A;  2NPB A;  2VM1 A;  2O85 A;  5G1L A;  1NW2 A;  4ZBA A;  5CNW A;  2H76 A;  2E0Q A;  2R4V A;  4KGI A;  5IMA A;  3R2Q A;  1WE0 A;  5IQY A;  3IDV A;  1GNW A;  4G19 A;  3A5I A;  4RI7 A;  4KA0 A;  2RM6 A;  1G0T A;  1YKC A;  3CSI A;  2MMO A;  2OJL A;  4JU5 A;  2FA8 A;  1ON4 A;  2GSS A;  4PL4 A;  3GX0 A;  2KKM A;  4MJA A;  4JCV E;  4IHU A;  1XG8 A;  2FD3 A;  1RK4 A;  1BAY A;  1WWJ A;  4NPB A;  3LGC A;  1XW9 A;  3KP9 A;  1SD9 A;  3ZRD A;  5GST A;  1FHE A;  3RHC A;  3ZRE A;  4HUA A;  4Q5F A;  4MCU A;  4WF4 A;  2L4Q A;  5IPH A;  3CQF A;  2YJH A;  3FBV A;  1VRS D;  2H19 A;  3UMA A;  4PNF A;  3GUS A;  4J2F A;  5IM9 A;  1VF2 A;  3F8U A;  2GQK A;  1YDK A;  1TI1 A;  2CX4 A;  4IS0 A;  3Q18 A;  5B8A A;  3FZ4 A;  5GAN D;  2BL8 A;  3ZIV A;  2RIO A;  2XC2 A;  4HZ2 A;  4ECJ A;  3IAS 1;  4KDU A;  2E2G A;  3DA4 A;  2DIZ A;  5GAP D;  2QZG A;  3MNG A;  1ACV A;  5KN2 A;  3UAR A;  3IAM 1;  2JB1 A;  1M3I A;  3GRX A;  4JE1 A;  1SK0 A;  4A5P A;  2JB2 A;  5CAX A;  3GTU B;  4Q5Q A;  4LMV A;  3WYW A;  1Q4J A;  2LRC A;  4XS6 A;  2GZY A;  1TDI A;  3NOF A;  2JZS A;  3RHB A;  14GS A;  3WGE A;  4POB A;  5AIV A;  2O7K A;  3KM6 A;  1XOA A;  2CVK A;  2MMA A;  2N5A A;  5COH A;  4KAE A;  4ZIJ A;  2PWJ A;  3LXT A;  4GSN A;  2GZZ A;  3GKX A;  1A24 A;  2JSY A;  4DSQ A;  16GS A;  3ERF A;  3ERG A;  1E2Y A;  2RII A;  2F3M A;  3SWL A;  4IP1 A;  4TR4 A;  2B5Y A;  1Q98 A;  4I1T A;  1X5E A;  2RAD A;  2RLI A;  3ZFB A;  2A2R A;  2H1A A;  2TIR A;  4WF5 A;  4U6R A;  4J57 E;  1H75 A;  3IC4 A;  1URM A;  2HXK A;  5ECM B;  3PIN A;  4WKW A;  1XBS A;  3F4S A;  1LU4 A;  3A5W A;  4WR4 A;  2H6Z A;  5D96 A;  5F07 A;  3I9V 1;  4ULX A;  2GTU A;  4NV2 A;  4TXV A;  3VUR A;  4MH3 A;  2P5R A;  4N10 A;  2MYG A;  5DQS A;  1QFN A;  5IO0 A;  4NAX A;  3VWU A;  1SL1 B;  3M8N A;  4K7O A;  2VD0 A;  1XWG A;  3ZIT A;  2YZU A;  1UVZ A;  2M46 A;  4I2T A;  4IJI A;  4X0X A;  2H0H A;  4K7I A;  2KOK A;  1O81 A;  4P3Y B;  4BVY A;  5ABR A;  3IR4 A;  1HNB A;  2YOI A;  3PH9 A;  2Z9S A;  1WRY A;  1S3R A;  3QAW A;  3H8Q A;  3L0I A;  2I9H A;  3TJB A;  3ZLP A;  2CAI A;  3F3R A;  2DC5 A;  3GST A;  3GNJ A;  3TRX A;  3LJ0 A;  1BJX A;  2H6Y A;  2VL9 A;  1SD8 A;  2VLU A;  2DJK A;  4GRF A;  2LNT A;  4BVX B;  2CZ2 A;  1OC8 A;  5ECN B;  1EOG A;  5LNK 1;  3LFL A;  2C8U A;  1X9M B;  1W89 A;  2VAF A;  4WBJ A;  2O8V B;  2C3Q A;  2FEF A;  6GSW A;  3JSB A;  2CVD A;  1T4Y A;  2YWO A;  2PUK C;  1WP0 A;  1GWC A;  4IN0 A;  4MH2 A;  2QSI A;  2HZE A;  2V6O A;  3DEX A;  3IC8 A;  3DD3 A;  2C0G A;  3FRC A;  3APQ A;  1JZW A;  5H5S A;  4K1F A;  2C1Y A;  4KX4 A;  2LV3 A;  2OE0 A;  3KH9 A;  1X0R A;  1OE8 A;  2GSQ A;  3GH9 A;  4BL7 B;  5G30 A;  3WGD A;  1YF0 A;  4ZIL A;  3F4M A;  2M72 A;  1FVJ A;  4GWR A;  6GST A;  4OMV A;  2A2C A;  1AAZ A;  1TRW A;  3GL3 A;  5GZZ B;  3HVV A;  5FHI A;  1YF1 A;  4CDO A;  3DRN A;  1AXD A;  2FHE A;  3F63 A;  2QGV A;  3V1W A;  2EIQ A;  5DAL B;  2VCQ A;  3GL5 A;  2HE3 A;  2LQQ A;  2P31 A;  2X64 A;  2NBS A;  1SK1 A;  1TU8 A;  4V2N A;  3P8W A;  2PMT A;  2VCV A;  4POL A;  2I3Y A;  18GS A;  4ZL9 A;  2AHE A;  4I8B A;  