4NV2A

C50a mutant of synechococcus vkor, c2221 crystal form
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
266
structure length
264
Chain Sequence
RHSRLILAILAGLGSLLTAYLTYTKLTEQPAAFATGDGGCDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPDPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPLEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VKORC1/thioredoxin domain protein
publication title Structures of an intramembrane vitamin K epoxide reductase homolog reveal control mechanisms for electron transfer.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Oxidoreductase
total genus 82
structure length 264
sequence length 266
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 4nv2A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nv2A02
2LNSA 1BQ7A 2L59A 4X1UA 5JWRB 2MBTA 2V6KA 5IMZA 3VPTA 1JZOA 1M9BA 2H75A 1ZZYA 3QAWA 1Q4JA 3KD0A 2RLIA 1PN9A 3FZ4A 5EVOA 2YWOA 2TRXA 4YH2A 2KP1A 3UBKA 4RQXA 2MBSA 2YWMA 2CAIA 1ZOFA 1R5AA 4KAEA 5ECIB 1GTAA 2CVBA 3F6FA 1XPVA 3P7XA 2CZ2A 1ACVA 2YNXA 3M9JA 4MF6A 3K8NA 5DALA 4GCIA 4ZXGA 2B5XA 3VK9A 1B48A 2O89A 2GZPA 4LL1B 1AUCA 5ECSA 2H0HA 1THXA 4O32A 3EURA 2BTOT 3ZRDA 2FLSA 1ML6A 1A8YA 5HFIA 2VCQA 2LQQA 3CSHA 4NV5A 5B6NA 2GDRA 5KN2A 3I9V2 5H5SA 2WFCA 1Z6NA 2KHPA 4XTSA 1WPIA 5HQPA 5G1KA 2N5FA 4ZL7A 4ML6A 5DQYA 4MF5A 4Z7XA 6GSWA 1ZL9A 4MJCA 5ECRB 18GSA 2CZ3A 3G7YA 4DSQA 3HJPA 1QMVA 2TRCP 5G30A 1TRSA 3RAZA 1AQXA 2B1KA 2YZHA 1SK2A 2YV9A 2B6MA 1FHEA 1XW6A 1GP1A 1K3YA 3TCOA 2EIRA 3UBLA 5IMVA 4AF2A 4TKYA 3QOUA 4LA1A 3CMIA 2F3MA 4MZBA 5IO0A 3CBUA 2HZFA 4I97A 4MCUA 1BG5A 3GTUB 3QFBC 4PNGA 1PRXA 1TJDA 4G10A 5J41A 4V2MA 4QQ7A 4JU5A 5DJMA 4MJAA 2XPDA 4IP1A 5J3RA 2JSZA 1FG4A 6GSVA 5KN0A 2L4QA 2DJ1A 4KDXA 2H6YA 3NZNA 4I8BA 2O87A 1XWBA 4IQ1A 2H01A 2C0EA 4DEJA 3EWLA 1JZDA 4O5RA 2WJUA 4GXZA 4I5QA 5IQYA 1KNGA 1EGRA 2ON5A 1K3LA 1K0MA 2GZYA 9GSSA 3IPZA 4IP6A 1A2MA 3HCZA 2VO4A 5CRGA 5J9CA 16GSA 5CRWA 1PMTA 1X9MB 1GSDA 2PMTA 4OWYA 2H8LA 3GH6A 3FR9A 2LJKA 4XS4A 1EV9A 1WE0A 1PX7A 4TVEA 4ULXA 1NW2A 1XVWA 2QC7A 4D73B 3FRCA 2LKUA 4OFNA 1XBSA 2H1BA 4N30A 1GSQA 5H5QA 3A5WA 1BAYA 4X43A 3KTBA 1GLQA 2CVDA 1BEDA 1GULA 1J08A 2IL3A 4NAXA 3U6VA 2R5GA 4GLTA 1ERWA 2H76A 4BVYA 5JCGA 3IV4A 5ECKB 1OVNA 1PQNA 5FHIA 2VCZA 4K7NA 3F4RA 4NHZA 3GKXA 4Q5RA 1O8WA 5INYA 1THOA 3TRXA 3VI5A 3PH9A 3WYWA 2NPBA 3ZIJA 4QL7A 4AJ6A 2A2SA 4EF0A 2ZNMA 1SU9A 2O7KA 1U3AA 5JWQB 1XZOA 2FNOA 1HD2A 2G0FA 2XBIA 4WR5A 4F82A 1ZCPA 1Z5YE 4AJ8A 3KXOA 4LMVA 2HXKA 1PSQA 3VLNA 3TRPA 1AAZA 5B8AA 3W8JA 5KN3A 1AQVA 3GV1A 1X5EA 2H72A 2C8UA 3ED3A 5HR0A 2CT6A 3LXZA 2VCTA 3KJYA 1B4QA 5DQSA 3TRQA 1E6BA 1WMJA 4IVFA 3I69A 5CRHA 1GLPA 2Z9SA 3TOUA 1MEKA 2L5LA 4ID0A 4HUAA 2DBCA 1O7UA 5GAPD 5ECQB 1VF1A 4TN8A 4ZILA 3C7MA 1EGOA 2AV4A 3P8WA 3EYTA 4G19A 1DSBA 2WGRA 3DD3A 2GZZA 1SK0A 2WB9A 3GTUA 1O8XA 4HZ4A 2LRTA 5D73A 1SYXA 4EDYA 2YP6A 5HFKA 2YV7A 3DGQA 3EE2A 5FWGA 3UJ1A 3GYKA 3TJJA 2OADA 4O7HA 3QMXA 1B8XA 1R26A 2BJXA 1U87A 2H6XA 4L8EA 4JR4A 2PBJA 1W89A 1YJ6A 2V6OA 4BL7A 4JZQA 5ID2A 1U3IA 4IKHA 5HFGA 3CSIA 4DSSA 3EC3A 3WGEA 5B8BA 4HEA2 3HDCA 3LQ7A 1NHOA 4CHSA 1EEMA 2N5AA 1QFNA 1Z7PA 1SD8A 3KIJA 2YJ7A 1H4OA 3HVXA 1MDJA 2QSIA 1X9SB 3OR5A 3FZ9A 1SL2B 1OYJA 2FD3A 1HNAA 1I5GA 2H19A 5AIXA 4D73A 4PUAA 4OCEA 2F8AA 3ZZXA 3FR6A 4WEYA 4TR3A 3VWWA 4MPGA 4RI7A 3HYPA 4GSNA 2X8CA 2C0DA 2F51A 1ZYQB 1R7HA 3DWVA 3KCMA 1VF3A 3H4KA 2EIQA 5D96A 3GN3A 4NV2A 5CO3A 5LNKe 2CVKA 4MMMA 4JBBA 2P31A 3Q74A 3QCPA 1XOAA 3FW2A 4K7IA 4NPBA 2ALBA 3TJFA 4V2NA 1KBNA 3QAVA 3FYGA 1XVQA 4PNFA 1GSEA 1A23A 3CTGA 1GNWA 3PGTA 2AYTA 4IGJA 5CYYA 5ABRA 2HT9A 4FO5A 3D4MA 4NWYA 4FYCA 3W8SA 1GSFA 1T1VA 3DYRA 3EVIA 2AJQB 1G7EA 5AGYA 3C1SA 4JRRA 2DIYA 3HD5A 2GLRA 1SKRB 3FKFA 3ZREA 3GA4A 4PUFC 3VWVA 2NDOA 4ECJA 5DAKA 2C80A 2IMFA 1WP0A 4KSOA 2YJHA 1OE8A 3TJGA 4XS4B 4POKA 3S9FA 1I9DA 3AY8A 1GUKA 3FHKA 4MF7A 2WRTA 3ZTLA 5EL8A 5IM9A 4YQMA 2LJRA 3ME7A 3F8UA 2I4AA 2H66A 1F2EA 3WT2A 2IFQA 2K8VA 2VAFA 1T3BA 2V32A 2F9SA 5G1LA 4KB3A 3UAPA 3ZL5A 2FWHA 1K0NA 2VL2A 3RBTA 5JWOB 19GSA 14GSA 4IJIA 2I1UA 1F37A 7GSSA 5DVBA 3F9UA 3UMAA 2ZCTA 3NIVA 3CSJA 4KDUA 2BMXA 1N2AA 5G5EA 4KW6A 1ERUA 3EMPA 1UA5A 1EEJA 4MK3A 5ECLB 2FWGA 4GSTA 3D5JA 3ZYWA 1TU8A 4IBPA 3QAGA 3ISOA 2OE0A 2K9FA 2YCDA 2XHFA 3LYPA 3FZ5A 4XCSA 1V57A 1B9YC 4KE3A 3TJBA 1SJZA 2GVPA 2CAQA 2E2GA 1WWJA 1A0RP 4KUNA 2K8SA 1HNBA 3LFLA 5C00A 1UC7A 1F9MA 1J9BA 1PX6A 1FAAA 5D8IA 5IMCA 1MTCA 3F4SA 1TKDB 2FCHA 4N0ZA 3ZIVA 4EO3A 3MWHA 4OMVA 2OE3A 2QKEA 1NHYA 2O85A 2OKAA 5HR2A 3VWUA 3A2XA 4V1Ap 2VOCA 1TK8B 4POMA 1ZMAA 4GQFA 1LBKA 2HSHA 1OC3A 1K0CA 2IN3A 3UVHA 3QDNA 1QGVA 3HVSA 2H30A 1A8LA 1XW9A 3EU3A 1K0OA 3GSTA 4N10A 1R5PA 1M2DA 4EE0A 3KGKA 4EUYA 3HKRA 3F3QA 2FUG2 3IA1A 5ECHB 4G2EA 1RQMA 1SYRA 2C3NA 4EVMA 3L9SA 3TJKA 5ID2B 5DDLA 3DEXA 1XXUA 4WF4A 4MABA 2K6VA 2VL3A 3HA9A 1DE2A 1GWCA 1SL1B 20GSA 5H5RA 4DSSB 3HHVA 2LRCA 5LCZA 1OKTA 2HNLA 4HU9A 1G7OA 1HYUA 1ST9A 4TRXA 3ZVJA 2A2RA 3IK7A 2YWNA 4PURA 4HS1A 2H71A 2YOIA 3FY7A 4MJBA 5F8BA 1NSWA 2HE3A 5GZZB 2X64A 1QXHA 3GIXA 1JLVA 3KTLA 3O3TA 4FYUA 4OCFA 4OFTA 3Q18A 1O85A 3BCKA 1MD4A 4TOPA 3TGZA 2FWFA 2VD1A 1XWCA 4HQZA 1QQ2A 1TI3A 4MA9A 4V2LA 4P3YB 3V1WA 3GSSA 2K18A 2VLTA 4J57E 3GNJA 1T4YA 2DSAA 1LU4A 2GQLA 3CXGA 1YDKA 5LD0A 4GSSA 4AGSA 3IXRA 2X99A 5D93A 5CP1A 4IQAA 2C0FA 2PUKC 1DUGA 2PVQA 4POLA 1VRSD 2LRNA 2FA8A 2PERA 2ON7A 2EC4A 2ZUPA 1T8EB 1XWKA 4CDOA 1G6YA 3KH7A 4TXOA 3BOAA 3L4NA 2CV4A 2IMIA 2DJ2A 6GSXA 3VFIA 4ZB6A 4IS0A 5DCGA 3HXSA 2M80A 2F8FA 4F2IA 4YAVA 4I6XA 3F4TA 1BX9A 1X9WB 3APSA 3M9KA 1FW1A 1LJRA 2WS2A 3FK8A 4MP4A 4MDCA 1AW9A 3APOA 4MZWA 3EU4A 2YPMA 2AAWA 1JHBA 1CQHA 4V1Ag 1X0RA 2JACA 3ERGA 2I3YA 4ML1A 1KTEA 5DAKB 3TKSE 2GQKA 4TXVA 1SENA 2DMLA 1CQGA 3KMNA 3LSZA 3DXBA 3I6AA 1A2LA 3LJRA 2PN8A 2GQMA 4F03A 3E9JB 1EZKA 5CRDA 1XIYA 1M0UA 1F6MC 1GRXA 1W4VA 3A2WA 2OE1A 5IPGA 5B6MA 2PGTA 1WOUA 1XWGA 2KLXA 1WJKA 1YY7A 2IFQB 3ERWA 5D9TA 3F0IA 3M0FA 1RK4A 1GTBA 2DJKA 4EC0A 2IIYA 4KGIA 4ECIA 5DCHA 3O6TA 3ZMLA 1U6TA 1VF4A 5IOXA 2VIMA 3IK9A 4WXTA 2P5QA 2D2ZA 2I81A 4JE1A 2P5RA 4Q5NA 2B5YA 2OACA 3ME8A 2IMEA 2RUEA 10GSA 1URMA 4ZIJA 2JADA 2R2JA 1XCCA 2KUCA 2P0GA 2VL9A 4YQUA 3QR6A 4HI7A 2RIIA 1TTZA 3F3RA 2AB6A 5A4WA 1GUMA 3TKSC 1FOVA 3MNGA 2L6CA 2GSTA 3VI7A 2XC2A 4J2FA 2JSYA 1MD3A 3WGXA 3PINA 5F05A 3QPMA 1WIKA 1SD9A 1NM3A 4K2DA 2C1YA 5G2ZA 1GSYA 3LEFA 3UARA 4LL4B 2C4JA 4WF5A 5G31A 1TW9A 1S3AA 4XIHA 4TW5A 1EOGA 3KH9A 8GSSA 2JZRA 2KOKA 2E2MA 2JL4A 2V2GA 4WKWA 1K0BA 2G2QA 5CREA 2REMA 3ZFLA 5KN1A 2L6DA 5A4VA 3BD2A 3N5OA 1TRUA 3GKMA 1OC9A 5EY6A 2VD0A 4XRAA 4DSRA 3IE3A 3ERFA 1KEBA 2CA8A 4PQ1A 2E0QA 5ENUA 1R4WA 1AQWA 3GL3A 4MH2A 1EV4A 2R37A 1FVKA 5ECNB 4WBJA 4BVXA 1A0FA 2V41A 4JEDA 3UIWA 3LYKA 3US3A 4TR1A 1ZGNA 2X8GA 2DC5A 3RHBA 3C71A 3HZ4A 1V58A 2MZCA 4EDZA 1JFUA 1K3OA 2FWEA 2VM1A 4CW9A 5L71A 4G9HA 3RPNA 11GSA 2GGTA 6GSUA 4GWRA 1A2JA 3GKKA 4MH3A 1O81A 4OO4A 3VURA 1U88A 4ECBA 2DMMA 1FVJA 3M3MA 2ES7A 1WRYA 2OJLA 1G6WA 2FY6A 2V1MA 3DMLA 4ZL9A 4MLYA 5F0GA 2HI7A 2FHEA 2MMAA 1C72A 4WETA 1TP9A 1XFLA 3CTFA 1IYHA 2DJ0A 1B9XC 1H75A 2MMOA 5AISA 3KEBA 6GSTA 2B5EA 2LTKA 1TK0B 3HY2A 5J9BA 3SBCA 2H74A 4I2TA 3VPQA 3TOTA 4EKZA 2YZUA 3IC4A 1SKSB 4L0WA 3I43A 3A3TA 3D21A 2C0GA 4TXOB 2JZTA 4HU7A 3ZVJD 1B4PA 3JCML 1EOHA 4KH7A 1YF1A 3KZQA 4ZB9A 5D9WA 1V98A 2WCIA 1TDIA 2B3SA 2H1DA 3A2VA 1M2AA 5D9XA 3EINA 5DJLA 5IOWA 3G7JA 4OD7A 3GX0A 4IELA 2WDUA 4HOJA 2WULA 3F6DA 5ECMB 3IBHA 2GT5A 2IPAA 3UOMA 4JR6A 1BJXA 3C1RA 3MDKA 1PKZA 2B7JA 4FYBA 2VCVA 2VCXA 2XBQA 1PA3A 3D0ZA 3G9BA 4LMWA 1GL8A 3LGCA 1F3AA 4RI6A 3ZFBA 5HR3A 3WGDA 4K0NA 1MDIA 3QD9A 5KEJA 5F06A 4LLRA 1V2AA 4GRFA 2GTUA 1XOBA 3WT1A 3O76A 3APQA 1M99A 2HZEA 1FB0A 3F63A 4K9ZA 4HDEA 1G0TA 2M72A 2A4VA 4O92A 1JZRA 4L0UA 2HFDA 1GSUA 1ON4A 2H73A 3NOFA 4WBRD 1AIUA 3DVWA 3PR8A 3DRNA 1ILOA 5HR1A 5C04A 2RM5A 3EMXA 3WD6A 2HRFA 1TU7A 3GURA 4OO5A 4GF0A 4E8HA 3TUEA 3ZITA 4MZCA 3GFKA 2OA7A 1YQ1A 3IAS2 4TR0A 2MMZA 1PKWA 4KSMA 5AN1A 3ZMKA 3MAKA 5CNWA 1Q98A 1EP7A 1YEPA 4ISDA 4KCEA 1TOFA 4GTUA 3MSZA 1AC1A 1EP8A 1M7TA 4FIWA 1A24A 1FO5A 4BA7A 1O73A 5GAND 4NHWA 5ELGA 3U5RE 5F07A 4MJEA 2GSQA 3BJ5A 3GUSA 1GH2A 5FT3A 3H79A 4ZBDA 3TKSA 3H1NA 2TIRA 1GTIA 2XPEA 3TKPA 3FEUA 3BBYA 3GX8A 2GS3A 3UL3A 1PL1A 1PL2A 5GSTA 4L5OA 3IRAA 1ABAA 2NBSA 4PX1A 3R2QA 4IN0A 3C8EA 2MYGA 3HZ8A 1S3CA 1J0FA 2X8HA 3Q6OA 4XRDA 3M8NA 1IYIA 3BCIA 3P2AA 3GHAA 12GSA 3GMFA 4F0BA 1T4ZA 1YKAA 4XS6A 3IHQA 1TK5B 4POBA 4EL1A 2FGXA 4I2UA 4ZBBA 4PXOA 3C73A 2LNTA 2L4CA 2LQOA 1YKCA 2IMDA 1RW1A 3CRUA 2DJJA 2MMNA 4WR4A 3E3EA 1XW5A 1Y25A 4N11A 2HSYA 2DLXA 3KP8A 2JZSA 2H70A 5IIZA 4KDYA 5IO2A 1YEXA 2B1LA 2GSRA 3LORA 3H8QA 1K0AA 2QGVA 2YN1A 2LUSA 1AXDA 1DE1A 1OC9B 1FB6A 5DBQA 1VGLA 13GSA 22GSA 4NXIA 2R3XA 2VLVA 2I9HA 2VL2C 2L5OA 3D4TA 4IW9A 2H0IA 3DVXA 3HJOA 5AIVA 1GUHA 2L57A 1V40A 2NVLA 4HJMA 2HRNA 5IMFA 4TR1B 1TRVA 3J7Yb 1ERTA 1OKDA 6GSYA 4GQCA 5ELAA 1S3DA 4HQSA 2C3QA 2CX3A 1JZWA 1GTUA 4IJ3A 5JCUA 17GSA 3LWAA 5EPFA 4QL9A 1XWAA 2CQ9A 4KA0A 2N5BA 4ZL8A 4J56E 4ECCA 2R4VA 6GSSA 4IHUA 3GH9A 3CRTA 2EIOA 3IDVA 4PGTA 3IOSA 1F3BA 2H0GA 5E59A 3TDGA 4RQRA 2GSSA 4XS1A 4BPYA 1Z3EA 3CYNA 3SWLA 1T7PB 3DIEA 2DIZA 5G5FA 2VM2A 2IWTA 1M9AA 1BYEA 1UN2A 1K0DA 2VCWA 3P90A 5D9VA 2RUFA 2HYXA 1OE7A 3L78A 1SJIA 1Z6MA 2YANA 2H1AA 4ACSA 2M46A 4AJ7A 1OC8A 2LV3A 4RUVA 3GKNA 1TXXA 4K7OA 4HZ2A 4Q5QA 1O6JA 3QFAC 4F0CA 4EXJA 2FA4A 2R6KA 4XHMA 2GT6A 3VWXA 2E7PA 4L5LA 2OBIA 1X5CA 2H1GA 1YF0A 5COHA 4PQIA 5A5KA 4PQHA 1TRWA 5IMDA 2YWIA 5CAXA 5DALB 4KX4A 4BWSA 2AUVA 4K6XA 2B7KA 3KMOA 2IMKA 1ERVA 1MDKA 1SJ6A 1Z9HA 3D6IA 5J4UA 1OAZA 3D22A 4MPFA 2RM6A 4HJ2A 1V9WA 1HNCA 2JU5A 4KCAA 1HQOA 2PVOC 2KP2A 4BWQA 1PGTA 3L9VA 1QK8A 3GRXA 4E8EA 5JCWA 5IPHA 2O8VB 3TKQA 1JLWA 2PWJA 4YQVA 3DKSA 3IR4A 1E2YA 2HZEB 3HJMA 2AHEA 2C3TA 1SL0B 2CX4A 3LG6A 1GNEA 3TKRA 3N9JA 3J7Yk 4ILFA 4K8MA 4NMUA 1USBA 4N0VA 3M1GA 4F9ZA 3RHCA 2LSTA 1N8JA 1ZYEA 4KNDA 3L0HA 1TI1A 5GSSA 2VUPA 1UVZA 3W6GA 4OFMA 1PD21 5ECOB 1Y6EA 3LXTA 3RPPA 3G7IA 2NTOA 3E0UA 3GL5A 5E4WA 4ZBAA 2LEGA 3RDWA 2LS5A 2WZ9A 2PPTA 3KM6A 2HLSA 4FH8A 2J23A 2IJYA 3KP9A 4X0XA 4H86A 2LJAA 5A4UA 1VF2A 1T00A 1YZXA 3HVVA 3UEMA 4YAPA 2H6ZA 2OBKA 1SK1A 2J9HA 3Q19A 1EWXA 2DJ3A 1DBYA 3TB2A 2PU9C 3UVTA 5J5NA 1GSSA 4K1FA 3IAM2 5ECPB 3FZAA 1QUWA 1Z7RA 4TR4A 3ZLPA 3L9UA 1SKWB 5B7CA 5IMAA 3FR3A 4DVCA 2VLUA 1X5DA 4Q5FA 4ZB8A 4K0GA 1M2BA 3H93A
chains in the Genus database with same CATH superfamily
2LNSA 1BQ7A 2L59A 2V1CC 4JCVE 4X1UA 5JWRB 2MBTA 2V6KA 5IMZA 3VPTA 1JZOA 1M9BA 2H75A 1ZZYA 3QAWA 4OAVB 1Q4JA 3KD0A 2RLIA 1PN9A 3LJ1A 4K5RA 3FZ4A 5EVOA 2YWOA 2TRXA 4YH2A 2KP1A 3UBKA 4G76A 4RQXA 2MBSA 2YWMA 2CAIA 1ZOFA 1R5AA 4KAEA 5ECIB 1GTAA 2CVBA 3F6FA 1XPVA 3P7XA 4GXTA 2A2CA 2CZ2A 1ACVA 2YNXA 3M9JA 4MF6A 3K8NA 5DALA 3I9V1 4GCIA 4ZXGA 4G75A 2B5XA 3VK9A 1B48A 2O89A 2GZPA 4LL1B 1AUCA 5ECSA 2P22B 2H0HA 1THXA 4O32A 3EURA 2BTOT 3ZRDA 2FLSA 1ML6A 1A8YA 5HFIA 2VCQA 2LQQA 3CSHA 4NV5A 5B6NA 2GDRA 5KN2A 3I9V2 2JB2A 5H5SA 2WFCA 1Z6NA 2KHPA 4XTSA 1WPIA 2F66B 5HQPA 5G1KA 2N5FA 4ZL7A 1JQOA 4ML6A 4Z7XA 4MF5A 5DQYA 6GSWA 1ZL9A 4MJCA 5ECRB 18GSA 2CZ3A 3G7YA 4DSQA 4I1TA 3HJPA 1QMVA 2TRCP 5G30A 1TRSA 4Z7GA 3RAZA 1AQXA 2B1KA 4PL3A 2YZHA 1SK2A 2YV9A 2B6MA 1FHEA 1XW6A 1GP1A 1K3YA 3TCOA 2EIRA 2MJFB 3UBLA 5IMVA 4AF2A 4TKYA 3QOUA 4LA1A 3CMIA 2F3MA 4MZBA 5IO0A 3CBUA 3FMWA 2HZFA 4I97A 4MCUA 1BG5A 2CAZB 3GTUB 3QFBC 4PNGA 1PRXA 1TJDA 4G10A 2QA1A 5J41A 4V2MA 4QQ7A 4JU5A 5DJMA 4MJAA 2XPDA 4IP1A 5J3RA 2JSZA 1FG4A 6GSVA 5KN0A 2JAEA 2A2PA 2L1LB 2L4QA 2DJ1A 4KDXA 2H6YA 4BL7B 3NZNA 4I8BA 3SDJA 2O87A 1XWBA 4IQ1A 2H01A 3PPUA 2C0EA 4DEJA 3EWLA 1JZDA 4O5RA 2WJUA 4GXZA 4I5QA 5IQYA 1KNGA 1EGRA 2ON5A 1K3LA 1K0MA 4PL4A 2GZYA 9GSSA 3IPZA 4IP6A 1ZYPA 1A2MA 3HCZA 2VO4A 5CRGA 5J9CA 16GSA 5CRWA 1PMTA 1X9MB 1GSDA 2PMTA 4OWYA 2H8LA 3GH6A 3FR9A 2LJKA 4XS4A 1EV9A 1WE0A 1PX7A 4TVEA 4ULXA 1NW2A 1XVWA 2QC7A 4D73B 3FRCA 2LKUA 4OFNA 1XBSA 2H1BA 4N30A 1GSQA 5H5QA 3A5WA 1BAYA 4X43A 3KTBA 1GLQA 2CVDA 1BEDA 1GULA 4U6RA 5LNK1 1J08A 2IL3A 4NAXA 3U6VA 2R5GA 4GLTA 1ERWA 4O5QA 2H76A 4BVYA 5JCGA 3IV4A 5ECKB 1OVNA 1PQNA 5FHIA 2VCZA 4K7NA 3F4RA 4NHZA 4G0LA 3GKXA 4Q5RA 1O8WA 5INYA 2BL7A 4K5SA 1THOA 3TRXA 3VI5A 3PH9A 3WYWA 2ZRRA 2NPBA 3ZIJA 4QL7A 2JBWA 2R0GA 4AJ6A 2A2SA 4EF0A 2ZNMA 1SU9A 2O7KA 1U3AA 5JWQB 2X49A 1XZOA 2FNOA 1HD2A 2G0FA 2XBIA 4WR5A 4F82A 1ZCPA 1Z5YE 4AJ8A 3KXOA 4LMVA 2HXKA 1PSQA 3VLNA 3TRPA 1AAZA 5B8AA 3W8JA 5KN3A 1AQVA 3GV1A 1X5EA 2H72A 2C8UA 3ED3A 5HR0A 4YKFA 2CT6A 3LXZA 2VCTA 3KJYA 1B4QA 5DQSA 3TRQA 1E6BA 1WMJA 4IVFA 3I69A 5CRHA 1GLPA 4Z2UA 2Z9SA 3TOUA 1MEKA 2L5LA 4ID0A 4HUAA 2DBCA 1O7UA 5GAPD 5ECQB 1VF1A 4TN8A 4ZILA 3C7MA 1EGOA 2AV4A 3P8WA 3EYTA 4G19A 1DSBA 2WGRA 3DD3A 2GZZA 1SK0A 2WB9A 3GTUA 3DA3A 1O8XA 4HZ4A 2LRTA 5D73A 1SYXA 4EDYA 2YP6A 5HFKA 2YV7A 3DGQA 3EE2A 2DKIA 5FWGA 3UJ1A 3GYKA 3TJJA 2OADA 3QMXA 4O7HA 3CQFA 1B8XA 1R26A 2BJXA 2DKHA 1U87A 2H6XA 4L8EA 4JR4A 2PBJA 1W89A 1YJ6A 2ETDA 2V6OA 4BL7A 4JZQA 5ID2A 1U3IA 4IKHA 5HFGA 3CSIA 4DSSA 3EC3A 3WGEA 5B8BA 4HEA2 3HDCA 3LQ7A 1NHOA 4CHSA 4EIQA 1EEMA 2N5AA 1QFNA 1Z7PA 1SD8A 3KIJA 2YJ7A 1H4OA 3HVXA 4YZ9A 1MDJA 2QSIA 4EIPA 1X9SB 3OR5A 3FZ9A 3VA9A 1SL2B 1OYJA 1PN0A 2FD3A 1HNAA 1I5GA 2H19A 5AIXA 4D73A 4PUAA 4OCEA 3IHGA 2F8AA 3ZZXA 3FR6A 4WEYA 4TR3A 2V6EA 3VWWA 4MPGA 2JB1A 4RI7A 3HYPA 4GSNA 2ZW3A 5HGIA 2X8CA 4O1OA 2QGMA 2C0DA 2F51A 1ZYQB 1R7HA 3DWVA 3KCMA 1VF3A 3H4KA 2EIQA 5D96A 3GN3A 4NV2A 5CO3A 5LNKe 2CVKA 4MMMA 4JBBA 2P31A 3Q74A 3QCPA 1FOHA 1XOAA 3FW2A 4K7IA 4NPBA 2ALBA 3TJFA 4V2NA 1KBNA 3QAVA 3FYGA 1XVQA 4PNFA 1GSEA 1A23A 3CTGA 1GNWA 3PGTA 2AYTA 4IGJA 5CYYA 5ABRA 2HT9A 4FO5A 2HSMA 3D4MA 4NWYA 4FYCA 3W8SA 1GSFA 1T1VA 3DYRA 3EVIA 2AJQB 1G7EA 5AGYA 3C1SA 4JRRA 2DIYA 3HD5A 2GLRA 1SKRB 3FKFA 3ZREA 3GA4A 4PUFC 3VWVA 2NDOA 3Q8DA 4ECJA 5DAKA 2BL8A 2C80A 2IMFA 1WP0A 4KSOA 2YJHA 1OE8A 3TJGA 4XS4B 4POKA 3S9FA 1I9DA 3AY8A 1GUKA 4PL5A 3FHKA 4MF7A 2WRTA 3ZTLA 5EL8A 5IM9A 4YQMA 2LJRA 3ME7A 3F8UA 2I4AA 2H66A 1F2EA 3WT2A 2IFQA 2K8VA 2VAFA 1T3BA 2V32A 2F9SA 5G1LA 4KB3A 3UAPA 3ZL5A 2FWHA 2XTRA 1K0NA 2VL2A 3RBTA 5JWOB 19GSA 14GSA 4IJIA 4CY8A 2I1UA 1F37A 7GSSA 5DVBA 3F9UA 3UMAA 2ZCTA 4BVYB 3NIVA 3CSJA 4KDUA 2BMXA 4CY6A 1N2AA 5G5EA 3A5IA 4KW6A 1ERUA 3EMPA 1UA5A 1EEJA 4MK3A 5ECLB 2FWGA 4GSTA 3D5JA 3ZYWA 1TU8A 4IBPA 3QAGA 3ISOA 2OE0A 2K9FA 2YCDA 2XHFA 3LYPA 3FZ5A 4XCSA 1V57A 1B9YC 4KE3A 3TJBA 1SJZA 4G0KA 2GVPA 2CAQA 2E2GA 1WWJA 1A0RP 4KUNA 2K8SA 1HNBA 3LFLA 5C00A 1UC7A 1YO7A 1F9MA 1J9BA 1PX6A 1FAAA 5D8IA 5IMCA 1MTCA 3F4SA 1TKDB 4Z2RA 4Z7HA 2FCHA 2FU2A 4N0ZA 3ZIVA 4EO3A 3MWHA 4OMVA 2OE3A 2QKEA 1NHYA 2O85A 2OKAA 5HR2A 3VWUA 3A2XA 4V1Ap 3IAS1 2VOCA 1TK8B 4POMA 1ZMAA 2FUG1 4GQFA 1LBKA 2HSHA 1OC3A 1K0CA 2IN3A 1PFOA 3UVHA 3QDNA 1QGVA 3HVSA 2H30A 1A8LA 1XW9A 3EU3A 1K0OA 3GSTA 4N10A 1R5PA 1M2DA 4EE0A 3KGKA 4EUYA 3HKRA 2R0PA 3F3QA 2FUG2 3IA1A 5ECHB 4G2EA 1RQMA 1SYRA 2C3NA 4EVMA 3L9SA 3TJKA 5ID2B 5DDLA 3DEXA 1XXUA 4WF4A 4MABA 2K6VA 2VL3A 3HA9A 1DE2A 1GWCA 1SL1B 20GSA 5H5RA 4DSSB 3HHVA 2LRCA 5LCZA 3DA4A 1OKTA 2HNLA 4HU9A 1G7OA 1HYUA 1ST9A 4TRXA 3ZVJA 2A2RA 4G0IA 3IK7A 2YWNA 4PURA 4HS1A 2H71A 2YOIA 1S3RA 3FY7A 4MJBA 5KOWA 5F8BA 4O1PA 1NSWA 2HE3A 5GZZB 2X64A 1QXHA 3GIXA 1JLVA 3KTLA 3O3TA 4FYUA 4OCFA 4OFTA 3Q18A 1O85A 3BCKA 1MD4A 2KKMA 4TOPA 4MNNA 3TGZA 2FWFA 2VD1A 1XWCA 4HQZA 1QQ2A 1TI3A 4MA9A 4V2LA 4P3YB 3V1WA 3GSSA 2K18A 2VLTA 4J57E 3GNJA 1T4YA 2DSAA 1LU4A 2GQLA 3CXGA 1YDKA 5LD0A 4GSSA 4AGSA 3IXRA 2X99A 5D93A 5CP1A 4YKGA 4IQAA 2C0FA 2PUKC 1DUGA 2PVQA 4POLA 3R3EA 1VRSD 2LRNA 2FA8A 2PERA 1XG8A 2EC4A 2ON7A 2ZUPA 1T8EB 1XWKA 2R0CA 4CDOA 1G6YA 3KH7A 4TXOA 3BOAA 3L4NA 2CV4A 2IMIA 2DJ2A 6GSXA 3VFIA 4ZB6A 4IS0A 3LJ2A 5DCGA 3HXSA 2M80A 2F8FA 4F2IA 4YAVA 4I6XA 3F4TA 1BX9A 1X9WB 3APSA 3M9KA 1FW1A 1LJRA 2WS2A 3FK8A 4MP4A 4MDCA 3L0IA 1AW9A 3APOA 4MZWA 3EU4A 2YPMA 2AAWA 4A5PA 1JHBA 4USSA 1CQHA 4V1Ag 1X0RA 2JACA 3ERGA 2I3YA 4ML1A 1KTEA 5DAKB 3TKSE 2GQKA 4TXVA 1SENA 2DMLA 1CQGA 3KMNA 3LSZA 3DXBA 3I6AA 1A2LA 3LJRA 2PN8A 2GQMA 4F03A 3E9JB 1EZKA 5CRDA 1XIYA 1M0UA 1F6MC 1GRXA 1W4VA 3A2WA 2OE1A 5IPGA 5B6MA 2PGTA 1WOUA 1XWGA 2KLXA 1WJKA 1YY7A 2IFQB 3ERWA 5D9TA 3F0IA 3M0FA 1RK4A 1GTBA 2DJKA 4EC0A 2IIYA 4KGIA 4ECIA 5DCHA 3O6TA 3ZMLA 1U6TA 1VF4A 5IOXA 2VIMA 3IK9A 4WXTA 2P5QA 2A4HA 2D2ZA 2K19A 2I81A 4JE1A 2P5RA 4Q5NA 2B5YA 2OACA 3ME8A 2IMEA 2HRKA 2RUEA 10GSA 1URMA 4ZIJA 2JADA 2R2JA 1XCCA 2KUCA 2P0GA 2VL9A 4YQUA 3QR6A 4HI7A 2RIIA 1TTZA 3F3RA 4YZDA 2AB6A 5A4WA 1GUMA 3TKSC 1FOVA 3MNGA 2L6CA 2GSTA 1ZYNA 3VI7A 3F4MA 2XC2A 1U5KA 4J2FA 2JSYA 1MD3A 3WGXA 3PINA 5F05A 3QPMA 1WIKA 1SD9A 1NM3A 4K2DA 2C1YA 5G2ZA 1GSYA 3LEFA 3UARA 4LL4B 2C4JA 4WF5A 5G31A 1TW9A 1S3AA 4XIHA 4TW5A 1EOGA 3KH9A 8GSSA 2JZRA 2KOKA 4O5UA 2E2MA 2JL4A 2V2GA 3FBVA 3FVVA 4WKWA 1K0BA 2G2QA 5CREA 2REMA 3ZFLA 5KN1A 2L6DA 5A4VA 3BD2A 3LJ0A 3N5OA 4PTSA 4X4JA 1TRUA 3GKMA 1OC9A 5EY6A 2VD0A 