1GSS A;  4OAV B;  2UZ8 A;  2R37 A;  1ERV A;  2YJ7 A;  4ZB9 A;  2ON7 A;  2GZP A;  3DXB A;  5KEJ A;  2MBS A;  2VCT A;  2C0D A;  2NVL A;  3OR5 A;  2OAD A;  4AF2 A;  1M9B A;  3HA9 A;  3APS A;  4POM A;  2PN8 A;  2GS3 A;  4Z2T A;  3MYD A;  2H73 A;  3LEF A;  1KEB A;  1V40 A;  2HT9 A;  1SJI A;  4G0L A;  1YZX A;  3IBH A;  2F9S A;  2FU2 A;  2DSA A;  5D73 A;  2IFQ B;  5CRE A;  3P7X A;  2YWN A;  3HZ8 A;  4MJE A;  4NHZ A;  3IE3 A;  1TI3 A;  4TR0 A;  3HYP A;  2DML A;  1KBN A;  1OC9 B;  2NTO A;  1E6B A;  4XRD A;  2B7J A;  4WET A;  1CQH A;  2YWM A;  1OE7 A;  1XCC A;  2DIY A;  2HI7 A;  2YP6 A;  2ZCT A;  4HS1 A;  5H5R A;  2B7K A;  1EOH A;  3TKS C;  2FNO A;  4G2E A;  1Y25 A;  2L4C A;  5ENU A;  3IHG A;  2JBW A;  2L6D A;  4MZC A;  3L9S A;  1OYJ A;  2R3X A;  4MP4 A;  1RW1 A;  4OFM A;  3D21 A;  4EO3 A;  1W4V A;  2I81 A;  1SYR A;  1T4Z A;  3KP8 A;  2WB9 A;  3IV4 A;  4N0Z A;  3GTU A;  3TKP A;  2O89 A;  1NM3 A;  1FOH A;  2GDR A;  3FZ5 A;  4ECI A;  2GVP A;  2OAC A;  2EIR A;  1B9X C;  1TW9 A;  3LYK A;  4F0C A;  1R7H A;  2JB3 A;  4O1P A;  2OE1 A;  4K5R A;  4ML1 A;  3QMX A;  5D9W A;  3N9J A;  5A4W A;  3FW2 A;  4MPG A;  5DAK B;  4CW9 A;  2ETD A;  3DYR A;  4GQF A;  2GLR A;  3ERW A;  5JWQ B;  4WR5 A;  1PD2 1;  4V2L A;  1FG4 A;  1YO7 A;  4HEA 1;  5JCU A;  3KMO A;  1ZYQ B;  3L0H A;  4K2D A;  1PL1 A;  2YPM A;  5HR0 A;  2VD1 A;  4ISD A;  2AB6 A;  3A2V A;  2H0I A;  4IKH A;  4J56 E;  2L59 A;  2FCH A;  3U6V A;  1SKS B;  2RLD A;  4HU7 A;  4K9Z A;  4MDC A;  2C0F A;  4TVE A;  2B1L A;  2HZE B;  4FYC A;  1K0M A;  1USB A;  3VFI A;  1T3B A;  3TOU A;  5IO2 A;  2H70 A;  4KF9 A;  1QGV A;  3D22 A;  1THO A;  4RQX A;  1ZZY A;  1DUG A;  2CVB A;  4F0B A;  4ZXG A;  13GS A;  4GST A;  3P90 A;  17GS A;  4USS A;  2VUP A;  1SJ6 A;  3KGK A;  2WCI A;  1MDI A;  4LA1 A;  1F37 A;  3FR3 A;  3MSZ A;  5ECO B;  2PVQ A;  1Z3E A;  1U6T A;  1S3D A;  3DWV A;  1PL2 A;  5D9V A;  3IOS A;  2F51 A;  1T1V A;  1AUC A;  3H93 A;  3IPZ A;  4KUN A;  5CRH A;  1XZO A;  2FUG 1;  4EUY A;  4EC0 A;  5ID2 B;  2IJY A;  1X9W B;  5D9T A;  4MLY A;  3WGX A;  2HRF A;  1GUL A;  4JR6 A;  2FY6 A;  4BVX A;  2N5F A;  4L0W A;  4XIH A;  4X1U A;  4TKY A;  4DSS B;  3HJO A;  4O1O A;  4ZBD A;  1A8L A;  2LKU A;  2HSH A;  4L8E A;  1R4W A;  5JCG A;  1G6W A;  3KCM A;  4L0U A;  2LS5 A;  2HSY A;  1EGO A;  4BWS A;  5AGY A;  4YZC A;  3IK9 A;  1JFU A;  1M2D A;  2L1L B;  2DKH A;  5A4U A;  1J08 A;  4OO5 A;  1OAZ A;  3L78 A;  4V1A g;  4EL1 A;  3J7Y b;  1AQV A;  2AAW A;  5LNK e;  3WT2 A;  2QA1 A;  3BJ5 A;  2QA2 A;  2VCW A;  4BL7 A;  3TJK A;  2M80 A;  4KCA A;  5HFI A;  1PMT A;  2JL4 A;  5ELA A;  2WRT A;  4YZ9 A;  4H86 A;  5JWR B;  1BQ7 A;  1ZCP A;  4ILF A;  2CAQ A;  1O85 A;  4JBB A;  2QSB A;  5IOX A;  4I5Q A;  3EVI A;  4KE3 A;  3A2X A;  1XVQ A;  5DAL A;  1M7T A;  2ZNM A;  4PQ1 A;  4I2U A;  3RDW A;  3A2W A;  4YQU A;  3HJM A;  1BYE A;  5HGI A;  1ZGN A;  2K8S A;  1KTE A;  5J4U A;  3FMW A;  2X99 A;  3KEB A;  3WT1 A;  1H4O A;  3L9U A;  3S9F A;  4YKF A;  5FT3 A;  1ERT A;  3QAV A;  3E0U A;  2ON5 A;  2IIY A;  2WGR A;  2C80 A;  1FVK A;  1XWC A;  2B5X