4XRAA 4DSRA 3IE3A 3ERFA 1KEBA 2CA8A 4PQ1A 2E0QA 5ENUA 1R4WA 1AQWA 3GL3A 4MH2A 1EV4A 2R37A 1FVKA 5ECNB 4WBJA 4BVXA 1A0FA 2V41A 4JEDA 3UIWA 3LYKA 3US3A 4TR1A 1ZGNA 2X8GA 3DO9A 2DC5A 3RHBA 3C71A 5KOXA 1SJ8A 3HZ4A 1V58A 2MZCA 4EDZA 1JFUA 1K3OA 2FWEA 2VM1A 4CW9A 5L71A 4G9HA 3RPNA 11GSA 2GGTA 6GSUA 4GWRA 1A2JA 3GKKA 4MH3A 1O81A 4OO4A 3VURA 1U88A 2XMXA 4ECBA 2DMMA 1FVJA 3M3MA 2ES7A 1WRYA 2OJLA 1G6WA 2FY6A 2V1MA 3DMLA 4ZL9A 4MLYA 2RLDA 5F0GA 2HI7A 2FHEA 4DWLA 2MMAA 1C72A 4WETA 1TP9A 1XFLA 3CTFA 1IYHA 2DJ0A 1B9XC 1H75A 3MYDA 2MMOA 5AISA 3KEBA 6GSTA 2B5EA 4AS2A 2LTKA 1TK0B 3HY2A 5J9BA 3SBCA 2H74A 4I2TA 3VPQA 3TOTA 4EKZA 2YZUA 3IC4A 1SKSB 4L0WA 3I43A 3A3TA 3D21A 2C0GA 4TXOB 2JZTA 4HU7A 3ZVJD 1B4PA 3JCML 1EOHA 4KH7A 1YF1A 3KZQA 4ZB9A 5D9WA 1TDPA 1V98A 2WCIA 1TDIA 2B3SA 2H1DA 3A2VA 1M2AA 5D9XA 3EINA 5DJLA 3P23A 3AJFA 5IOWA 3G7JA 4OD7A 3GX0A 4IELA 2WDUA 4HOJA 2WULA 3F6DA 5ECMB 3IBHA 2GT5A 2IPAA 4AS3A 3IC8A 3UOMA 4JR6A 1BJXA 3C1RA 3MDKA 1PKZA 1M3IA 2B7JA 4FYBA 2VCVA 2VCXA 2XBQA 3UITA 1PA3A 2X4AA 3D0ZA 3G9BA 4LMWA 1GL8A 3LGCA 1F3AA 4RI6A 3ZFBA 5HR3A 3WGDA 4K0NA 1MDIA 3QD9A 5KEJA 5F06A 4K2XA 4LLRA 1V2AA 4GRFA 2GTUA 1XOBA 3WT1A 3O76A 3APQA 1M99A 2HZEA 1FB0A 3F63A 4K9ZA 4HDEA 1G0TA 2M72A 2A4VA 4O92A 1JZRA 4L0UA 2HFDA 1GSUA 1ON4A 2H73A 3NOFA 4WBRD 1AIUA 3DVWA 3PR8A 3DRNA 1ILOA 5HR1A 5C04A 2RM5A 3EMXA 3WD6A 2HRFA 1TU7A 3GURA 4OO5A 4GF0A 4E8HA 3TUEA 3ZITA 4MZCA 3GFKA 2OA7A 5BMUA 1YQ1A 3IAS2 4TR0A 2MMZA 1PKWA 4KSMA 5AN1A 3ZMKA 3MAKA 5CNWA 1Q98A 3HVNA 1EP7A 2UZ8A 4ICYA 1YEPA 4ISDA 4KCEA 1TOFA 4GTUA 2QSBA 3MSZA 1AC1A 1EP8A 1M7TA 4FIWA 1A24A 1FO5A 2JB3A 4BA7A 1O73A 5GAND 4NHWA 5ELGA 3U5RE 5F07A 4MJEA 2GSQA 3BJ5A 3GUSA 1GH2A 5FT3A 3H79A 4ZBDA 3TKSA 3H1NA 2TIRA 1GTIA 2XPEA 3TKPA 3FEUA 3BBYA 3GX8A 3MIXA 2GS3A 3UL3A 1PL1A 1PL2A 5GSTA 4L5OA 3IRAA 1ABAA 2NBSA 4PX1A 3R2QA 4IN0A 3C8EA 2MYGA 3HZ8A 1S3CA 1J0FA 2X8HA 5BRTA 3Q6OA 4XRDA 3M8NA 1IYIA 3BCIA 3P2AA 3GHAA 12GSA 3GMFA 2YFAA 4F0BA 1T4ZA 1YKAA 4XS6A 2FEFA 3IHQA 1TK5B 4POBA 4EL1A 2FGXA 4I2UA 4ZBBA 4PXOA 3C73A 2LNTA 2L4CA 2LQOA 1YKCA 2IMDA 1RW1A 3CRUA 2DJJA 2MMNA 4WR4A 3E3EA 1XW5A 1Y25A 4N11A 2HSYA 2DLXA 3KP8A 2JZSA 2F6MB 2H70A 5IIZA 4KDYA 5IO2A 1YEXA 2B1LA 2GSRA 3LORA 3FNBA 3H8QA 3B55A 1K0AA 4Q9VA 2QGVA 2YN1A 2LUSA 1AXDA 1DE1A 1OC9B 1FB6A 5DBQA 1VGLA 13GSA 22GSA 4NXIA 2R3XA 2VLVA 2I9HA 2VL2C 2L5OA 2RIOA 3D4TA 4IW9A 2H0IA 3DVXA 2XTQA 3HJOA 5AIVA 1GUHA 2L57A 1V40A 2NVLA 4BVXB 4HJMA 2HRNA 5IMFA 4TR1B 1TRVA 3J7Yb 1ERTA 1OKDA 6GSYA 4GQCA 2HGKA 5ELAA 1S3DA 4HQSA 2C3QA 2CX3A 1JZWA 1GTUA 4IJ3A 5JCUA 4BIKA 17GSA 3LWAA 5EPFA 4QL9A 1XWAA 2CQ9A 4KA0A 2N5BA 4ZL8A 4J56E 4ECCA 2R4VA 6GSSA 4IHUA 3GH9A 3CRTA 2EIOA 3IDVA 2A2DA 2HRAA 4PGTA 3IOSA 1F3BA 2H0GA 5E59A 3TDGA 4RQRA 2GSSA 4XS1A 4BPYA 1Z3EA 3CYNA 3SWLA 1T7PB 3DIEA 2DIZA 5G5FA 2VM2A 2IWTA 1M9AA 1BYEA 1UN2A 2YFBA 1K0DA 2VCWA 3P90A 5D9VA 2RUFA 2HYXA 1OE7A 3L78A 1SJIA 4Z2TA 1Z6MA 2YANA 2H1AA 4ACSA 2M46A 4AJ7A 1OC8A 2LV3A 4RUVA 3GKNA 1TXXA 4K7OA 4HZ2A 4Q5QA 2GSCA 1O6JA 3QFAC 4F0CA 4EXJA 2FA4A 2R6KA 4XHMA 4HFVA 2GT6A 3VWXA 2E7PA 4L5LA 2OBIA 1X5CA 2H1GA 1YF0A 4OAUC 4HEA1 5COHA 4PQIA 2QZGA 5A5KA 4PQHA 1TRWA 5IMDA 2YWIA 5CAXA 5DALB 4KX4A 4BWSA 2AUVA 4K6XA 2B7KA 3KMOA 2IMKA 1W3SA 1ERVA 1MDKA 1SJ6A 1Z9HA 3D6IA 5J4UA 1OAZA 3D22A 4MPFA 2RM6A 1M3JA 4HJ2A 1V9WA 1HNCA 2JU5A 4KCAA 1HQOA 2PVOC 2KP2A 4BWQA 1PGTA 3L9VA 1QK8A 3GRXA 4E8EA 5JCWA 5IPHA 2O8VB 3TKQA 1JLWA 2E8GA 2PWJA 4YQVA 3DKSA 3IR4A 4YZCA 1E2YA 4FQUA 2HZEB 3HJMA 2AHEA 2C3TA 1SL0B 2CX4A 3LG6A 1GNEA 3TKRA 3N9JA 3J7Yk 4ILFA 4K8MA 4NMUA 1USBA 2IP6A 4KF9A 4N0VA 3M1GA 4F9ZA 3RHCA 2LSTA 1N8JA 1ZYEA 4KNDA 3L0HA 1TI1A 5GSSA 3EPTA 2VUPA 1UVZA 3W6GA 4OFMA 1PD21 5ECOB 1Y6EA 3LXTA 3RPPA 3G7IA 2NTOA 3E0UA 3GL5A 5E4WA 4ZBAA 2LEGA 3RDWA 2LS5A 2WZ9A 2PPTA 3KM6A 2HLSA 4FH8A 2J23A 3LW9A 2IJYA 3KP9A 4X0XA 4H86A 3IAM1 2LJAA 5A4UA 1VF2A 1T00A 1YZXA 3HVVA 3UEMA 4YAPA 2H6ZA 2OBKA 1SK1A 2J9HA 3Q19A 2QA2A 1EWXA 2DJ3A 1DBYA 3TB2A 2PU9C 4HSCX 2RADA 3UVTA 5J5NA 1GSSA 4K1FA 3IAM2 5ECPB 3FZAA 1QUWA 1Z7RA 4TR4A 3ZLPA 3L9UA 1SKWB 5B7CA 5IMAA 3FR3A 4DVCA 2VLUA 1X5DA 3JSBA 4Q5FA 4K0GA 4ZB8A 1M2BA 3H93A
chains in the Genus database with same CATH topology
2LNSA 1BQ7A 2L59A 2V1CC 4JCVE 4X1UA 5JWRB 2MBTA 2V6KA 5IMZA 3VPTA 1JZOA 1M9BA 2H75A 1ZZYA 3QAWA 4OAVB 1Q4JA 3KD0A 2RLIA 1PN9A 3LJ1A 4K5RA 3FZ4A 5EVOA 2YWOA 2TRXA 4YH2A 2KP1A 3UBKA 4G76A 4RQXA 2MBSA 2YWMA 2CAIA 1ZOFA 1R5AA 4KAEA 5ECIB 1GTAA 2CVBA 3F6FA 1XPVA 3P7XA 4GXTA 2A2CA 2CZ2A 1ACVA 2YNXA 3M9JA 4MF6A 3K8NA 5DALA 3I9V1 4GCIA 4ZXGA 4G75A 2B5XA 3VK9A 1B48A 2O89A 2GZPA 4LL1B 1AUCA 5ECSA 2P22B 2H0HA 1THXA 4O32A 3EURA 2BTOT 3ZRDA 2FLSA 1ML6A 1A8YA 5HFIA 2VCQA 2LQQA 3CSHA 4NV5A 5B6NA 2GDRA 5KN2A 3I9V2 2JB2A 5H5SA 2WFCA 1Z6NA 2KHPA 4XTSA 1WPIA 2F66B 5HQPA 5G1KA 2N5FA 4ZL7A 4ML6A 4Z7XA 4MF5A 5DQYA 6GSWA 1ZL9A 4MJCA 5ECRB 18GSA 2CZ3A 3G7YA 4DSQA 4I1TA 3HJPA 1QMVA 2TRCP 5G30A 1TRSA 4Z7GA 3RAZA 1AQXA 2B1KA 4PL3A 2YZHA 1SK2A 2YV9A 2B6MA 1FHEA 1XW6A 1GP1A 1K3YA 3TCOA 2EIRA 2MJFB 3UBLA 5IMVA 4AF2A 4TKYA 3QOUA 4LA1A 3CMIA 2F3MA 4MZBA 5IO0A 3CBUA 3FMWA 2HZFA 4I97A 4MCUA 1BG5A 2CAZB 3GTUB 3QFBC 4PNGA 1PRXA 1TJDA 4G10A 2QA1A 5J41A 4V2MA 4QQ7A 4JU5A 5DJMA 4MJAA 2XPDA 4IP1A 5J3RA 2JSZA 1FG4A 6GSVA 5KN0A 2JAEA 2A2PA 2L1LB 2L4QA 2DJ1A 4KDXA 2H6YA 4BL7B 3NZNA 4I8BA 3SDJA 2O87A 1XWBA 4IQ1A 2H01A 3PPUA 2C0EA 4DEJA 3EWLA 1JZDA 4O5RA 2WJUA 4GXZA 4I5QA 5IQYA 1KNGA 1EGRA 2ON5A 1K3LA 1K0MA 4PL4A 2GZYA 9GSSA 3IPZA 4IP6A 1ZYPA 1A2MA 3HCZA 2VO4A 5CRGA 5J9CA 16GSA 5CRWA 1PMTA 1X9MB 1GSDA 2PMTA 4OWYA 2H8LA 3GH6A 3FR9A 2LJKA 4XS4A 1EV9A 1WE0A 1PX7A 4TVEA 4ULXA 1NW2A 1XVWA 2QC7A 4D73B 3FRCA 2LKUA 4OFNA 1XBSA 2H1BA 4N30A 1GSQA 5H5QA 3A5WA 1BAYA 4X43A 3KTBA 1GLQA 2CVDA 1BEDA 1GULA 4U6RA 5LNK1 1J08A 2IL3A 4NAXA 3U6VA 2R5GA 4GLTA 1ERWA 4O5QA 2H76A 4BVYA 5JCGA 3IV4A 5ECKB 1OVNA 1PQNA 5FHIA 2VCZA 4K7NA 3F4RA 4NHZA 4G0LA 3GKXA 4Q5RA 1O8WA 5INYA 4K5SA 1THOA 3TRXA 3VI5A 3PH9A 3WYWA 2ZRRA 2NPBA 3ZIJA 4QL7A 2R0GA 4AJ6A 2A2SA 4EF0A 2ZNMA 1SU9A 2O7KA 1U3AA 5JWQB 2X49A 1XZOA 2FNOA 1HD2A 2G0FA 2XBIA 4WR5A 4F82A 1ZCPA 1Z5YE 4AJ8A 3KXOA 4LMVA 2HXKA 1PSQA 3VLNA 3TRPA 1AAZA 5B8AA 3W8JA 5KN3A 1AQVA 3GV1A 1X5EA 2H72A 2C8UA 3ED3A 5HR0A 4YKFA 2CT6A 3LXZA 2VCTA 3KJYA 1B4QA 5DQSA 3TRQA 1E6BA 1WMJA 4IVFA 3I69A 5CRHA 1GLPA 4Z2UA 2Z9SA 3TOUA 1MEKA 2L5LA 4ID0A 4HUAA 2DBCA 1O7UA 5GAPD 5ECQB 1VF1A 4TN8A 4ZILA 3C7MA 1EGOA 2AV4A 3P8WA 3EYTA 4G19A 1DSBA 2WGRA 3DD3A 2GZZA 1SK0A 2WB9A 3GTUA 3DA3A 1O8XA 4HZ4A 2LRTA 5D73A 1SYXA 4EDYA 2YP6A 5HFKA 2YV7A 3DGQA 3EE2A 2DKIA 5FWGA 3UJ1A 3GYKA 3TJJA 2OADA 4O7HA 3QMXA 1B8XA 1R26A 2BJXA 2DKHA 1U87A 2H6XA 4L8EA 4JR4A 2PBJA 1W89A 1YJ6A 2V6OA 4BL7A 4JZQA 5ID2A 1U3IA 4IKHA 5HFGA 3CSIA 4DSSA 3EC3A 3WGEA 5B8BA 4HEA2 3HDCA 3LQ7A 1NHOA 4CHSA 4EIQA 1EEMA 2N5AA 1QFNA 1Z7PA 1SD8A 3KIJA 2YJ7A 1H4OA 3HVXA 4YZ9A 1MDJA 2QSIA 4EIPA 1X9SB 3OR5A 3FZ9A 3VA9A 1SL2B 1OYJA 1PN0A 2FD3A 1HNAA 1I5GA 2H19A 5AIXA 4D73A 4PUAA 4OCEA 3IHGA 2F8AA 3ZZXA 3FR6A 4WEYA 4TR3A 2V6EA 3VWWA 4MPGA 2JB1A 4RI7A 3HYPA 4GSNA 5HGIA 2X8CA 4O1OA 2C0DA 2F51A 1ZYQB 1R7HA 3DWVA 3KCMA 1VF3A 3H4KA 2EIQA 5D96A 3GN3A 4NV2A 5CO3A 5LNKe 2CVKA 4MMMA 4JBBA 2P31A 3Q74A 3QCPA 1FOHA 1XOAA 3FW2A 4K7IA 4NPBA 2ALBA 3TJFA 4V2NA 1KBNA 3QAVA 3FYGA 1XVQA 4PNFA 1GSEA 1A23A 3CTGA 1GNWA 3PGTA 2AYTA 4IGJA 5CYYA 5ABRA 2HT9A 4FO5A 2HSMA 3D4MA 4NWYA 4FYCA 3W8SA 1GSFA 1T1VA 3DYRA 3EVIA 2AJQB 1G7EA 5AGYA 3C1SA 4JRRA 2DIYA 3HD5A 2GLRA 1SKRB 3FKFA 3ZREA 3GA4A 4PUFC 3VWVA 2NDOA 3Q8DA 4ECJA 5DAKA 2C80A 2IMFA 1WP0A 4KSOA 2YJHA 1OE8A 3TJGA 4XS4B 4POKA 3S9FA 1I9DA 3AY8A 1GUKA 4PL5A 3FHKA 4MF7A 2WRTA 3ZTLA 5EL8A 5IM9A 4YQMA 2LJRA 3ME7A 3F8UA 2I4AA 2H66A 1F2EA 3WT2A 2IFQA 2K8VA 2VAFA 1T3BA 2V32A 2F9SA 5G1LA 4KB3A 3UAPA 3ZL5A 2FWHA 2XTRA 1K0NA 2VL2A 3RBTA 5JWOB 19GSA 14GSA 4IJIA 4CY8A 2I1UA 1F37A 7GSSA 5DVBA 3F9UA 3UMAA 2ZCTA 4BVYB 3NIVA 3CSJA 4KDUA 2BMXA 4CY6A 1N2AA 5G5EA 3A5IA 4KW6A 1ERUA 3EMPA 1UA5A 1EEJA 4MK3A 5ECLB 2FWGA 4GSTA 3D5JA 3ZYWA 1TU8A 4IBPA 3QAGA 3ISOA 2OE0A 2K9FA 2YCDA 2XHFA 3LYPA 3FZ5A 4XCSA 1V57A 1B9YC 4KE3A 3TJBA 1SJZA 4G0KA 2GVPA 2CAQA 2E2GA 1WWJA 1A0RP 4KUNA 2K8SA 1HNBA 3LFLA 5C00A 1UC7A 1YO7A 1F9MA 1J9BA 1PX6A 1FAAA 5D8IA 5IMCA 1MTCA 3F4SA 1TKDB 4Z2RA 4Z7HA 2FCHA 4N0ZA 3ZIVA 4EO3A 3MWHA 4OMVA 2OE3A 2QKEA 1NHYA 2O85A 2OKAA 5HR2A 3VWUA 3A2XA 4V1Ap 3IAS1 2VOCA 1TK8B 4POMA 1ZMAA 2FUG1 4GQFA 1LBKA 2HSHA 1OC3A 1K0CA 