A;  4IBP A;  1N2A A;  3ME7 A;  5INY A;  4FQU A;  4XHM A;  4IQ1 A;  2P5Q A;  5G31 A;  2CT6 A;  2PU9 C;  2FWG A;  2REM A;  1M9A A;  4JED A;  3UAP A;  1K0A A;  4PTS A;  3MWH A;  2IME A;  4WBR D;  3HVX A;  1BG5 A;  3CRT A;  2CX3 A;  4OCF A;  4Z2U A;  3C73 A;  4ML6 A;  2VCX A;  2RUF A;  5HR2 A;  1EZK A;  1K0C A;  4RQR A;  3VI5 A;  2MZC A;  2IFQ A;  4MZW A;  2KP1 A;  2H75 A;  4DSR A;  2YFB A;  4AS2 A;  1O6J A;  3VWX A;  1SK2 A;  1JQO A;  4OFT A;  2LJA A;  1OC9 A;  1M0U A;  3GKN A;  1W3S A;  4EKZ A;  4QQ7 A;  1ZL9 A;  1T8E B;  5IOW A;  4D73 A;  3VA9 A;  2E2M A;  1ZOF A;  5BMU A;  2LNS A;  3EC3 A;  5EL8 A;  4ECC A;  2XPE A;  4PQI A;  2LQO A;  2V6E A;  2H71 A;  4PL3 A;  1V58 A;  1AW9 A;  3EIN A;  3KTB A;  1BED A;  5EPF A;  2LTK A;  1IYI A;  5A5K A;  1HD2 A;  4TOP A;  1TK0 B;  1X5D A;  1FAA A;  4EDY A;  4KDY A;  5F06 A;  1FB6 A;  2VL2 C;  2X8G A;  3ME8 A;  1TDP A;  4LMW A;  4MMM A;  3I43 A;  6GSY A;  2GQL A;  3O6T A;  3EMX A;  3MIX A;  4EE0 A;  2EIO A;  3M0F A;  2L57 A;  3QDN A;  5DQY A;  2A2P A;  3FHK A;  5DAK A;  3C71 A;  2VLV A;  3C7M A;  1EGR A;  1TXX A;  4NHW A;  1HYU A;  2R0C A;  4JR4 A;  1XWK A;  2WJU A;  3ZL5 A;  3TKR A;  1SKR B;  4YZD A;  3M1G A;  4QL7 A;  2LJK A;  5DCG A;  2JAE A;  4YKG A;  1MD4 A;  3DML A;  2G2Q A;  1AC1 A;  1U3A A;  3GSS A;  2ES7 A;  1XFL A;  2AYT A;  2VL3 A;  1S3C A;  2YV9 A;  5LD0 A;  11GS A;  1ST9 A;  3BOA A;  1QK8 A;  2LEG A;  1XW5 A;  2GT6 A;  3ZVJ D;  4TXO B;  1PGT A;  3M3M A;  2GGT A;  3K8N A;  3G7I A;  2YWI A;  1M2A A;  1VF3 A;  3LYP A;  2VIM A;  4IGJ A;  5F05 A;  4ID0 A;  2K6V A;  1K0B A;  1WJK A;  1XOB A;  4O32 A;  1A2J A;  3FR9 A;  4CY6 A;  4ZL7 A;  4GLT A;  5F8B A;  3D4T A;  3TCO A;  2IMI A;  6GSV A;  4K0G A;  3ZMK A;  1PA3 A;  3C1R A;  3GH6 A;  5CYY A;  5ECK B;  4NXI A;  5F0G A;  1F3A A;  3Q8D A;  4LL4 B;  3CYN A;  1WPI A;  4RUV A;  2WFC A;  3APO A;  2K18 A;  5ID2 A;  2PER A;  2L6C A;  5DCH A;  2YAN A;  3LW9 A;  10GS A;  1PN9 A;  2XBI A;  1FO5 A;  2OBK A;  5C00 A;  4DSS A;  4HOJ A;  5IIZ A;  2IN3 A;  3KJY A;  4E8E A;  1OC3 A;  3GKK A;  2B1K A;  4HU9 A;  3Q19 A;  3GIX A;  1A2M A;  1ZYN A;  1GSD A;  4DEJ A;  4Z7H A;  3TJF A;  4KB3 A;  6GSS A;  2A4H A;  4KSO A;  3TJJ A;  4JZQ A;  4ZL8 A;  1YQ1 A;  1GUH A;  1Y6E A;  2PGT A;  5B6M A;  5ECL B;  4V1A p;  2YCD A;  5JCW A;  5IMF A;  1ZYP A;  3QCP A;  3LJ1 A;  4Z7G A;  3TOT A;  3ISO A;  2LJR A;  3LJ2 A;  4FYB A;  2QGM A;  2YFA A;  4AJ8 A;  5CO3 A;  2V41 A;  3IRA A;  3W6G A;  4HZ4 A;  1X5C A;  1EEJ A;  3UOM A;  4GXT A;  1PKZ A;  1SU9 A;  4O5Q A;  3F0I A;  5BRT A;  1ERU A;  4D73 B;  3KTL A;  2F66 B;  2HRK A;  1R5P A;  1FW1 A;  3F4R A;  1K0O A;  2KHP A;  2XMX A;  5IMZ A;  4KW6 A;  2VL2 A;  4O7H A;  1AQX A;  2CQ9 A;  3WD6 A;  1B4P A;  1C72 A;  1EV9 A;  3O76 A;  3LSZ A;  5DDL A;  1GSE A;  4EIQ A;  1TP9 A;  5IMV A;  1LBK A;  4XRA A;  5HR1 A;  1OKD A;  3BCK A;  3TKQ A;  4GF0 A;  3QR6 A;  2YN1 A;  5KN1 A;  4PUF C;  2DBC A;  3QPM A;  3SBC A;  2JSZ A;  3UBL A;  5KOX A;  2CAZ B;  1PFO A;  2JZR A;  3ED3 A;  2LUS A;  3H1N A;  1M3J A; 
#chains in the Genus database with same CATH homology
 4PUR A;  3EU4 A;  1DBY A;  3GHA A;  1OVN A;  3HHV A;  4TR3 A;  2L5O A;  1ABA A;  1A8Y A;  5J41 A;  3D5J A;  4E8H A;  4HJM A;  3QFB C;  4N11 A;  4MAB A;  3UEM A;  4L5O A;  4Q5N A;  3CMI A;  1VF4 A;  1GSY A;  5FWG A;  2ZUP A;  4HFV A;  3E3E A;  5KN3 A;  1VF1 A;  5AIX A;  4YQV A;  2V1M A;  2AUV A;  1J0F A;  3HJP A;  2X4A A;  1TRU A;  3KXO A;  3UVT A;  3BCI A;  1DE1 A;  3TRQ A;  3GX8 A;  3E9J B;  4YAV A;  4I6X A;  4AJ6 A;  4F9Z A;  3ZZX A;  1KNG A;  7GSS A;  1JZD A;  3UIW A;  1NHY A;  2HYX A;  5ELG A;  3PGT A;  2FWH A;  1GUK A;  5ECR B;  4GSS A;  2HZF A;  4G0I A;  1EP7 A;  2R0G A;  5AN1 A;  2E8G A;  3IAS 2;  2L5L A;  4MJC A;  4KCE A;  3IXR A;  3TB2 A;  1V57 A;  4K6X A;  4HQS A;  3IAM 2;  4GCI A;  2V6K A;  2A2S A;  2H6X A;  3DKS A;  4EDZ A;  5B6N A;  4FH8 A;  2K9F A;  1RQM A;  2IWT A;  4K7N A;  4BWQ A;  3DO9 A;  3J7Y k;  5DJL A;  1XWA A;  1U87 A;  4MPF A;  3G7Y A;  1MD3 A;  3L4N A;  4XS1 A;  5GSS A;  1FOV A;  4MZB A;  2WDU A;  3EE2 A;  4PL5 A;  3HCZ A;  4WEY A;  2HRN A;  4K8M A;  3DIE A;  2X8C A;  4OCE A;  2JAD A;  4PUA A;  2C4J A;  1GTA A;  2J9H A;  3M9K A;  3NIV A;  3JCM L;  1MDJ A;  3LOR A;  4TXO A;  2G0F A;  1YKA A;  1SEN A;  1X9S B;  1UC7 A;  3IHQ A;  2LRT A;  3LJR A;  1QUW A;  1K0D A;  2H0G A;  3CSH A;  3ZIJ A;  2LST A;  4KDX A;  3ZVJ A;  1TRV A;  2JZT A;  5AIS A;  1TKD B;  3I9V 2;  3L9V A;  5ECS A;  3BD2 A;  1F3B A;  3O3T A;  3FK8 A;  4OD7 A;  2IPA A;  4F82 A;  4F03 A;  12GS A;  2PVO C;  1NHO A;  2A2D A;  3PR8 A;  2O87 A;  2B6M A;  4OWY A;  5G2Z A;  5J9B A;  3R3E A;  1PQN A;  3UL3 A;  4EVM A;  3TKS A;  1Z7P A;  1GRX A;  3TDG A;  1Z7R A;  2C3T A;  4AGS A;  4IVF A;  3DVW A;  4K2X A;  2QKE A;  4ECB A;  4G9H A;  1GSF A;  1WOU A;  2R2J A;  4PX1 A;  1Z6M A;  1XVW A;  2XTR A;  4GQC A;  3QOU A;  2V1C C;  4KSM A;  3GV1 A;  3TKS E;  1TJD A;  2PBJ A;  4MA9 A;  4RI6 A;  4TN8 A;  1Z5Y E;  1SKW B;  3FKF A;  2HNL A;  1TOF A;  2WUL A;  4FYU A;  5EVO A;  1MTC A;  2DJ2 A;  2OKA A;  1GH2 A;  4DVC A;  3CTF A;  1PKW A;  2MMN A;  2RUE A;  4Z2R A;  1EWX A;  4N0V A;  1J9B A;  1CQG A;  3KD0 A;  3QD9 A;  3KH7 A;  3TGZ A;  4MF6 A;  3VI7 A;  1JZR A;  1O8X A;  2BMX A;  2FWF A;  2LRN A;  1Z9H A;  4G0K A;  4N30 A;  5LCZ A;  5CRG A;  1XIY A;  1SJ8 A;  2P22 B;  3UJ1 A;  1R5A A;  2JAC A;  3G7J A;  3RAZ A;  5J5N A;  2NDO A;  2DJ3 A;  5D8I A;  4KH7 A;  3EWL A;  1O7U A;  5DJM A;  3CTG A;  5J9C A;  2IMD A;  5DBQ A;  2MBT A;  1XW6 A;  1B4Q A;  4ACS A;  3HVS A;  3LG6 A;  3P2A A;  3VK9 A;  2HSM A;  2JU5 A;  2K8V A;  1GSU A;  5DVB A;  4O5R A;  1YEX A;  4PNG A;  4EF0 A;  4TR1 B;  1T7P B;  3HD5 A;  4IQA A;  4HQZ A;  4IP6 A;  1JLV A;  3HXS A;  4PXO A;  2DJJ A;  3GA4 A;  4QL9 A;  1S3A A;  8GSS A;  2D2Z A;  5ECI B;  3H4K A;  1GUM A;  4MNN A;  1PSQ A;  1ILO A;  2DMM A;  3Q74 A;  3SDJ A;  3D0Z A;  2TRX A;  3CBU A;  1EV4 A;  2AV4 A;  1V9W A;  4ZB6 A;  2XHF A;  1LJR A;  2DJ1 A;  1HNC A;  1GNE A;  2BTO T;  3Q6O A;  2C0E A;  2VOC A;  1PX7 A;  2H8L A;  4Z7X A;  3MDK A;  4GTU A;  1HQO A;  2E7P A;  1T00 A;  1JZO A;  3EU3 A;  2FGX A;  1Z6N A;  4HJ2 