2IN3A 3UVHA 3QDNA 1QGVA 3HVSA 2H30A 1A8LA 1XW9A 3EU3A 1K0OA 3GSTA 4N10A 1R5PA 1M2DA 4EE0A 3KGKA 4EUYA 3HKRA 2R0PA 3F3QA 2FUG2 3IA1A 5ECHB 4G2EA 1RQMA 1SYRA 2C3NA 4EVMA 3L9SA 3TJKA 5ID2B 5DDLA 3DEXA 1XXUA 4WF4A 4MABA 2K6VA 2VL3A 3HA9A 1DE2A 1GWCA 1SL1B 20GSA 5H5RA 4DSSB 3HHVA 2LRCA 5LCZA 3DA4A 1OKTA 2HNLA 4HU9A 1G7OA 1HYUA 1ST9A 4TRXA 3ZVJA 2A2RA 4G0IA 3IK7A 2YWNA 4PURA 4HS1A 2H71A 2YOIA 3FY7A 4MJBA 5KOWA 5F8BA 4O1PA 1NSWA 2HE3A 5GZZB 2X64A 1QXHA 3GIXA 1JLVA 3KTLA 3O3TA 4FYUA 4OCFA 4OFTA 3Q18A 1O85A 3BCKA 1MD4A 2KKMA 4TOPA 4MNNA 3TGZA 2FWFA 2VD1A 1XWCA 4HQZA 1QQ2A 1TI3A 4MA9A 4V2LA 4P3YB 3V1WA 3GSSA 2K18A 2VLTA 4J57E 3GNJA 1T4YA 2DSAA 1LU4A 2GQLA 3CXGA 1YDKA 5LD0A 4GSSA 4AGSA 3IXRA 2X99A 5D93A 5CP1A 4YKGA 4IQAA 2C0FA 2PUKC 1DUGA 2PVQA 4POLA 3R3EA 1VRSD 2LRNA 2FA8A 2PERA 2ON7A 2EC4A 2ZUPA 1T8EB 1XWKA 2R0CA 4CDOA 1G6YA 3KH7A 4TXOA 3BOAA 3L4NA 2CV4A 2IMIA 2DJ2A 6GSXA 3VFIA 4ZB6A 4IS0A 3LJ2A 5DCGA 3HXSA 2M80A 2F8FA 4F2IA 4YAVA 4I6XA 3F4TA 1BX9A 1X9WB 3APSA 3M9KA 1FW1A 1LJRA 2WS2A 3FK8A 4MP4A 4MDCA 3L0IA 1AW9A 3APOA 4MZWA 3EU4A 2YPMA 2AAWA 4A5PA 1JHBA 4USSA 1CQHA 4V1Ag 1X0RA 2JACA 3ERGA 2I3YA 4ML1A 1KTEA 5DAKB 3TKSE 2GQKA 4TXVA 1SENA 2DMLA 1CQGA 3KMNA 3LSZA 3DXBA 3I6AA 1A2LA 3LJRA 2PN8A 2GQMA 4F03A 3E9JB 1EZKA 5CRDA 1XIYA 1M0UA 1F6MC 1GRXA 1W4VA 3A2WA 2OE1A 5IPGA 5B6MA 2PGTA 1WOUA 1XWGA 2KLXA 1WJKA 1YY7A 2IFQB 3ERWA 5D9TA 3F0IA 3M0FA 1RK4A 1GTBA 2DJKA 4EC0A 2IIYA 4KGIA 4ECIA 5DCHA 3O6TA 3ZMLA 1U6TA 1VF4A 5IOXA 2VIMA 3IK9A 4WXTA 2P5QA 2A4HA 2D2ZA 2K19A 2I81A 4JE1A 2P5RA 4Q5NA 2B5YA 2OACA 3ME8A 2IMEA 2HRKA 2RUEA 10GSA 1URMA 4ZIJA 2JADA 2R2JA 1XCCA 2KUCA 2P0GA 2VL9A 4YQUA 3QR6A 4HI7A 2RIIA 1TTZA 3F3RA 4YZDA 2AB6A 5A4WA 1GUMA 3TKSC 1FOVA 3MNGA 2L6CA 2GSTA 1ZYNA 3VI7A 3F4MA 2XC2A 1U5KA 4J2FA 2JSYA 1MD3A 3WGXA 3PINA 5F05A 3QPMA 1WIKA 1SD9A 1NM3A 4K2DA 2C1YA 5G2ZA 1GSYA 3LEFA 3UARA 4LL4B 2C4JA 4WF5A 5G31A 1TW9A 1S3AA 4XIHA 4TW5A 1EOGA 3KH9A 8GSSA 2JZRA 2KOKA 4O5UA 2E2MA 2JL4A 2V2GA 3FBVA 4WKWA 1K0BA 2G2QA 5CREA 2REMA 3ZFLA 5KN1A 2L6DA 5A4VA 3BD2A 3LJ0A 3N5OA 4PTSA 4X4JA 1TRUA 3GKMA 1OC9A 5EY6A 2VD0A 4XRAA 4DSRA 3IE3A 3ERFA 1KEBA 2CA8A 4PQ1A 2E0QA 5ENUA 1R4WA 1AQWA 3GL3A 4MH2A 1EV4A 2R37A 1FVKA 5ECNB 4WBJA 4BVXA 1A0FA 2V41A 4JEDA 3UIWA 3LYKA 3US3A 4TR1A 1ZGNA 2X8GA 3DO9A 2DC5A 3RHBA 3C71A 5KOXA 1SJ8A 3HZ4A 1V58A 2MZCA 4EDZA 1JFUA 1K3OA 2FWEA 2VM1A 4CW9A 5L71A 4G9HA 3RPNA 11GSA 2GGTA 6GSUA 4GWRA 1A2JA 3GKKA 4MH3A 1O81A 4OO4A 3VURA 1U88A 2XMXA 4ECBA 2DMMA 1FVJA 3M3MA 2ES7A 1WRYA 2OJLA 1G6WA 2FY6A 2V1MA 3DMLA 4ZL9A 4MLYA 5F0GA 2HI7A 2FHEA 4DWLA 2MMAA 1C72A 4WETA 1TP9A 1XFLA 3CTFA 1IYHA 2DJ0A 1B9XC 1H75A 3MYDA 2MMOA 5AISA 3KEBA 6GSTA 2B5EA 4AS2A 2LTKA 1TK0B 3HY2A 5J9BA 3SBCA 2H74A 4I2TA 3VPQA 3TOTA 4EKZA 2YZUA 3IC4A 1SKSB 4L0WA 3I43A 3A3TA 3D21A 2C0GA 4TXOB 2JZTA 4HU7A 3ZVJD 1B4PA 3JCML 1EOHA 4KH7A 1YF1A 3KZQA 4ZB9A 5D9WA 1V98A 2WCIA 1TDIA 2B3SA 2H1DA 3A2VA 1M2AA 5D9XA 3EINA 5DJLA 3P23A 3AJFA 5IOWA 3G7JA 4OD7A 3GX0A 4IELA 2WDUA 4HOJA 2WULA 3F6DA 5ECMB 3IBHA 2GT5A 2IPAA 4AS3A 3IC8A 3UOMA 4JR6A 1BJXA 3C1RA 3MDKA 1PKZA 2B7JA 4FYBA 2VCVA 2VCXA 2XBQA 3UITA 1PA3A 2X4AA 3D0ZA 3G9BA 4LMWA 1GL8A 3LGCA 1F3AA 4RI6A 3ZFBA 5HR3A 3WGDA 4K0NA 1MDIA 3QD9A 5KEJA 5F06A 4K2XA 4LLRA 1V2AA 4GRFA 2GTUA 1XOBA 3WT1A 3O76A 3APQA 1M99A 2HZEA 1FB0A 3F63A 4K9ZA 4HDEA 1G0TA 2M72A 2A4VA 4O92A 1JZRA 4L0UA 2HFDA 1GSUA 1ON4A 2H73A 3NOFA 4WBRD 1AIUA 3DVWA 3PR8A 3DRNA 1ILOA 5HR1A 5C04A 2RM5A 3EMXA 3WD6A 2HRFA 1TU7A 3GURA 4OO5A 4GF0A 4E8HA 3TUEA 3ZITA 4MZCA 3GFKA 2OA7A 5BMUA 1YQ1A 3IAS2 4TR0A 2MMZA 1PKWA 4KSMA 5AN1A 3ZMKA 3MAKA 5CNWA 1Q98A 1EP7A 2UZ8A 4ICYA 1YEPA 4ISDA 4KCEA 1TOFA 4GTUA 3MSZA 1AC1A 1EP8A 1M7TA 4FIWA 1A24A 1FO5A 2JB3A 4BA7A 1O73A 5GAND 4NHWA 5ELGA 3U5RE 5F07A 4MJEA 2GSQA 3BJ5A 3GUSA 1GH2A 5FT3A 3H79A 4ZBDA 3TKSA 3H1NA 2TIRA 1GTIA 2XPEA 3TKPA 3FEUA 3BBYA 3GX8A 3MIXA 2GS3A 3UL3A 1PL1A 1PL2A 5GSTA 4L5OA 3IRAA 1ABAA 2NBSA 4PX1A 3R2QA 4IN0A 3C8EA 2MYGA 3HZ8A 1S3CA 1J0FA 2X8HA 5BRTA 3Q6OA 4XRDA 3M8NA 1IYIA 3BCIA 3P2AA 3GHAA 12GSA 3GMFA 2YFAA 4F0BA 1T4ZA 1YKAA 4XS6A 3IHQA 1TK5B 4POBA 4EL1A 2FGXA 4I2UA 4ZBBA 4PXOA 3C73A 2LNTA 2L4CA 2LQOA 1YKCA 2IMDA 1RW1A 3CRUA 2DJJA 2MMNA 4WR4A 3E3EA 1XW5A 1Y25A 4N11A 2HSYA 2DLXA 3KP8A 2JZSA 2F6MB 2H70A 5IIZA 4KDYA 5IO2A 1YEXA 2B1LA 2GSRA 3LORA 3H8QA 1K0AA 4Q9VA 2QGVA 2YN1A 2LUSA 1AXDA 1DE1A 1OC9B 1FB6A 5DBQA 1VGLA 13GSA 22GSA 4NXIA 2R3XA 2VLVA 2I9HA 2VL2C 2L5OA 2RIOA 3D4TA 4IW9A 2H0IA 3DVXA 2XTQA 3HJOA 5AIVA 1GUHA 2L57A 1V40A 2NVLA 4BVXB 4HJMA 2HRNA 5IMFA 4TR1B 1TRVA 3J7Yb 1ERTA 1OKDA 6GSYA 4GQCA 5ELAA 1S3DA 4HQSA 2C3QA 2CX3A 1JZWA 1GTUA 4IJ3A 5JCUA 17GSA 3LWAA 5EPFA 4QL9A 1XWAA 2CQ9A 4KA0A 2N5BA 4ZL8A 4J56E 4ECCA 2R4VA 6GSSA 4IHUA 3GH9A 3CRTA 2EIOA 3IDVA 2A2DA 2HRAA 4PGTA 3IOSA 1F3BA 2H0GA 5E59A 3TDGA 4RQRA 2GSSA 4XS1A 4BPYA 1Z3EA 3CYNA 3SWLA 1T7PB 3DIEA 2DIZA 5G5FA 2VM2A 2IWTA 1M9AA 1BYEA 1UN2A 2YFBA 1K0DA 2VCWA 3P90A 5D9VA 2RUFA 2HYXA 1OE7A 3L78A 1SJIA 4Z2TA 1Z6MA 2YANA 2H1AA 4ACSA 2M46A 4AJ7A 1OC8A 2LV3A 4RUVA 3GKNA 1TXXA 4K7OA 4HZ2A 4Q5QA 1O6JA 3QFAC 4F0CA 4EXJA 2FA4A 2R6KA 4XHMA 4HFVA 2GT6A 3VWXA 2E7PA 4L5LA 2OBIA 1X5CA 2H1GA 1YF0A 4OAUC 4HEA1 5COHA 4PQIA 5A5KA 4PQHA 1TRWA 5IMDA 2YWIA 5CAXA 5DALB 4KX4A 4BWSA 2AUVA 4K6XA 2B7KA 3KMOA 2IMKA 1W3SA 1ERVA 1MDKA 1SJ6A 1Z9HA 3D6IA 5J4UA 1OAZA 3D22A 4MPFA 2RM6A 4HJ2A 1V9WA 1HNCA 2JU5A 4KCAA 1HQOA 2PVOC 2KP2A 4BWQA 1PGTA 3L9VA 1QK8A 3GRXA 4E8EA 5JCWA 5IPHA 2O8VB 3TKQA 1JLWA 2E8GA 2PWJA 4YQVA 3DKSA 3IR4A 4YZCA 1E2YA 4FQUA 2HZEB 3HJMA 2AHEA 2C3TA 1SL0B 2CX4A 3LG6A 1GNEA 3TKRA 3N9JA 3J7Yk 4ILFA 4K8MA 4NMUA 1USBA 2IP6A 4KF9A 4N0VA 3M1GA 4F9ZA 3RHCA 2LSTA 1N8JA 1ZYEA 4KNDA 3L0HA 1TI1A 5GSSA 3EPTA 2VUPA 1UVZA 3W6GA 4OFMA 1PD21 5ECOB 1Y6EA 3LXTA 3RPPA 3G7IA 2NTOA 3E0UA 3GL5A 5E4WA 4ZBAA 2LEGA 3RDWA 2LS5A 2WZ9A 2PPTA 3KM6A 2HLSA 4FH8A 2J23A 3LW9A 2IJYA 3KP9A 4X0XA 4H86A 3IAM1 2LJAA 5A4UA 1VF2A 1T00A 1YZXA 3HVVA 3UEMA 4YAPA 2H6ZA 2OBKA 1SK1A 2J9HA 3Q19A 2QA2A 1EWXA 2DJ3A 1DBYA 3TB2A 2PU9C 3UVTA 5J5NA 1GSSA 4K1FA 3IAM2 5ECPB 3FZAA 1QUWA 1Z7RA 4TR4A 3ZLPA 3L9UA 1SKWB 5B7CA 5IMAA 3FR3A 4DVCA 2VLUA 1X5DA 3JSBA 4Q5FA 4K0GA 4ZB8A 1M2BA 3H93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNS A;  1BQ7 A;  2L59 A;  4X1U A;  5JWR B;  2MBT A;  2V6K A;  5IMZ A;  3VPT A;  1JZO A;  1M9B A;  2H75 A;  1ZZY A;  3QAW A;  1Q4J A;  3KD0 A;  2RLI A;  1PN9 A;  3FZ4 A;  5EVO A;  2YWO A;  2TRX A;  4YH2 A;  2KP1 A;  3UBK A;  4RQX A;  2MBS A;  2YWM A;  2CAI A;  1ZOF A;  1R5A A;  4KAE A;  5ECI B;  1GTA A;  2CVB A;  3F6F A;  1XPV A;  3P7X A;  2CZ2 A;  1ACV A;  2YNX A;  3M9J A;  4MF6 A;  3K8N A;  5DAL A;  4GCI A;  4ZXG A;  2B5X A;  3VK9 A;  1B48 A;  2O89 A;  2GZP A;  4LL1 B;  1AUC A;  5ECS A;  2H0H A;  1THX A;  4O32 A;  3EUR A;  2BTO T;  3ZRD A;  2FLS A;  1ML6 A;  1A8Y A;  5HFI A;  2VCQ A;  2LQQ A;  3CSH A;  4NV5 A;  5B6N A;  2GDR A;  5KN2 A;  3I9V 2;  5H5S A;  2WFC A;  1Z6N A;  2KHP A;  4XTS A;  1WPI A;  5HQP A;  5G1K A;  2N5F A;  4ZL7 A;  4ML6 A;  5DQY A;  4MF5 A;  4Z7X A;  6GSW A;  1ZL9 A;  4MJC A;  5ECR B;  18GS A;  2CZ3 A;  3G7Y A;  4DSQ A;  3HJP A;  1QMV A;  2TRC P;  5G30 A;  1TRS A;  3RAZ A;  1AQX A;  2B1K A;  2YZH A;  1SK2 A;  2YV9 A;  2B6M A;  1FHE A;  1XW6 A;  1GP1 A;  1K3Y A;  3TCO A;  2EIR A;  3UBL A;  5IMV A;  4AF2 A;  4TKY A;  3QOU A;  4LA1 A;  3CMI A;  2F3M A;  4MZB A;  5IO0 A;  3CBU A;  2HZF A;  4I97 A;  4MCU A;  1BG5 A;  3GTU B;  3QFB C;  4PNG A;  1PRX A;  1TJD A;  4G10 A;  5J41 A;  4V2M A;  4QQ7 A;  4JU5 A;  5DJM A;  4MJA A;  2XPD A;  4IP1 A;  5J3R A;  2JSZ A;  1FG4 A;  6GSV A;  5KN0 A;  2L4Q A;  2DJ1 A;  4KDX A;  2H6Y A;  3NZN A;  4I8B A;  2O87 A;  1XWB A;  4IQ1 A;  2H01 A;  2C0E A;  4DEJ A;  3EWL A;  1JZD A;  4O5R A;  2WJU A;  4GXZ A;  4I5Q A;  5IQY A;  1KNG A;  1EGR A;  2ON5 A;  1K3L A;  1K0M A;  2GZY A;  9GSS A;  3IPZ A;  4IP6 A;  1A2M A;  3HCZ A;  2VO4 A;  5CRG A;  5J9C A;  16GS A;  5CRW A;  1PMT A;  1X9M B;  1GSD A;  2PMT A;  4OWY A;  2H8L A;  3GH6 A;  3FR9 A;  2LJK A;  4XS4 A;  1EV9 A;  1WE0 A;  1PX7 A;  4TVE A;  4ULX A;  1NW2 A;  1XVW A;  2QC7 A;  4D73 B;  3FRC A;  2LKU A;  4OFN A;  1XBS A;  2H1B A;  4N30 A;  1GSQ A;  5H5Q A;  3A5W A;  1BAY A;  4X43 A;  3KTB A;  1GLQ A;  2CVD A;  1BED A;  1GUL A;  1J08 A;  2IL3 A;  4NAX A;  3U6V A;  2R5G A;  4GLT A;  1ERW A;  2H76 A;  4BVY A;  5JCG A;  3IV4 A;  5ECK B;  1OVN A;  1PQN A;  5FHI A;  2VCZ A;  4K7N A;  3F4R A;  4NHZ A;  3GKX A;  4Q5R A;  1O8W A;  5INY A;  1THO A;  3TRX A;  3VI5 A;  3PH9 A;  3WYW A;  2NPB A;  3ZIJ A;  4QL7 A;  4AJ6 A;  2A2S A;  4EF0 A;  2ZNM A;  1SU9 A;  2O7K A;  1U3A A;  5JWQ B;  1XZO A;  2FNO A;  1HD2 A;  2G0F A;  2XBI A;  4WR5 A;  4F82 A;  1ZCP A;  1Z5Y E;  4AJ8 A;  3KXO A;  4LMV A;  2HXK A;  1PSQ A;  3VLN A;  3TRP A;  1AAZ A;  5B8A A;  3W8J A;  5KN3 A;  1AQV A;  3GV1 A;  1X5E A;  2H72 A;  2C8U A;  3ED3 A;  5HR0 A;  2CT6 A;  3LXZ A;  2VCT A;  3KJY A;  1B4Q A;  5DQS A;  3TRQ A;  1E6B A;  1WMJ A;  4IVF A;  3I69 A;  5CRH A;  1GLP A;  2Z9S A;  3TOU A;  1MEK A;  2L5L A;  4ID0 A;  4HUA A;  2DBC A;  1O7U A;  5GAP D;  5ECQ B;  1VF1 A;  4TN8 A;  4ZIL A;  3C7M A;  1EGO A;  2AV4 A;  3P8W A;  3EYT A;  4G19 A;  1DSB A;  2WGR A;  3DD3 A;  2GZZ A;  1SK0 A;  2WB9 A;  3GTU A;  1O8X A;  4HZ4 A;  2LRT A;  5D73 A;  1SYX A;  4EDY A;  2YP6 A;  5HFK A;  2YV7 A;  3DGQ A;  3EE2 A;  5FWG A;  3UJ1 A;  3GYK A;  3TJJ A;  2OAD A;  4O7H A;  3QMX A;  1B8X A;  1R26 A;  2BJX A;  1U87 A;  2H6X A;  4L8E A;  4JR4 A;  2PBJ A;  1W89 A;  1YJ6 A;  2V6O A;  4BL7 A;  4JZQ A;  5ID2 A;  1U3I A;  4IKH A;  5HFG A;  3CSI A;  4DSS A;  3EC3 A;  3WGE A;  5B8B A;  4HEA 2;  3HDC A;  3LQ7 A;  1NHO A;  4CHS A;  1EEM A;  2N5A A;  1QFN A;  1Z7P A;  1SD8 A;  3KIJ A;  2YJ7 A;  1H4O A;  3HVX A;  1MDJ A;  2QSI A;  1X9S B;  3OR5 A;  3FZ9 A;  1SL2 B;  1OYJ A;  2FD3 A;  1HNA A;  1I5G A;  2H19 A;  5AIX A;  4D73 A;  4PUA A;  4OCE A;  2F8A A;  3ZZX A;  3FR6 A;  4WEY A;  4TR3 A;  3VWW A;  4MPG A;  4RI7 A;  3HYP A;  4GSN A;  2X8C A;  2C0D A;  2F51 A;  1ZYQ B;  1R7H A;  3DWV A;  3KCM A;  1VF3 A;  3H4K A;  2EIQ A;  5D96 A;  3GN3 A;  4NV2 A;  5CO3 A;  5LNK e;  2CVK A;  4MMM A;  4JBB A;  2P31 A;  3Q74 A;  3QCP A;  1XOA A;  3FW2 A;  4K7I A;  4NPB A;  2ALB A;  3TJF A;  4V2N A;  1KBN A;  3QAV A;  3FYG A;  1XVQ A;  4PNF A;  1GSE A;  1A23 A;  3CTG A;  1GNW A;  3PGT A;  2AYT A;  4IGJ A;  5CYY A;  5ABR A;  2HT9 A;  4FO5 A;  3D4M A;  4NWY A;  4FYC A;  3W8S A;  1GSF A;  1T1V A;  3DYR A;  3EVI A;  2AJQ B;  1G7E A;  5AGY A;  3C1S A;  4JRR A;  2DIY A;  3HD5 A;  2GLR A;  1SKR B;  3FKF A;  3ZRE A;  3GA4 A;  4PUF C;  3VWV A;  2NDO A;  4ECJ A;  5DAK A;  2C80 A;  2IMF A;  1WP0 A;  4KSO A;  2YJH A;  1OE8 A;  3TJG A;  4XS4 B;  4POK A;  3S9F A;  1I9D A;  3AY8 A;  1GUK A;  3FHK A;  4MF7 A;  2WRT A;  3ZTL A;  5EL8 A;  5IM9 A;  4YQM A;  2LJR A;  3ME7 A;  3F8U A;  2I4A A;  2H66 A;  1F2E A;  3WT2 A;  2IFQ A;  2K8V A;  2VAF A;  1T3B A;  2V32 A;  2F9S A;  5G1L A;  4KB3 A;  3UAP A;  3ZL5 A;  2FWH A;  1K0N A;  2VL2 A;  3RBT A;  5JWO B;  19GS A;  14GS A;  4IJI A;  2I1U A;  1F37 A;  7GSS A;  5DVB A;  3F9U A;  3UMA A;  2ZCT A;  3NIV A;  3CSJ A;  4KDU A;  2BMX A;  1N2A A;  5G5E A;  4KW6 A;  1ERU A;  3EMP A;  1UA5 A;  1EEJ A;  4MK3 A;  5ECL B;  2FWG A;  4GST A;  3D5J A;  3ZYW A;  1TU8 A;  4IBP A;  3QAG A;  3ISO A;  2OE0 A;  2K9F A;  2YCD A;  2XHF A;  3LYP A;  3FZ5 A;  4XCS A;  1V57 A;  1B9Y C;  4KE3 A;  3TJB A;  1SJZ A;  2GVP A;  2CAQ A;  2E2G A;  1WWJ A;  1A0R P;  4KUN A;  2K8S A;  1HNB A;  3LFL A;  5C00 A;  1UC7 A;  1F9M A;  1J9B A;  1PX6 A;  1FAA A;  5D8I A;  5IMC A;  1MTC A;  3F4S A;  1TKD B;  2FCH A;  4N0Z A;  3ZIV A;  4EO3 A;  3MWH A;  4OMV A;  2OE3 A;  2QKE A;  1NHY A;  2O85 A;  2OKA A;  5HR2 A;  3VWU A;  3A2X A;  4V1A p;  2VOC A;  1TK8 B;  4POM A;  1ZMA A;  4GQF A;  1LBK A;  2HSH A;  1OC3 A;  1K0C A;  2IN3 A;  3UVH A;  3QDN A;  1QGV A;  3HVS A;  2H30 A;  1A8L A;  1XW9 A;  3EU3 A;  1K0O A;  3GST A;  4N10 A;  1R5P A;  1M2D A;  4EE0 A;  3KGK A;  4EUY A;  3HKR A;  3F3Q A;  2FUG 2;  3IA1 A;  5ECH B;  4G2E A;  1RQM A;  1SYR A;  2C3N A;  4EVM A;  3L9S A;  3TJK A;  5ID2 B;  5DDL A;  3DEX A;  1XXU A;  4WF4 A;  4MAB A;  2K6V A;  2VL3 A;  3HA9 A;  1DE2 A;  1GWC A;  1SL1 B;  20GS A;  5H5R A;  4DSS B;  3HHV A;  2LRC A;  5LCZ A;  1OKT A;  2HNL A;  4HU9 A;  1G7O A;  1HYU A;  1ST9 A;  4TRX A;  3ZVJ A;  2A2R A;  3IK7 A;  2YWN A;  4PUR A;  4HS1 A;  2H71 A;  2YOI A;  3FY7 A;  4MJB A;  5F8B A;  1NSW A;  2HE3 A;  5GZZ B;  2X64 A;  1QXH A;  3GIX A;  1JLV A;  3KTL A;  3O3T A;  4FYU A;  4OCF A;  4OFT A;  3Q18 A;  1O85 A;  3BCK A;  1MD4 A;  4TOP A;  3TGZ A;  2FWF A;  2VD1 A;  1XWC A;  4HQZ A;  1QQ2 A;  1TI3 A;  4MA9 A;  4V2L A;  4P3Y B;  3V1W A;  3GSS A;  2K18 A;  2VLT A;  4J57 E;  3GNJ A;  1T4Y A;  2DSA A;  1LU4 A;  2GQL A;  3CXG A;  1YDK A;  5LD0 A;  4GSS A;  4AGS A;  3IXR A;  2X99 A;  5D93 A;  5CP1 A;  4IQA A;  2C0F A;  2PUK C;  1DUG A;  2PVQ A;  4POL A;  1VRS D;  2LRN A;  2FA8 A;  2PER A;  2ON7 A;  2EC4 A;  2ZUP A;  1T8E B;  1XWK A;  4CDO A;  1G6Y A;  3KH7 A;  4TXO A;  3BOA A;  3L4N A;  2CV4 A;  2IMI A;  2DJ2 A;  6GSX A;  3VFI A;  4ZB6 A;  4IS0 A;  5DCG A;  3HXS A;  2M80 A;  2F8F A;  4F2I A;  4YAV A;  4I6X A;  3F4T A;  1BX9 A;  1X9W B;  3APS A;  3M9K A;  1FW1 A;  1LJR A;  2WS2 A;  3FK8 A;  4MP4 A;  4MDC A;  1AW9 A;  3APO A;  4MZW A;  3EU4 A;  2YPM A;  2AAW A;  1JHB A;  1CQH A;  4V1A g;  1X0R A;  2JAC A;  3ERG A;  2I3Y A;  4ML1 A;  1KTE A;  5DAK B;  3TKS E;  2GQK A;  4TXV A;  1SEN A;  2DML A;  1CQG A;  3KMN A;  3LSZ A;  3DXB A;  3I6A A;  1A2L A;  3LJR A;  2PN8 A;  2GQM A;  4F03 A;  3E9J B;  1EZK A;  5CRD A;  1XIY A;  1M0U A;  1F6M C;  1GRX A;  1W4V A;  3A2W A;  2OE1 A;  5IPG A;  5B6M A;  2PGT A;  1WOU A;  1XWG A;  2KLX A;  1WJK A;  1YY7 A;  2IFQ B;  3ERW A;  5D9T A;  3F0I A;  3M0F A;  1RK4 A;  1GTB A;  2DJK A;  4EC0 A;  2IIY A;  4KGI A;  4ECI A;  5DCH A;  3O6T A;  3ZML A;  1U6T A;  1VF4 A;  5IOX A;  2VIM A;  3IK9 A;  4WXT A;  2P5Q A;  2D2Z A;  2I81 A;  4JE1 A;  2P5R A;  4Q5N A;  2B5Y A;  2OAC A;  3ME8 A;  2IME A;  2RUE A;  10GS A;  1URM A;  4ZIJ A;  2JAD A;  2R2J A;  1XCC A;  2KUC A;  2P0G A;  2VL9 A;  4YQU A;  3QR6 A;  4HI7 A;  2RII A;  1TTZ A;  3F3R A;  2AB6 A;  5A4W A;  1GUM A;  3TKS C;  1FOV A;  3MNG A;  2L6C A;  2GST A;  3VI7 A;  2XC2 A;  4J2F A;  2JSY A;  1MD3 A;  3WGX A;  3PIN A;  5F05 A;  3QPM A;  1WIK A;  1SD9 A;  1NM3 A;  4K2D A;  2C1Y A;  5G2Z A;  1GSY A;  3LEF A;  3UAR A;  4LL4 B;  2C4J A;  4WF5 A;  5G31 A;  1TW9 A;  1S3A A;  4XIH A;  4TW5 A;  1EOG A;  3KH9 A;  8GSS A;  2JZR A;  2KOK A;  2E2M A;  2JL4 A;  2V2G A;  4WKW A;  1K0B A;  2G2Q A;  5CRE A;  2REM A;  3ZFL A;  5KN1 A;  2L6D A;  5A4V A;  3BD2 A;  3N5O A;  1TRU A;  3GKM A;  1OC9 A;  5EY6 A;  2VD0 A;  4XRA A;  4DSR A;  3IE3 A;  3ERF A;  1KEB A;  2CA8 A;  4PQ1 A;  2E0Q A;  5ENU A;  1R4W A;  1AQW A;  3GL3 A;  4MH2 A;  1EV4 A;  2R37 A;  1FVK A;  5ECN B;  4WBJ A;  4BVX A;  1A0F A;  2V41 A;  4JED A;  3UIW A;  3LYK A;  3US3 A;  4TR1 A;  1ZGN A;  2X8G A;  2DC5 A;  3RHB A;  3C71 A;  3HZ4 A;  1V58 A;  2MZC A;  4EDZ A;  1JFU A;  1K3O A;  2FWE A;  2VM1 A;  4CW9 A;  5L71 A;  4G9H A;  3RPN A;  11GS A;  2GGT A;  6GSU A;  4GWR A;  1A2J A;  3GKK A;  4MH3 A;  1O81 A;  4OO4 A;  3VUR A;  1U88 A;  4ECB A;  2DMM A;  1FVJ A;  3M3M A;  2ES7 A;  1WRY A;  2OJL A;  1G6W A;  2FY6 A;  2V1M A;  3DML A;  4ZL9 A;  4MLY A;  5F0G A;  2HI7 A;  2FHE A;  2MMA A;  1C72 A;  4WET A;  1TP9 A;  1XFL A;  3CTF A;  1IYH A;  2DJ0 A;  1B9X C;  1H75 A;  2MMO A;  5AIS A;  3KEB A;  6GST A;  2B5E A;  2LTK A;  1TK0 B;  3HY2 A;  5J9B A;  3SBC A;  2H74 A;  4I2T A;  3VPQ A;  3TOT A;  4EKZ A;  2YZU A;  3IC4 A;  1SKS B;  4L0W A;  3I43 A;  3A3T A;  3D21 A;  2C0G A;  4TXO B;  2JZT A;  4HU7 A;  3ZVJ D;  1B4P A;  3JCM L;  1EOH A;  4KH7 A;  1YF1 A;  3KZQ A;  4ZB9 A;  5D9W A;  1V98 A;  2WCI A;  1TDI A;  2B3S A;  2H1D A;  3A2V A;  1M2A A;  5D9X A;  3EIN A;  5DJL A;  5IOW A;  3G7J A;  4OD7 A;  3GX0 A;  4IEL A;  2WDU A;  4HOJ A;  2WUL A;  3F6D A;  5ECM B;  3IBH A;  2GT5 A;  2IPA A;  3UOM A;  4JR6 A;  1BJX A;  3C1R A;  3MDK A;  1PKZ A;  2B7J A;  4FYB A;  2VCV A;  2VCX A;  2XBQ A;  1PA3 A;  3D0Z A;  3G9B A;  4LMW A;  1GL8 A;  3LGC A;  1F3A A;  4RI6 A;  3ZFB A;  5HR3 A;  3WGD A;  4K0N A;  1MDI A;  3QD9 A;  5KEJ A;  5F06 A;  4LLR A;  1V2A A;  4GRF A;  2GTU A;  1XOB A;  3WT1 A;  3O76 A;  3APQ A;  1M99 A;  2HZE A;  1FB0 A;  3F63 A;  4K9Z A;  4HDE A;  1G0T A;  2M72 A;  2A4V A;  4O92 A;  1JZR A;  4L0U A;  2HFD A;  1GSU A;  1ON4 A;  2H73 A;  3NOF A;  4WBR D;  1AIU A;  3DVW A;  3PR8 A;  3DRN A;  1ILO A;  5HR1 A;  5C04 A;  2RM5 A;  3EMX A;  3WD6 A;  2HRF A;  1TU7 A;  3GUR A;  4OO5 A;  4GF0 