A;  1EEM A;  4AS3 A;  2F6M B;  4MF7 A;  2J23 A;  4XTS A;  3F3Q A;  1K3Y A;  1GTB A;  1A2L A;  1O73 A;  2XBQ A;  1QQ2 A;  3ZYW A;  5CP1 A;  2F8F A;  4IW9 A;  2H1D A;  2H1B A;  4EIP A;  5IMD A;  3P23 A;  1F6M C;  2RM5 A;  3FZ9 A;  4PQH A;  2H72 A;  1TRS A;  3NZN A;  4XS4 B;  3GFK A;  5IMC A;  1O8W A;  4MJB A;  4ICY A;  4MK3 A;  5IPG A;  2HRA A;  3FZA A;  2V32 A;  3RPN A;  1SJZ A;  1TTZ A;  3EUR A;  2GQM A;  1NSW A;  3MAK A;  2YV7 A;  2X49 A;  1U3I A;  3C1S A;  2TRC P;  1B48 A;  5ECH B;  3QFA C;  1OKT A;  4OAU C;  1U88 A;  3N5O A;  4HEA 2;  1XXU A;  1BX9 A;  5KOW A;  3FY7 A;  3VPT A;  3QAG A;  2MJF B;  2OBI A;  1A23 A;  4DWL A;  2EC4 A;  1YEP A;  2WZ9 A;  2IMK A;  1IYH A;  3GKM A;  4CHS A;  4G76 A;  1JHB A;  1SL2 B;  3GN3 A;  1A0R P;  4AJ7 A;  1WMJ A;  1ERW A;  1GL8 A;  4YQM A;  1WIK A;  1GP1 A;  3H79 A;  1ZMA A;  6GSU A;  3F6F A;  1XPV A;  5G1K A;  3KMN A;  3U5R E;  3FR6 A;  3LXZ A;  1JLW A;  2K19 A;  1SYX A;  3W8S A;  2B5E A;  4O5U A;  4FO5 A;  4ZBB A;  4LLR A;  5D9X A;  1PX6 A;  2PPT A;  2HLS A;  3G9B A;  3CRU A;  1F2E A;  3EMP A;  1K3O A;  1PRX A;  19GS A;  2I1U A;  3D4M A;  5HFK A;  3I69 A;  3AY8 A;  1HNA A;  4V2M A;  4PGT A;  2OE3 A;  5HR3 A;  3M9J A;  2FWE A;  2B3S A;  4HDE A;  3VWW A;  1G7E A;  5A4V A;  5B7C A;  1TK5 B;  3W8J A;  1FB0 A;  1XWB A;  5D93 A;  3A3T A;  5J3R A;  2A4V A;  2FUG 2;  2KP2 A;  2GT5 A;  4L5L A;  1F9M A;  2N5B A;  1YY7 A;  1UA5 A;  1R26 A;  3PPU A;  5EY6 A;  9GSS A;  1SL0 B;  3TJG A;  1DE2 A;  2CV4 A;  2VO4 A;  2ALB A;  2DLX A;  2R6K A;  5L71 A;  3C8E A;  1A0F A;  2DKI A;  5H5Q A;  3I6A A;  3VPQ A;  2CZ3 A;  1MEK A;  1G7O A;  2HFD A;  4YAP A;  2P0G A;  4TRX A;  1YJ6 A;  4BA7 A;  3GMF A;  3HDC A;  2XTQ A;  3D6I A;  1ML6 A;  4OFN A;  1V2A A;  5G5E A;  5C04 A;  5HQP A;  5CRW A;  1I9D A;  1B8X A;  3IA1 A;  4HI7 A;  3US3 A;  4TW5 A;  2VM2 A;  1THX A;  4IEL A;  3F6D A;  4BVY B;  2R0P A;  1V98 A;  3VLN A;  3ZTL A;  2CA8 A;  2GST A;  2H66 A;  22GS A;  2KLX A;  1M99 A;  4XCS A;  4NV5 A;  3RBT A;  2DJ0 A;  20GS A;  3CSJ A;  3GUR A;  3HY2 A;  5E4W A;  6GSX A;  3UBK A;  3HKR A;  5ECQ B;  3RPP A;  3DGQ A;  2WS2 A;  4G10 A;  3EPT A;  2MMZ A;  3UIT A;  5HFG A;  2FA4 A;  4TR1 A;  4ZB8 A;  3EYT A;  4POK A;  5G5F A;  5B8B A;  2QC7 A;  3TUE A;  2AJQ B;  2IMF A;  5KN0 A;  2IL3 A;  1VGL A;  5E59 A;  1TU7 A;  2VCZ A;  1ZYE A;  1TK8 B;  3DA3 A;  4G75 A;  4JRR A;  2XPD A;  4CY8 A;  2GSR A;  2V2G A;  3CXG A;  5ECP B;  2ZRR A;  2H01 A;  1N8J A;  4WXT A;  3LWA A;  4BPY A;  2YZH A;  3F4T A;  4NMU A;  2IP6 A;  2H30 A;  4YH2 A;  2X8H A;  1AQW A;  1I5G A;  3AJF A;  3TRP A;  2R5G A;  2BJX A;  1UN2 A;  1GTI A;  4F2I A;  3ZFL A;  4OO4 A;  4Q9V A;  2OA7 A;  3GYK A;  3DVX A;  2VLT A;  3LQ7 A;  4LL1 B;  2F8A A;  1GLQ A;  1GTU A;  1M2B A;  1GLP A;  4X43 A;  3IK7 A;  1G6Y A;  2YNX A;  4GXZ A;  4K5S A;  1AIU A;  4KND A;  1MDK A;  1QMV A;  5CRD A;  2FLS A;  4MF5 A;  2H74 A;  3KZQ A;  3FYG A;  3KIJ A;  3ZML A;  1EP8 A;  1PN0 A;  4I97 A;  3F9U A;  4K0N A;  1GSQ A;  3HZ4 A;  1U5K A;  1K0N A;  1QXH A;  4O92 A;  5JWO B;  3BBY A;  3VWV A;  