A;  4E8H A;  3TUE A;  3ZIT A;  4MZC A;  3GFK A;  2OA7 A;  1YQ1 A;  3IAS 2;  4TR0 A;  2MMZ A;  1PKW A;  4KSM A;  5AN1 A;  3ZMK A;  3MAK A;  5CNW A;  1Q98 A;  1EP7 A;  1YEP A;  4ISD A;  4KCE A;  1TOF A;  4GTU A;  3MSZ A;  1AC1 A;  1EP8 A;  1M7T A;  4FIW A;  1A24 A;  1FO5 A;  4BA7 A;  1O73 A;  5GAN D;  4NHW A;  5ELG A;  3U5R E;  5F07 A;  4MJE A;  2GSQ A;  3BJ5 A;  3GUS A;  1GH2 A;  5FT3 A;  3H79 A;  4ZBD A;  3TKS A;  3H1N A;  2TIR A;  1GTI A;  2XPE A;  3TKP A;  3FEU A;  3BBY A;  3GX8 A;  2GS3 A;  3UL3 A;  1PL1 A;  1PL2 A;  5GST A;  4L5O A;  3IRA A;  1ABA A;  2NBS A;  4PX1 A;  3R2Q A;  4IN0 A;  3C8E A;  2MYG A;  3HZ8 A;  1S3C A;  1J0F A;  2X8H A;  3Q6O A;  4XRD A;  3M8N A;  1IYI A;  3BCI A;  3P2A A;  3GHA A;  12GS A;  3GMF A;  4F0B A;  1T4Z A;  1YKA A;  4XS6 A;  3IHQ A;  1TK5 B;  4POB A;  4EL1 A;  2FGX A;  4I2U A;  4ZBB A;  4PXO A;  3C73 A;  2LNT A;  2L4C A;  2LQO A;  1YKC A;  2IMD A;  1RW1 A;  3CRU A;  2DJJ A;  2MMN A;  4WR4 A;  3E3E A;  1XW5 A;  1Y25 A;  4N11 A;  2HSY A;  2DLX A;  3KP8 A;  2JZS A;  2H70 A;  5IIZ A;  4KDY A;  5IO2 A;  1YEX A;  2B1L A;  2GSR A;  3LOR A;  3H8Q A;  1K0A A;  2QGV A;  2YN1 A;  2LUS A;  1AXD A;  1DE1 A;  1OC9 B;  1FB6 A;  5DBQ A;  1VGL A;  13GS A;  22GS A;  4NXI A;  2R3X A;  2VLV A;  2I9H A;  2VL2 C;  2L5O A;  3D4T A;  4IW9 A;  2H0I A;  3DVX A;  3HJO A;  5AIV A;  1GUH A;  2L57 A;  1V40 A;  2NVL A;  4HJM A;  2HRN A;  5IMF A;  4TR1 B;  1TRV A;  3J7Y b;  1ERT A;  1OKD A;  6GSY A;  4GQC A;  5ELA A;  1S3D A;  4HQS A;  2C3Q A;  2CX3 A;  1JZW A;  1GTU A;  4IJ3 A;  5JCU A;  17GS A;  3LWA A;  5EPF A;  4QL9 A;  1XWA A;  2CQ9 A;  4KA0 A;  2N5B A;  4ZL8 A;  4J56 E;  4ECC A;  2R4V A;  6GSS A;  4IHU A;  3GH9 A;  3CRT A;  2EIO A;  3IDV A;  4PGT A;  3IOS A;  1F3B A;  2H0G A;  5E59 A;  3TDG A;  4RQR A;  2GSS A;  4XS1 A;  4BPY A;  1Z3E A;  3CYN A;  3SWL A;  1T7P B;  3DIE A;  2DIZ A;  5G5F A;  2VM2 A;  2IWT A;  1M9A A;  1BYE A;  1UN2 A;  1K0D A;  2VCW A;  3P90 A;  5D9V A;  2RUF A;  2HYX A;  1OE7 A;  3L78 A;  1SJI A;  1Z6M A;  2YAN A;  2H1A A;  4ACS A;  2M46 A;  4AJ7 A;  1OC8 A;  2LV3 A;  4RUV A;  3GKN A;  1TXX A;  4K7O A;  4HZ2 A;  4Q5Q A;  1O6J A;  3QFA C;  4F0C A;  4EXJ A;  2FA4 A;  2R6K A;  4XHM A;  2GT6 A;  3VWX A;  2E7P A;  4L5L A;  2OBI A;  1X5C A;  2H1G A;  1YF0 A;  5COH A;  4PQI A;  5A5K A;  4PQH A;  1TRW A;  5IMD A;  2YWI A;  5CAX A;  5DAL B;  4KX4 A;  4BWS A;  2AUV A;  4K6X A;  2B7K A;  3KMO A;  2IMK A;  1ERV A;  1MDK A;  1SJ6 A;  1Z9H A;  3D6I A;  5J4U A;  1OAZ A;  3D22 A;  4MPF A;  2RM6 A;  4HJ2 A;  1V9W A;  1HNC A;  2JU5 A;  4KCA A;  1HQO A;  2PVO C;  2KP2 A;  4BWQ A;  1PGT A;  3L9V A;  1QK8 A;  3GRX A;  4E8E A;  5JCW A;  5IPH A;  2O8V B;  3TKQ A;  1JLW A;  2PWJ A;  4YQV A;  3DKS A;  3IR4 A;  1E2Y A;  2HZE B;  3HJM A;  2AHE A;  2C3T A;  1SL0 B;  2CX4 A;  3LG6 A;  1GNE A;  3TKR A;  3N9J A;  3J7Y k;  4ILF A;  4K8M A;  4NMU A;  1USB A;  4N0V A;  3M1G A;  4F9Z A;  3RHC A;  2LST A;  1N8J A;  1ZYE A;  4KND A;  3L0H A;  1TI1 A;  5GSS A;  2VUP A;  1UVZ A;  3W6G A;  4OFM A;  1PD2 1;  5ECO B;  1Y6E A;  3LXT A;  3RPP A;  3G7I A;  2NTO A;  3E0U A;  3GL5 A;  5E4W A;  4ZBA A;  2LEG A;  3RDW A;  2LS5 A;  2WZ9 A;  2PPT A;  3KM6 A;  2HLS A;  4FH8 A;  2J23 A;  2IJY A;  3KP9 A;  4X0X A;  4H86 A;  2LJA A;  5A4U A;  1VF2 A;  1T00 A;  1YZX A;  3HVV A;  3UEM A;  4YAP A;  2H6Z A;  2OBK A;  1SK1 A;  2J9H A;  3Q19 A;  1EWX A;  2DJ3 A;  1DBY A;  3TB2 A;  2PU9 C;  3UVT A;  5J5N A;  1GSS A;  4K1F A;  3IAM 2;  5ECP B;  3FZA A;  1QUW A;  1Z7R A;  4TR4 A;  3ZLP A;  3L9U A;  1SKW B;  5B7C A;  5IMA A;  3FR3 A;  4DVC A;  2VLU A;  1X5D A;  4Q5F A;  4ZB8 A;  4K0G A;  1M2B A;  3H93 A; 
#chains in the Genus database with same CATH topology
 2LNS A;  1BQ7 A;  2L59 A;  2V1C C;  4JCV E;  4X1U A;  5JWR B;  2MBT A;  2V6K A;  5IMZ A;  3VPT A;  1JZO A;  1M9B A;  2H75 A;  1ZZY A;  3QAW A;  4OAV B;  1Q4J A;  3KD0 A;  2RLI A;  1PN9 A;  3LJ1 A;  4K5R A;  3FZ4 A;  5EVO A;  2YWO A;  2TRX A;  4YH2 A;  2KP1 A;  3UBK A;  4G76 A;  4RQX A;  2MBS A;  2YWM A;  2CAI A;  1ZOF A;  1R5A A;  4KAE A;  5ECI B;  1GTA A;  2CVB A;  3F6F A;  1XPV A;  3P7X A;  4GXT A;  2A2C A;  2CZ2 A;  1ACV A;  2YNX A;  3M9J A;  4MF6 A;  3K8N A;  5DAL A;  3I9V 1;  4GCI A;  4ZXG A;  4G75 A;  2B5X A;  3VK9 A;  1B48 A;  2O89 A;  2GZP A;  4LL1 B;  1AUC A;  5ECS A;  2P22 B;  2H0H A;  1THX A;  4O32 A;  3EUR A;  2BTO T;  3ZRD A;  2FLS A;  1ML6 A;  1A8Y A;  5HFI A;  2VCQ A;  2LQQ A;  3CSH A;  4NV5 A;  5B6N A;  2GDR A;  5KN2 A;  3I9V 2;  2JB2 A;  5H5S A;  2WFC A;  1Z6N A;  2KHP A;  4XTS A;  1WPI A;  2F66 B;  5HQP A;  5G1K A;  2N5F A;  4ZL7 A;  1JQO A;  4ML6 A;  4Z7X A;  4MF5 A;  5DQY A;  6GSW A;  1ZL9 A;  4MJC A;  5ECR B;  18GS A;  2CZ3 A;  3G7Y A;  4DSQ A;  4I1T A;  3HJP A;  1QMV A;  2TRC P;  5G30 A;  1TRS A;  4Z7G A;  3RAZ A;  1AQX A;  2B1K A;  4PL3 A;  2YZH A;  1SK2 A;  2YV9 A;  2B6M A;  1FHE A;  1XW6 A;  1GP1 A;  1K3Y A;  3TCO A;  2EIR A;  2MJF B;  3UBL A;  5IMV A;  4AF2 A;  4TKY A;  3QOU A;  4LA1 A;  3CMI A;  2F3M A;  4MZB A;  5IO0 A;  3CBU A;  3FMW A;  2HZF A;  4I97 A;  4MCU A;  1BG5 A;  2CAZ B;  3GTU B;  3QFB C;  4PNG A;  1PRX A;  1TJD A;  4G10 A;  2QA1 A;  5J41 A;  4V2M A;  4QQ7 A;  4JU5 A;  5DJM A;  4MJA A;  2XPD A;  4IP1 A;  5J3R A;  2JSZ A;  1FG4 A;  6GSV A;  5KN0 A;  2JAE A;  2A2P A;  2L1L B;  2L4Q A;  2DJ1 A;  4KDX A;  2H6Y A;  4BL7 B;  3NZN A;  4I8B A;  3SDJ A;  2O87 A;  1XWB A;  4IQ1 A;  2H01 A;  3PPU A;  2C0E A;  4DEJ A;  3EWL A;  1JZD A;  4O5R A;  2WJU A;  4GXZ A;  4I5Q A;  5IQY A;  1KNG A;  1EGR A;  2ON5 A;  1K3L A;  1K0M A;  4PL4 A;  2GZY A;  9GSS A;  3IPZ A;  4IP6 A;  1ZYP A;  1A2M A;  3HCZ A;  2VO4 A;  5CRG A;  5J9C A;  16GS A;  5CRW A;  1PMT A;  1X9M B;  1GSD A;  2PMT A;  4OWY A;  2H8L A;  3GH6 A;  3FR9 A;  2LJK A;  4XS4 A;  1EV9 A;  1WE0 A;  1PX7 A;  4TVE A;  4ULX A;  1NW2 A;  1XVW A;  2QC7 A;  4D73 B;  3FRC A;  2LKU A;  4OFN A;  1XBS A;  2H1B A;  4N30 A;  1GSQ A;  5H5Q A;  3A5W A;  1BAY A;  4X43 A;  3KTB A;  1GLQ A;  2CVD A;  1BED A;  1GUL A;  4U6R A;  5LNK 1;  1J08 A;  2IL3 A;  4NAX A;  3U6V A;  2R5G A;  4GLT A;  1ERW A;  4O5Q A;  2H76 A;  4BVY A;  5JCG A;  3IV4 A;  5ECK B;  1OVN A;  1PQN A;  5FHI A;  2VCZ A;  4K7N A;  3F4R A;  4NHZ A;  4G0L A;  3GKX A;  4Q5R A;  1O8W A;  5INY A;  2BL7 A;  4K5S A;  1THO A;  3TRX A;  3VI5 A;  3PH9 A;  3WYW A;  2ZRR A;  2NPB A;  3ZIJ A;  4QL7 A;  2JBW A;  2R0G A;  4AJ6 A;  2A2S A;  4EF0 A;  2ZNM A;  1SU9 A;  2O7K A;  1U3A A;  5JWQ B;  2X49 A;  1XZO A;  2FNO A;  1HD2 A;  2G0F A;  2XBI A;  4WR5 A;  4F82 A;  1ZCP A;  1Z5Y E;  4AJ8 A;  3KXO A;  4LMV A;  2HXK A;  1PSQ A;  3VLN A;  3TRP A;  1AAZ A;  5B8A A;  3W8J A;  5KN3 A;  1AQV A;  3GV1 A;  1X5E A;  2H72 A;  2C8U A;  3ED3 A;  5HR0 A;  4YKF A;  2CT6 A;  3LXZ A;  2VCT A;  3KJY A;  1B4Q A;  5DQS A;  3TRQ A;  1E6B A;  1WMJ A;  4IVF A;  3I69 A;  5CRH A;  1GLP A;  4Z2U A;  2Z9S A;  3TOU A;  1MEK A;  2L5L A;  4ID0 A;  4HUA A;  2DBC A;  1O7U A;  5GAP D;  5ECQ B;  1VF1 A;  4TN8 A;  4ZIL A;  3C7M A;  1EGO A;  2AV4 A;  3P8W A;  3EYT A;  4G19 A;  1DSB A;  2WGR A;  3DD3 A;  2GZZ A;  1SK0 A;  2WB9 A;  3GTU A;  3DA3 A;  1O8X A;  4HZ4 A;  2LRT A;  5D73 A;  1SYX A;  4EDY A;  2YP6 A;  5HFK A;  2YV7 A;  3DGQ A;  3EE2 A;  2DKI A;  5FWG A;  3UJ1 A;  3GYK A;  3TJJ A;  2OAD A;  3QMX A;  4O7H A;  3CQF A;  1B8X A;  1R26 A;  2BJX A;  2DKH A;  1U87 A;  2H6X A;  4L8E A;  4JR4 A;  2PBJ A;  1W89 A;  1YJ6 A;  2ETD A;  2V6O A;  4BL7 A;  4JZQ A;  5ID2 A;  1U3I A;  4IKH A;  5HFG A;  3CSI A;  4DSS A;  3EC3 A;  3WGE A;  5B8B A;  4HEA 2;  3HDC A;  3LQ7 A;  1NHO A;  4CHS A;  4EIQ A;  1EEM A;  2N5A A;  1QFN A;  1Z7P A;  1SD8 A;  3KIJ A;  2YJ7 A;  1H4O A;  3HVX A;  4YZ9 A;  1MDJ A;  2QSI A;  4EIP A;  1X9S B;  3OR5 A;  3FZ9 A;  3VA9 A;  1SL2 B;  1OYJ A;  1PN0 A;  2FD3 A;  1HNA A;  1I5G A;  2H19 A;  5AIX A;  4D73 A;  4PUA A;  4OCE A;  3IHG A;  2F8A A;  3ZZX A;  3FR6 A;  4WEY A;  4TR3 A;  2V6E A;  3VWW A;  4MPG A;  2JB1 A;  4RI7 A;  3HYP A;  4GSN A;  2ZW3 A;  5HGI A;  2X8C A;  4O1O A;  2QGM A;  2C0D A;  2F51 A;  1ZYQ B;  1R7H A;  3DWV A;  3KCM A;  1VF3 A;  3H4K A;  2EIQ A;  5D96 A;  3GN3 A;  4NV2 A;  5CO3 A;  5LNK e;  2CVK A;  4MMM A;  4JBB A;  2P31 A;  3Q74 A;  3QCP A;  1FOH A;  1XOA A;  3FW2 A;  4K7I A;  4NPB A;  2ALB A;  3TJF A;  4V2N A;  1KBN