4FIW A;  4NWY A;  4IJ3 A;  2I4A A;  4X4J A;  4Q5R A;  3FEU A;  4EXJ A;  2H1G A;  1K3L A;  1B9Y C;  2C3N A;  1DSB A;  4XS4 A;  2KUC A;  3UVH A;  2NPB A;  2VM1 A;  2O85 A;  5G1L A;  1NW2 A;  4ZBA A;  5CNW A;  2H76 A;  2E0Q A;  2R4V A;  4KGI A;  5IMA A;  3R2Q A;  1WE0 A;  5IQY A;  3IDV A;  1GNW A;  4G19 A;  3A5I A;  4RI7 A;  4KA0 A;  2RM6 A;  1G0T A;  1YKC A;  3CSI A;  2MMO A;  2OJL A;  4JU5 A;  2FA8 A;  1ON4 A;  2GSS A;  4PL4 A;  3GX0 A;  2KKM A;  4MJA A;  4JCV E;  4IHU A;  2FD3 A;  1RK4 A;  1BAY A;  1WWJ A;  4NPB A;  3LGC A;  1XW9 A;  3KP9 A;  1SD9 A;  3ZRD A;  5GST A;  1FHE A;  3RHC A;  3ZRE A;  4HUA A;  4Q5F A;  4MCU A;  4WF4 A;  2L4Q A;  5IPH A;  2YJH A;  3FBV A;  1VRS D;  2H19 A;  3UMA A;  4PNF A;  3GUS A;  4J2F A;  5IM9 A;  1VF2 A;  3F8U A;  2GQK A;  1YDK A;  1TI1 A;  2CX4 A;  4IS0 A;  3Q18 A;  5B8A A;  3FZ4 A;  5GAN D;  3ZIV A;  2RIO A;  2XC2 A;  4HZ2 A;  4ECJ A;  3IAS 1;  4KDU A;  2E2G A;  3DA4 A;  2DIZ A;  5GAP D;  3MNG A;  1ACV A;  5KN2 A;  3UAR A;  3IAM 1;  2JB1 A;  3GRX A;  4JE1 A;  1SK0 A;  4A5P A;  2JB2 A;  5CAX A;  3GTU B;  4Q5Q A;  4LMV A;  3WYW A;  1Q4J A;  2LRC A;  4XS6 A;  2GZY A;  1TDI A;  3NOF A;  2JZS A;  3RHB A;  14GS A;  3WGE A;  4POB A;  5AIV A;  2O7K A;  3KM6 A;  1XOA A;  2CVK A;  2MMA A;  2N5A A;  5COH A;  4KAE A;  4ZIJ A;  2PWJ A;  3LXT A;  4GSN A;  2GZZ A;  3GKX A;  1A24 A;  2JSY A;  4DSQ A;  16GS A;  3ERF A;  3ERG A;  1E2Y A;  2RII A;  2F3M A;  3SWL A;  4IP1 A;  4TR4 A;  2B5Y A;  1Q98 A;  4I1T A;  1X5E A;  2RLI A;  3ZFB A;  2A2R A;  2H1A A;  2TIR A;  4WF5 A;  4U6R A;  4J57 E;  1H75 A;  3IC4 A;  1URM A;  2HXK A;  5ECM B;  3PIN A;  4WKW A;  1XBS A;  3F4S A;  1LU4 A;  3A5W A;  4WR4 A;  2H6Z A;  5D96 A;  5F07 A;  3I9V 1;  4ULX A;  2GTU A;  4NV2 A;  4TXV A;  3VUR A;  4MH3 A;  2P5R A;  4N10 A;  2MYG A;  5DQS A;  1QFN A;  5IO0 A;  4NAX A;  3VWU A;  1SL1 B;  3M8N A;  4K7O A;  2VD0 A;  1XWG A;  3ZIT A;  2YZU A;  1UVZ A;  2M46 A;  4I2T A;  4IJI A;  4X0X A;  2H0H A;  4K7I A;  2KOK A;  1O81 A;  4P3Y B;  4BVY A;  5ABR A;  3IR4 A;  1HNB A;  2YOI A;  3PH9 A;  2Z9S A;  1WRY A;  3QAW A;  3H8Q A;  3L0I A;  2I9H A;  3TJB A;  3ZLP A;  2CAI A;  3F3R A;  2DC5 A;  3GST A;  3GNJ A;  3TRX A;  3LJ0 A;  1BJX A;  2H6Y A;  2VL9 A;  1SD8 A;  2VLU A;  2DJK A;  4GRF A;  2LNT A;  4BVX B;  2CZ2 A;  1OC8 A;  5ECN B;  1EOG A;  5LNK 1;  3LFL A;  2C8U A;  1X9M B;  1W89 A;  2VAF A;  4WBJ A;  2O8V B;  2C3Q A;  6GSW A;  3JSB A;  2CVD A;  1T4Y A;  2YWO A;  2PUK C;  1WP0 A;  1GWC A;  4IN0 A;  4MH2 A;  2QSI A;  2HZE A;  2V6O A;  3DEX A;  3IC8 A;  3DD3 A;  2C0G A;  3FRC A;  3APQ A;  1JZW A;  5H5S A;  4K1F A;  2C1Y A;  4KX4 A;  2LV3 A;  2OE0 A;  3KH9 A;  1X0R A;  1OE8 A;  2GSQ A;  3GH9 A;  4BL7 B;  5G30 A;  3WGD A;  1YF0 A;  4ZIL A;  3F4M A;  2M72 A;  1FVJ A;  4GWR A;  6GST A;  4OMV A;  2A2C A;  1AAZ A;  1TRW A;  3GL3 A;  5GZZ B;  3HVV A;  5FHI A;  1YF1 A;  4CDO A;  3DRN A;  1AXD A;  2FHE A;  3F63 A;  2QGV A;  3V1W A;  2EIQ A;  5DAL B;  2VCQ A;  3GL5 A;  2HE3 A;  2LQQ A;  2P31 A;  2X64 A;  2NBS A;  1SK1 A;  1TU8 A;  4V2N A;  3P8W A;  2PMT