A;  3QAV A;  3FYG A;  1XVQ A;  4PNF A;  1GSE A;  1A23 A;  3CTG A;  1GNW A;  3PGT A;  2AYT A;  4IGJ A;  5CYY A;  5ABR A;  2HT9 A;  4FO5 A;  2HSM A;  3D4M A;  4NWY A;  4FYC A;  3W8S A;  1GSF A;  1T1V A;  3DYR A;  3EVI A;  2AJQ B;  1G7E A;  5AGY A;  3C1S A;  4JRR A;  2DIY A;  3HD5 A;  2GLR A;  1SKR B;  3FKF A;  3ZRE A;  3GA4 A;  4PUF C;  3VWV A;  2NDO A;  3Q8D A;  4ECJ A;  5DAK A;  2BL8 A;  2C80 A;  2IMF A;  1WP0 A;  4KSO A;  2YJH A;  1OE8 A;  3TJG A;  4XS4 B;  4POK A;  3S9F A;  1I9D A;  3AY8 A;  1GUK A;  4PL5 A;  3FHK A;  4MF7 A;  2WRT A;  3ZTL A;  5EL8 A;  5IM9 A;  4YQM A;  2LJR A;  3ME7 A;  3F8U A;  2I4A A;  2H66 A;  1F2E A;  3WT2 A;  2IFQ A;  2K8V A;  2VAF A;  1T3B A;  2V32 A;  2F9S A;  5G1L A;  4KB3 A;  3UAP A;  3ZL5 A;  2FWH A;  2XTR A;  1K0N A;  2VL2 A;  3RBT A;  5JWO B;  19GS A;  14GS A;  4IJI A;  4CY8 A;  2I1U A;  1F37 A;  7GSS A;  5DVB A;  3F9U A;  3UMA A;  2ZCT A;  4BVY B;  3NIV A;  3CSJ A;  4KDU A;  2BMX A;  4CY6 A;  1N2A A;  5G5E A;  3A5I A;  4KW6 A;  1ERU A;  3EMP A;  1UA5 A;  1EEJ A;  4MK3 A;  5ECL B;  2FWG A;  4GST A;  3D5J A;  3ZYW A;  1TU8 A;  4IBP A;  3QAG A;  3ISO A;  2OE0 A;  2K9F A;  2YCD A;  2XHF A;  3LYP A;  3FZ5 A;  4XCS A;  1V57 A;  1B9Y C;  4KE3 A;  3TJB A;  1SJZ A;  4G0K A;  2GVP A;  2CAQ A;  2E2G A;  1WWJ A;  1A0R P;  4KUN A;  2K8S A;  1HNB A;  3LFL A;  5C00 A;  1UC7 A;  1YO7 A;  1F9M A;  1J9B A;  1PX6 A;  1FAA A;  5D8I A;  5IMC A;  1MTC A;  3F4S A;  1TKD B;  4Z2R A;  4Z7H A;  2FCH A;  2FU2 A;  4N0Z A;  3ZIV A;  4EO3 A;  3MWH A;  4OMV A;  2OE3 A;  2QKE A;  1NHY A;  2O85 A;  2OKA A;  5HR2 A;  3VWU A;  3A2X A;  4V1A p;  3IAS 1;  2VOC A;  1TK8 B;  4POM A;  1ZMA A;  2FUG 1;  4GQF A;  1LBK A;  2HSH A;  1OC3 A;  1K0C A;  2IN3 A;  1PFO A;  3UVH A;  3QDN A;  1QGV A;  3HVS A;  2H30 A;  1A8L A;  1XW9 A;  3EU3 A;  1K0O A;  3GST A;  4N10 A;  1R5P A;  1M2D A;  4EE0 A;  3KGK A;  4EUY A;  3HKR A;  2R0P A;  3F3Q A;  2FUG 2;  3IA1 A;  5ECH B;  4G2E A;  1RQM A;  1SYR A;  2C3N A;  4EVM A;  3L9S A;  3TJK A;  5ID2 B;  5DDL A;  3DEX A;  1XXU A;  4WF4 A;  4MAB A;  2K6V A;  2VL3 A;  3HA9 A;  1DE2 A;  1GWC A;  1SL1 B;  20GS A;  5H5R A;  4DSS B;  3HHV A;  2LRC A;  5LCZ A;  3DA4 A;  1OKT A;  2HNL A;  4HU9 A;  1G7O A;  1HYU A;  1ST9 A;  4TRX A;  3ZVJ A;  2A2R A;  4G0I A;  3IK7 A;  2YWN A;  4PUR A;  4HS1 A;  2H71 A;  2YOI A;  1S3R A;  3FY7 A;  4MJB A;  5KOW A;  5F8B A;  4O1P A;  1NSW A;  2HE3 A;  5GZZ B;  2X64 A;  1QXH A;  3GIX A;  1JLV A;  3KTL A;  3O3T A;  4FYU A;  4OCF A;  4OFT A;  3Q18 A;  1O85 A;  3BCK A;  1MD4 A;  2KKM A;  4TOP A;  4MNN A;  3TGZ A;  2FWF A;  2VD1 A;  1XWC A;  4HQZ A;  1QQ2 A;  1TI3 A;  4MA9 A;  4V2L A;  4P3Y B;  3V1W A;  3GSS A;  2K18 A;  2VLT A;  4J57 E;  3GNJ A;  1T4Y A;  2DSA A;  1LU4 A;  2GQL A;  3CXG A;  1YDK A;  5LD0 A;  4GSS A;  4AGS A;  3IXR A;  2X99 A;  5D93 A;  5CP1 A;  4YKG A;  4IQA A;  2C0F A;  2PUK C;  1DUG A;  2PVQ A;  4POL A;  3R3E A;  1VRS D;  2LRN A;  2FA8 A;  2PER A;  1XG8 A;  2EC4 A;  2ON7 A;  2ZUP A;  1T8E B;  1XWK A;  2R0C A;  4CDO A;  1G6Y A;  3KH7 A;  4TXO A;  3BOA A;  3L4N A;  2CV4 A;  2IMI A;  2DJ2 A;  6GSX A;  3VFI A;  4ZB6 A;  4IS0 A;  3LJ2 A;  5DCG A;  3HXS A;  2M80 A;  2F8F A;  4F2I A;  4YAV A;  4I6X A;  3F4T A;  1BX9 A;  1X9W B;  3APS A;  3M9K A;  1FW1 A;  1LJR A;  2WS2 A;  3FK8 A;  4MP4 A;  4MDC A;  3L0I A;  1AW9 A;  3APO A;  4MZW A;  3EU4 A;  2YPM A;  2AAW A;  4A5P A;  1JHB A;  4USS A;  1CQH A;  4V1A g;  1X0R A;  2JAC A;  3ERG A;  2I3Y A;  4ML1 A;  1KTE A;  5DAK B;  3TKS E;  2GQK A;  4TXV A;  1SEN A;  2DML A;  1CQG A;  3KMN A;  3LSZ A;  3DXB A;  3I6A A;  1A2L A;  3LJR A;  2PN8 A;  2GQM A;  4F03 A;  3E9J B;  1EZK A;  5CRD A;  1XIY A;  1M0U A;  1F6M C;  1GRX A;  1W4V A;  3A2W A;  2OE1 A;  5IPG A;  5B6M A;  2PGT A;  1WOU A;  1XWG A;  2KLX A;  1WJK A;  1YY7 A;  2IFQ B;  3ERW A;  5D9T A;  3F0I A;  3M0F A;  1RK4 A;  1GTB A;  2DJK A;  4EC0 A;  2IIY A;  4KGI A;  4ECI A;  5DCH A;  3O6T A;  3ZML A;  1U6T A;  1VF4 A;  5IOX A;  2VIM A;  3IK9 A;  4WXT A;  2P5Q A;  2A4H A;  2D2Z A;  2K19 A;  2I81 A;  4JE1 A;  2P5R A;  4Q5N A;  2B5Y A;  2OAC A;  3ME8 A;  2IME A;  2HRK A;  2RUE A;  10GS A;  1URM A;  4ZIJ A;  2JAD A;  2R2J A;  1XCC A;  2KUC A;  2P0G A;  2VL9 A;  4YQU A;  3QR6 A;  4HI7 A;  2RII A;  1TTZ A;  3F3R A;  4YZD A;  2AB6 A;  5A4W A;  1GUM A;  3TKS C;  1FOV A;  3MNG A;  2L6C A;  2GST A;  1ZYN A;  3VI7 A;  3F4M A;  2XC2 A;  1U5K A;  4J2F A;  2JSY A;  1MD3 A;  3WGX A;  3PIN A;  5F05 A;  3QPM A;  1WIK A;  1SD9 A;  1NM3 A;  4K2D A;  2C1Y A;  5G2Z A;  1GSY A;  3LEF A;  3UAR A;  4LL4 B;  2C4J A;  4WF5 A;  5G31 A;  1TW9 A;  1S3A A;  4XIH A;  4TW5 A;  1EOG A;  3KH9 A;  8GSS A;  2JZR A;  2KOK A;  4O5U A;  2E2M A;  2JL4 A;  2V2G A;  3FBV A;  3FVV A;  4WKW A;  1K0B A;  2G2Q A;  5CRE A;  2REM A;  3ZFL A;  5KN1 A;  2L6D A;  5A4V A;  3BD2 A;  3LJ0 A;  3N5O A;  4PTS A;  4X4J A;  1TRU A;  3GKM A;  1OC9 A;  5EY6 A;  2VD0 A;  4XRA A;  4DSR A;  3IE3 A;  3ERF A;  1KEB A;  2CA8 A;  4PQ1 A;  2E0Q A;  5ENU A;  1R4W A;  1AQW A;  3GL3 A;  4MH2 A;  1EV4 A;  2R37 A;  1FVK A;  5ECN B;  4WBJ A;  4BVX A;  1A0F A;  2V41 A;  4JED A;  3UIW A;  3LYK A;  3US3 A;  4TR1 A;  1ZGN A;  2X8G A;  3DO9 A;  2DC5 A;  3RHB A;  3C71 A;  5KOX A;  1SJ8 A;  3HZ4 A;  1V58 A;  2MZC A;  4EDZ A;  1JFU A;  1K3O A;  2FWE A;  2VM1 A;  4CW9 A;  5L71 A;  4G9H A;  3RPN A;  11GS A;  2GGT A;  6GSU A;  4GWR A;  1A2J A;  3GKK A;  4MH3 A;  1O81 A;  4OO4 A;  3VUR A;  1U88 A;  2XMX A;  4ECB A;  2DMM A;  1FVJ A;  3M3M A;  2ES7 A;  1WRY A;  2OJL A;  1G6W A;  2FY6 A;  2V1M A;  3DML A;  4ZL9 A;  4MLY A;  2RLD A;  5F0G A;  2HI7 A;  2FHE A;  4DWL A;  2MMA A;  1C72 A;  4WET A;  1TP9 A;  1XFL A;  3CTF A;  1IYH A;  2DJ0 A;  1B9X C;  1H75 A;  3MYD A;  2MMO A;  5AIS A;  3KEB A;  6GST A;  2B5E A;  4AS2 A;  2LTK A;  1TK0 B;  3HY2 A;  5J9B A;  3SBC A;  2H74 A;  4I2T A;  3VPQ A;  3TOT A;  4EKZ A;  2YZU A;  3IC4 A;  1SKS B;  4L0W A;  3I43 A;  3A3T A;  3D21 A;  2C0G A;  4TXO B;  2JZT A;  4HU7 A;  3ZVJ D;  1B4P A;  3JCM L;  1EOH A;  4KH7 A;  1YF1 A;  3KZQ A;  4ZB9 A;  5D9W A;  1TDP A;  1V98 A;  2WCI A;  1TDI A;  2B3S A;  2H1D A;  3A2V A;  1M2A A;  5D9X A;  3EIN A;  5DJL A;  3P23 A;  3AJF A;  5IOW A;  3G7J A;  4OD7 A;  3GX0 A;  4IEL A;  2WDU A;  4HOJ A;  2WUL A;  3F6D A;  5ECM B;  3IBH A;  2GT5 A;  2IPA A;  4AS3 A;  3IC8 A;  3UOM A;  4JR6 A;  1BJX A;  3C1R A;  3MDK A;  1PKZ A;  1M3I A;  2B7J A;  4FYB A;  2VCV A;  2VCX A;  2XBQ A;  3UIT A;  1PA3 A;  2X4A A;  3D0Z A;  3G9B A;  4LMW A;  1GL8 A;  3LGC A;  1F3A A;  4RI6 A;  3ZFB A;  5HR3 A;  3WGD A;  4K0N A;  1MDI A;  3QD9 A;  5KEJ A;  5F06 A;  4K2X A;  4LLR A;  1V2A A;  4GRF A;  2GTU A;  1XOB A;  3WT1 A;  3O76 A;  3APQ A;  1M99 A;  2HZE A;  1FB0 A;  3F63 A;  4K9Z A;  4HDE A;  1G0T A;  2M72 A;  2A4V A;  4O92 A;  1JZR A;  4L0U A;  2HFD A;  1GSU A;  1ON4 A;  2H73 A;  3NOF A;  4WBR D;  1AIU A;  3DVW A;  3PR8 A;  3DRN A;  1ILO A;  5HR1 A;  5C04 A;  2RM5 A;  3EMX A;  3WD6 A;  2HRF A;  1TU7 A;  3GUR A;  4OO5 A;  4GF0 A;  4E8H A;  3TUE A;  3ZIT A;  4MZC A;  3GFK A;  2OA7 A;  5BMU A;  1YQ1 A;  3IAS 2;  4TR0 A;  2MMZ A;  1PKW A;  4KSM A;  5AN1 A;  3ZMK A;  3MAK A;  5CNW A;  1Q98 A;  3HVN A;  1EP7 A;  2UZ8 A;  4ICY A;  1YEP A;  4ISD A;  4KCE A;  1TOF A;  4GTU A;  2QSB A;  3MSZ A;  1AC1 A;  1EP8 A;  1M7T A;  4FIW A;  1A24 A;  1FO5 A;  2JB3 A;  4BA7 A;  1O73 A;  5GAN D;  4NHW A;  5ELG A;  3U5R E;  5F07 A;  4MJE A;  2GSQ A;  3BJ5 A;  3GUS A;  1GH2 A;  5FT3 A;  3H79 A;  4ZBD A;  3TKS A;  3H1N A;  2TIR A;  1GTI A;  2XPE A;  3TKP A;  3FEU A;  3BBY A;  3GX8 A;  3MIX A;  2GS3 A;  3UL3 A;  1PL1 A;  1PL2 A;  5GST A;  4L5O A;  3IRA A;  1ABA A;  2NBS A;  4PX1 A;  3R2Q A;  4IN0 A;  3C8E A;  2MYG A;  3HZ8 A;  1S3C A;  1J0F A;  2X8H A;  5BRT A;  3Q6O A;  4XRD A;  3M8N A;  1IYI A;  3BCI A;  3P2A A;  3GHA A;  12GS A;  3GMF A;  2YFA A;  4F0B A;  1T4Z A;  1YKA A;  4XS6 A;  2FEF A;  3IHQ A;  1TK5 B;  4POB A;  4EL1 A;  2FGX A;  4I2U A;  4ZBB A;  4PXO A;  3C73 A;  2LNT A;  2L4C A;  2LQO A;  1YKC A;  2IMD A;  1RW1 A;  3CRU A;  2DJJ A;  2MMN A;  4WR4 A;  3E3E A;  1XW5 A;  1Y25 A;  4N11 A;  2HSY A;  2DLX A;  3KP8 A;  2JZS A;  2F6M B;  2H70 A;  5IIZ A;  4KDY A;  5IO2 A;  1YEX A;  2B1L A;  2GSR A;  3LOR A;  3FNB A;  3H8Q A;  3B55 A;  1K0A A;  4Q9V A;  2QGV A;  2YN1 