A;  2VCV A;  4POL A;  2I3Y A;  18GS A;  4ZL9 A;  2AHE A;  4I8B A;  1GSS A;  4OAV B;  2UZ8 A;  2R37 A;  1ERV A;  2YJ7 A;  4ZB9 A;  2ON7 A;  2GZP A;  3DXB A;  5KEJ A;  2MBS A;  2VCT A;  2C0D A;  2NVL A;  3OR5 A;  2OAD A;  4AF2 A;  1M9B A;  3HA9 A;  3APS A;  4POM A;  2PN8 A;  2GS3 A;  4Z2T A;  3MYD A;  2H73 A;  3LEF A;  1KEB A;  1V40 A;  2HT9 A;  1SJI A;  4G0L A;  1YZX A;  3IBH A;  2F9S A;  2DSA A;  5D73 A;  2IFQ B;  5CRE A;  3P7X A;  2YWN A;  3HZ8 A;  4MJE A;  4NHZ A;  3IE3 A;  1TI3 A;  4TR0 A;  3HYP A;  2DML A;  1KBN A;  1OC9 B;  2NTO A;  1E6B A;  4XRD A;  2B7J A;  4WET A;  1CQH A;  2YWM A;  1OE7 A;  1XCC A;  2DIY A;  2HI7 A;  2YP6 A;  2ZCT A;  4HS1 A;  5H5R A;  2B7K A;  1EOH A;  3TKS C;  2FNO A;  4G2E A;  1Y25 A;  2L4C A;  5ENU A;  3IHG A;  2L6D A;  4MZC A;  3L9S A;  1OYJ A;  2R3X A;  4MP4 A;  1RW1 A;  4OFM A;  3D21 A;  4EO3 A;  1W4V A;  2I81 A;  1SYR A;  1T4Z A;  3KP8 A;  2WB9 A;  3IV4 A;  4N0Z A;  3GTU A;  3TKP A;  2O89 A;  1NM3 A;  1FOH A;  2GDR A;  3FZ5 A;  4ECI A;  2GVP A;  2OAC A;  2EIR A;  1B9X C;  1TW9 A;  3LYK A;  4F0C A;  1R7H A;  2JB3 A;  4O1P A;  2OE1 A;  4K5R A;  4ML1 A;  3QMX A;  5D9W A;  3N9J A;  5A4W A;  3FW2 A;  4MPG A;  5DAK B;  4CW9 A;  3DYR A;  4GQF A;  2GLR A;  3ERW A;  5JWQ B;  4WR5 A;  1PD2 1;  4V2L A;  1FG4 A;  1YO7 A;  4HEA 1;  5JCU A;  3KMO A;  1ZYQ B;  3L0H A;  4K2D A;  1PL1 A;  2YPM A;  5HR0 A;  2VD1 A;  4ISD A;  2AB6 A;  3A2V A;  2H0I A;  4IKH A;  4J56 E;  2L59 A;  2FCH A;  3U6V A;  1SKS B;  4HU7 A;  4K9Z A;  4MDC A;  2C0F A;  4TVE A;  2B1L A;  2HZE B;  4FYC A;  1K0M A;  1USB A;  3VFI A;  1T3B A;  3TOU A;  5IO2 A;  2H70 A;  4KF9 A;  1QGV A;  3D22 A;  1THO A;  4RQX A;  1ZZY A;  1DUG A;  2CVB A;  4F0B A;  4ZXG A;  13GS A;  4GST A;  3P90 A;  17GS A;  4USS A;  2VUP A;  1SJ6 A;  3KGK A;  2WCI A;  1MDI A;  4LA1 A;  1F37 A;  3FR3 A;  3MSZ A;  5ECO B;  2PVQ A;  1Z3E A;  1U6T A;  1S3D A;  3DWV A;  1PL2 A;  5D9V A;  3IOS A;  2F51 A;  1T1V A;  1AUC A;  3H93 A;  3IPZ A;  4KUN A;  5CRH A;  1XZO A;  2FUG 1;  4EUY A;  4EC0 A;  5ID2 B;  2IJY A;  1X9W B;  5D9T A;  4MLY A;  3WGX A;  2HRF A;  1GUL A;  4JR6 A;  2FY6 A;  4BVX A;  2N5F A;  4L0W A;  4XIH A;  4X1U A;  4TKY A;  4DSS B;  3HJO A;  4O1O A;  4ZBD A;  1A8L A;  2LKU A;  2HSH A;  4L8E A;  1R4W A;  5JCG A;  1G6W A;  3KCM A;  4L0U A;  2LS5 A;  2HSY A;  1EGO A;  4BWS A;  5AGY A;  4YZC A;  3IK9 A;  1JFU A;  1M2D A;  2L1L B;  2DKH A;  5A4U A;  4OO5 A;  1J08 A;  1OAZ A;  3L78 A;  4V1A g;  4EL1 A;  3J7Y b;  1AQV A;  2AAW A;  5LNK e;  3WT2 A;  2QA1 A;  3BJ5 A;  2QA2 A;  2VCW A;  4BL7 A;  3TJK A;  2M80 A;  4KCA A;  5HFI A;  1PMT A;  2JL4 A;  5ELA A;  2WRT A;  4YZ9 A;  4H86 A;  5JWR B;  1BQ7 A;  1ZCP A;  4ILF A;  2CAQ A;  1O85 A;  4JBB A;  5IOX A;  4I5Q A;  3EVI A;  4KE3 A;  3A2X A;  1XVQ A;  5DAL A;  1M7T A;  2ZNM A;  4PQ1 A;  4I2U A;  3RDW A;  3A2W A;  4YQU A;  3HJM A;  1BYE A;  5HGI A;  1ZGN A;  2K8S A;  1KTE A;  5J4U A;  3FMW A;  2X99 A;  3KEB A;  3WT1 A;  1H4O A;  3L9U A;  3S9F A;  4YKF A;  5FT3 A;  1ERT A;  3QAV A;  3E0U A;  2ON5 A;  2IIY A;  2WGR A;  2C80 A;  1FVK A;  1XWC A;  2B5X A;  4IBP A;  1N2A A;  3ME7 A;  5INY A;  4FQU A;  4XHM A;  4IQ1 A;  2P5Q A;  5G31 A;  2CT6 A;  2PU9 C;  2FWG A;  2REM A;  1M9A A;  4JED A;  3UAP A;  1K0A A;  4PTS A;  3MWH A;  2IME A;  4WBR D;  3HVX A;  1BG5 A;  3CRT A;  2CX3 A;  4OCF A;  4Z2U A;  3C73 A;  4ML6 A;  2VCX A;  2RUF A;  5HR2 A;  1EZK A;  1K0C A;  4RQR A;  3VI5 A;  2MZC A;  2IFQ A;  4MZW A;  2KP1 A;  2H75 A;  4DSR A;  2YFB A;  4AS2 A;  1O6J A;  3VWX A;  1SK2 A;  4OFT A;  2LJA A;  1OC9 A;  1M0U A;  3GKN A;  1W3S A;  4EKZ A;  4QQ7 A;  1ZL9 A;  1T8E B;  5IOW A;  4D73 A;  3VA9 A;  2E2M A;  1ZOF A;  5BMU A;  2LNS A;  3EC3 A;  5EL8 A;  4ECC A;  2XPE A;  4PQI A;  2LQO A;  2V6E A;  2H71 A;  4PL3 A;  1V58 A;  1AW9 A;  3EIN A;  3KTB A;  1BED A;  5EPF A;  2LTK A;  1IYI A;  5A5K A;  1HD2 A;  4TOP A;  1TK0 B;  1X5D A;  1FAA A;  4EDY A;  4KDY A;  5F06 A;  1FB6 A;  2VL2 C;  2X8G A;  3ME8 A;  4LMW A;  4MMM A;  3I43 A;  6GSY A;  2GQL A;  3O6T A;  3EMX A;  3MIX A;  4EE0 A;  2EIO A;  3M0F A;  2L57 A;  3QDN A;  5DQY A;  2A2P A;  3FHK A;  5DAK A;  3C71 A;  2VLV A;  3C7M A;  1EGR A;  1TXX A;  4NHW A;  1HYU A;  2R0C A;  4JR4 A;  1XWK A;  2WJU A;  3ZL5 A;  3TKR A;  1SKR B;  4YZD A;  3M1G A;  4QL7 A;  2LJK A;  5DCG A;  2JAE A;  4YKG A;  1MD4 A;  3DML A;  2G2Q A;  1AC1 A;  1U3A A;  3GSS A;  2ES7 A;  1XFL A;  2AYT A;  2VL3 A;  1S3C A;  2YV9 A;  5LD0 A;  11GS A;  1ST9 A;  3BOA A;  1QK8 A;  2LEG A;  1XW5 A;  2GT6 A;  3ZVJ D;  4TXO B;  1PGT A;  3M3M A;  2GGT A;  3K8N A;  3G7I A;  2YWI A;  1M2A A;  1VF3 A;  3LYP A;  2VIM A;  4IGJ A;  5F05 A;  4ID0 A;  2K6V A;  1K0B A;  1WJK A;  1XOB A;  4O32 A;  1A2J A;  3FR9 A;  4CY6 A;  4ZL7 A;  4GLT A;  5F8B A;  3D4T A;  3TCO A;  2IMI A;  6GSV A;  4K0G A;  3ZMK A;  1PA3 A;  3C1R A;  3GH6 A;  5CYY A;  5ECK B;  4NXI A;  5F0G A;  1F3A A;  3Q8D A;  4LL4 B;  3CYN A;  1WPI A;  4RUV A;  2WFC A;  3APO A;  2K18 A;  5ID2 A;  2PER A;  2L6C A;  5DCH A;  2YAN A;  3LW9 A;  10GS A;  1PN9 A;  2XBI A;  1FO5 A;  2OBK A;  5C00 A;  4DSS A;  4HOJ A;  5IIZ A;  2IN3 A;  3KJY A;  4E8E A;  1OC3 A;  3GKK A;  2B1K A;  4HU9 A;  3Q19 A;  3GIX A;  1A2M A;  1ZYN A;  1GSD A;  4DEJ A;  4Z7H A;  3TJF A;  4KB3 A;  6GSS A;  2A4H A;  4KSO A;  3TJJ A;  4JZQ A;  4ZL8 A;  1YQ1 A;  1GUH A;  1Y6E A;  2PGT A;  5B6M A;  5ECL B;  4V1A p;  2YCD A;  5JCW A;  5IMF A;  1ZYP A;  3QCP A;  4Z7G A;  3LJ1 A;  3TOT A;  3ISO A;  2LJR A;  3LJ2 A;  4FYB A;  2YFA A;  4AJ8 A;  5CO3 A;  2V41 A;  3IRA A;  3W6G A;  4HZ4 A;  1X5C A;  1EEJ A;  3UOM A;  4GXT A;  1PKZ A;  1SU9 A;  4O5Q A;  3F0I A;  5BRT A;  1ERU A;  4D73 B;  3KTL A;  2F66 B;  2HRK A;  1R5P A;  1FW1 A;  3F4R A;  1K0O A;  2KHP A;  2XMX A;  5IMZ A;  4KW6 A;  2VL2 A;  4O7H A;  1AQX A;  2CQ9 A;  3WD6 A;  1B4P A;  1C72 A;  1EV9 A;  3O76 A;  3LSZ A;  5DDL A;  1GSE A;  4EIQ A;  1TP9 A;  5IMV A;  1LBK A;  4XRA A;  5HR1 A;  1OKD A;  3BCK A;  3TKQ A;  4GF0 A;  3QR6 A;  2YN1 A;  5KN1 A;  4PUF C;  2DBC A;  3QPM A;  3SBC A;  2JSZ A;  3UBL A;  5KOX A;  2CAZ B;  2JZR A;  3ED3 A;  2LUS A;  3H1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...