A;  2LUS A;  1AXD A;  1DE1 A;  1OC9 B;  1FB6 A;  5DBQ A;  1VGL A;  13GS A;  22GS A;  4NXI A;  2R3X A;  2VLV A;  2I9H A;  2VL2 C;  2L5O A;  2RIO A;  3D4T A;  4IW9 A;  2H0I A;  3DVX A;  2XTQ A;  3HJO A;  5AIV A;  1GUH A;  2L57 A;  1V40 A;  2NVL A;  4BVX B;  4HJM A;  2HRN A;  5IMF A;  4TR1 B;  1TRV A;  3J7Y b;  1ERT A;  1OKD A;  6GSY A;  4GQC A;  2HGK A;  5ELA A;  1S3D A;  4HQS A;  2C3Q A;  2CX3 A;  1JZW A;  1GTU A;  4IJ3 A;  5JCU A;  4BIK A;  17GS A;  3LWA A;  5EPF A;  4QL9 A;  1XWA A;  2CQ9 A;  4KA0 A;  2N5B A;  4ZL8 A;  4J56 E;  4ECC A;  2R4V A;  6GSS A;  4IHU A;  3GH9 A;  3CRT A;  2EIO A;  3IDV A;  2A2D A;  2HRA A;  4PGT A;  3IOS A;  1F3B A;  2H0G A;  5E59 A;  3TDG A;  4RQR A;  2GSS A;  4XS1 A;  4BPY A;  1Z3E A;  3CYN A;  3SWL A;  1T7P B;  3DIE A;  2DIZ A;  5G5F A;  2VM2 A;  2IWT A;  1M9A A;  1BYE A;  1UN2 A;  2YFB A;  1K0D A;  2VCW A;  3P90 A;  5D9V A;  2RUF A;  2HYX A;  1OE7 A;  3L78 A;  1SJI A;  4Z2T A;  1Z6M A;  2YAN A;  2H1A A;  4ACS A;  2M46 A;  4AJ7 A;  1OC8 A;  2LV3 A;  4RUV A;  3GKN A;  1TXX A;  4K7O A;  4HZ2 A;  4Q5Q A;  2GSC A;  1O6J A;  3QFA C;  4F0C A;  4EXJ A;  2FA4 A;  2R6K A;  4XHM A;  4HFV A;  2GT6 A;  3VWX A;  2E7P A;  4L5L A;  2OBI A;  1X5C A;  2H1G A;  1YF0 A;  4OAU C;  4HEA 1;  5COH A;  4PQI A;  2QZG A;  5A5K A;  4PQH A;  1TRW A;  5IMD A;  2YWI A;  5CAX A;  5DAL B;  4KX4 A;  4BWS A;  2AUV A;  4K6X A;  2B7K A;  3KMO A;  2IMK A;  1W3S A;  1ERV A;  1MDK A;  1SJ6 A;  1Z9H A;  3D6I A;  5J4U A;  1OAZ A;  3D22 A;  4MPF A;  2RM6 A;  1M3J A;  4HJ2 A;  1V9W A;  1HNC A;  2JU5 A;  4KCA A;  1HQO A;  2PVO C;  2KP2 A;  4BWQ A;  1PGT A;  3L9V A;  1QK8 A;  3GRX A;  4E8E A;  5JCW A;  5IPH A;  2O8V B;  3TKQ A;  1JLW A;  2E8G A;  2PWJ A;  4YQV A;  3DKS A;  3IR4 A;  4YZC A;  1E2Y A;  4FQU A;  2HZE B;  3HJM A;  2AHE A;  2C3T A;  1SL0 B;  2CX4 A;  3LG6 A;  1GNE A;  3TKR A;  3N9J A;  3J7Y k;  4ILF A;  4K8M A;  4NMU A;  1USB A;  2IP6 A;  4KF9 A;  4N0V A;  3M1G A;  4F9Z A;  3RHC A;  2LST A;  1N8J A;  1ZYE A;  4KND A;  3L0H A;  1TI1 A;  5GSS A;  3EPT A;  2VUP A;  1UVZ A;  3W6G A;  4OFM A;  1PD2 1;  5ECO B;  1Y6E A;  3LXT A;  3RPP A;  3G7I A;  2NTO A;  3E0U A;  3GL5 A;  5E4W A;  4ZBA A;  2LEG A;  3RDW A;  2LS5 A;  2WZ9 A;  2PPT A;  3KM6 A;  2HLS A;  4FH8 A;  2J23 A;  3LW9 A;  2IJY A;  3KP9 A;  4X0X A;  4H86 A;  3IAM 1;  2LJA A;  5A4U A;  1VF2 A;  1T00 A;  1YZX A;  3HVV A;  3UEM A;  4YAP A;  2H6Z A;  2OBK A;  1SK1 A;  2J9H A;  3Q19 A;  2QA2 A;  1EWX A;  2DJ3 A;  1DBY A;  3TB2 A;  2PU9 C;  4HSC X;  2RAD A;  3UVT A;  5J5N A;  1GSS A;  4K1F A;  3IAM 2;  5ECP B;  3FZA A;  1QUW A;  1Z7R A;  4TR4 A;  3ZLP A;  3L9U A;  1SKW B;  5B7C A;  5IMA A;  3FR3 A;  4DVC A;  2VLU A;  1X5D A;  3JSB A;  4Q5F A;  4K0G A;  4ZB8 A;  1M2B A;  3H93 A; 
#chains in the Genus database with same CATH homology
 2LNS A;  1BQ7 A;  2L59 A;  2V1C C;  4JCV E;  4X1U A;  5JWR B;  2MBT A;  2V6K A;  5IMZ A;  3VPT A;  1JZO A;  1M9B A;  2H75 A;  1ZZY A;  3QAW A;  4OAV B;  1Q4J A;  3KD0 A;  2RLI A;  1PN9 A;  3LJ1 A;  4K5R A;  3FZ4 A;  5EVO A;  2YWO A;  2TRX A;  4YH2 A;  2KP1 A;  3UBK A;  4G76 A;  4RQX A;  2MBS A;  2YWM A;  2CAI A;  1ZOF A;  1R5A A;  4KAE A;  5ECI B;  1GTA A;  2CVB A;  3F6F A;  1XPV A;  3P7X A;  4GXT A;  2A2C A;  2CZ2 A;  1ACV A;  2YNX A;  3M9J A;  4MF6 A;  3K8N A;  5DAL A;  3I9V 1;  4GCI A;  4ZXG A;  4G75 A;  2B5X A;  3VK9 A;  1B48 A;  2O89 A;  2GZP A;  4LL1 B;  1AUC A;  5ECS A;  2P22 B;  2H0H A;  1THX A;  4O32 A;  3EUR A;  2BTO T;  3ZRD A;  2FLS A;  1ML6 A;  1A8Y A;  5HFI A;  2VCQ A;  2LQQ A;  3CSH A;  4NV5 A;  5B6N A;  2GDR A;  5KN2 A;  3I9V 2;  2JB2 A;  5H5S A;  2WFC A;  1Z6N A;  2KHP A;  4XTS A;  1WPI A;  2F66 B;  5HQP A;  5G1K A;  2N5F A;  4ZL7 A;  4ML6 A;  4Z7X A;  4MF5 A;  5DQY A;  6GSW A;  1ZL9 A;  4MJC A;  5ECR B;  18GS A;  2CZ3 A;  3G7Y A;  4DSQ A;  4I1T A;  3HJP A;  1QMV A;  2TRC P;  5G30 A;  1TRS A;  4Z7G A;  3RAZ A;  1AQX A;  2B1K A;  4PL3 A;  2YZH A;  1SK2 A;  2YV9 A;  2B6M A;  1FHE A;  1XW6 A;  1GP1 A;  1K3Y A;  3TCO A;  2EIR A;  2MJF B;  3UBL A;  5IMV A;  4AF2 A;  4TKY A;  3QOU A;  4LA1 A;  3CMI A;  2F3M A;  4MZB A;  5IO0 A;  3CBU A;  3FMW A;  2HZF A;  4I97 A;  4MCU A;  1BG5 A;  2CAZ B;  3GTU B;  3QFB C;  4PNG A;  1PRX A;  1TJD A;  4G10 A;  2QA1 A;  5J41 A;  4V2M A;  4QQ7 A;  4JU5 A;  5DJM A;  4MJA A;  2XPD A;  4IP1 A;  5J3R A;  2JSZ A;  1FG4 A;  6GSV A;  5KN0 A;  2JAE A;  2A2P A;  2L1L B;  2L4Q A;  2DJ1 A;  4KDX A;  2H6Y A;  4BL7 B;  3NZN A;  4I8B A;  3SDJ A;  2O87 A;  1XWB A;  4IQ1 A;  2H01 A;  3PPU A;  2C0E A;  4DEJ A;  3EWL A;  1JZD A;  4O5R A;  2WJU A;  4GXZ A;  4I5Q A;  5IQY A;  1KNG A;  1EGR A;  2ON5 A;  1K3L A;  1K0M A;  4PL4 A;  2GZY A;  9GSS A;  3IPZ A;  4IP6 A;  1ZYP A;  1A2M A;  3HCZ A;  2VO4 A;  5CRG A;  5J9C A;  16GS A;  5CRW A;  1PMT A;  1X9M B;  1GSD A;  2PMT A;  4OWY A;  2H8L A;  3GH6 A;  3FR9 A;  2LJK A;  4XS4 A;  1EV9 A;  1WE0 A;  1PX7 A;  4TVE A;  4ULX A;  1NW2 A;  1XVW A;  2QC7 A;  4D73 B;  3FRC A;  2LKU A;  4OFN A;  1XBS A;  2H1B A;  4N30 A;  1GSQ A;  5H5Q A;  3A5W A;  1BAY A;  4X43 A;  3KTB A;  1GLQ A;  2CVD A;  1BED A;  1GUL A;  4U6R A;  5LNK 1;  1J08 A;  2IL3 A;  4NAX A;  3U6V A;  2R5G A;  4GLT A;  1ERW A;  4O5Q A;  2H76 A;  4BVY A;  5JCG A;  3IV4 A;  5ECK B;  1OVN A;  1PQN A;  5FHI A;  2VCZ A;  4K7N A;  3F4R A;  4NHZ A;  4G0L A;  3GKX A;  4Q5R A;  1O8W A;  5INY A;  4K5S A;  1THO A;  3TRX A;  3VI5 A;  3PH9 A;  3WYW A;  2ZRR A;  2NPB A;  3ZIJ A;  4QL7 A;  2R0G A;  4AJ6 A;  2A2S A;  4EF0 A;  2ZNM A;  1SU9 A;  2O7K A;  1U3A A;  5JWQ B;  2X49 A;  1XZO A;  2FNO A;  1HD2 A;  2G0F A;  2XBI A;  4WR5 A;  4F82 A;  1ZCP A;  1Z5Y E;  4AJ8 A;  3KXO A;  4LMV A;  2HXK A;  1PSQ A;  3VLN A;  3TRP A;  1AAZ A;  5B8A A;  3W8J A;  5KN3 A;  1AQV A;  3GV1 A;  1X5E A;  2H72 A;  2C8U A;  3ED3 A;  5HR0 A;  4YKF A;  2CT6 A;  3LXZ A;  2VCT A;  3KJY A;  1B4Q A;  5DQS A;  3TRQ A;  1E6B A;  1WMJ A;  4IVF A;  3I69 A;  5CRH A;  1GLP A;  4Z2U A;  2Z9S A;  3TOU A;  1MEK A;  2L5L A;  4ID0 A;  4HUA A;  2DBC A;  1O7U A;  5GAP D;  5ECQ B;  1VF1 A;  4TN8 A;  4ZIL A;  3C7M A;  1EGO A;  2AV4 A;  3P8W A;  3EYT A;  4G19 A;  1DSB A;  2WGR A;  3DD3 A;  2GZZ A;  1SK0 A;  2WB9 A;  3GTU A;  3DA3 A;  1O8X A;  4HZ4 A;  2LRT A;  5D73 A;  1SYX A;  4EDY A;  2YP6 A;  5HFK A;  2YV7 A;  3DGQ A;  3EE2 A;  2DKI A;  5FWG A;  3UJ1 A;  3GYK A;  3TJJ A;  2OAD A;  4O7H A;  3QMX A;  1B8X A;  1R26 A;  2BJX A;  2DKH A;  1U87 A;  2H6X A;  4L8E A;  4JR4 A;  2PBJ A;  1W89 A;  1YJ6 A;  2V6O A;  4BL7 A;  4JZQ A;  5ID2 A;  1U3I A;  4IKH A;  5HFG A;  3CSI A;  4DSS A;  3EC3 A;  3WGE A;  5B8B A;  4HEA 2;  3HDC A;  3LQ7 A;  1NHO A;  4CHS A;  4EIQ A;  1EEM A;  2N5A A;  1QFN A;  1Z7P A;  1SD8 A;  3KIJ A;  2YJ7 A;  1H4O A;  3HVX A;  4YZ9 A;  1MDJ A;  2QSI A;  4EIP A;  1X9S B;  3OR5 A;  3FZ9 A;  3VA9 A;  1SL2 B;  1OYJ A;  1PN0 A;  2FD3 A;  1HNA A;  1I5G A;  2H19 A;  5AIX A;  4D73 A;  4PUA A;  4OCE A;  3IHG A;  2F8A A;  3ZZX A;  3FR6 A;  4WEY A;  4TR3 A;  2V6E A;  3VWW A;  4MPG A;  2JB1 A;  4RI7 A;  3HYP A;  4GSN A;  5HGI A;  2X8C A;  4O1O A;  2C0D A;  2F51 A;  1ZYQ B;  1R7H A;  3DWV A;  3KCM A;  1VF3 A;  3H4K A;  2EIQ A;  5D96 A;  3GN3 A;  4NV2 A;  5CO3 A;  5LNK e;  2CVK A;  4MMM A;  4JBB A;  2P31 A;  3Q74 A;  3QCP A;  1FOH A;  1XOA A;  3FW2 A;  4K7I A;  4NPB A;  2ALB A;  3TJF A;  4V2N A;  1KBN A;  3QAV A;  3FYG A;  1XVQ A;  4PNF A;  1GSE A;  1A23 A;  3CTG A;  1GNW A;  3PGT A;  2AYT A;  4IGJ A;  5CYY A;  5ABR A;  2HT9 A;  4FO5 A;  2HSM A;  3D4M A;  4NWY A;  4FYC A;  3W8S A;  1GSF A;  1T1V A;  3DYR A;  3EVI A;  2AJQ B;  1G7E A;  5AGY A;  3C1S A;  4JRR A;  2DIY A;  3HD5 A;  2GLR A;  1SKR B;  3FKF A;  3ZRE A;  3GA4 A;  4PUF C;  3VWV A;  2NDO A;  3Q8D A;  4ECJ A;  5DAK A;  2C80 A;  2IMF A;  1WP0 A;  4KSO A;  2YJH A;  1OE8 A;  3TJG A;  4XS4 B;  4POK A;  3S9F A;  1I9D A;  3AY8 A;  1GUK A;  4PL5 A;  3FHK A;  4MF7 A;  2WRT A;  3ZTL A;  5EL8 A;  5IM9 A;  4YQM A;  2LJR A;  3ME7 A;  3F8U A;  2I4A A;  2H66 A;  1F2E A;  3WT2 A;  2IFQ A;  2K8V A;  2VAF A;  1T3B A;  2V32 A;  2F9S A;  5G1L A;  4KB3 A;  3UAP A;  3ZL5 A;  2FWH A;  2XTR A;  1K0N A;  2VL2 A;  3RBT A;  5JWO B;  19GS A;  14GS A;  4IJI A;  4CY8 A;  2I1U A;  1F37 A;  7GSS A;  5DVB A;  3F9U A;  3UMA A;  2ZCT A;  4BVY B;  3NIV A;  3CSJ A;  4KDU A;  2BMX A;  4CY6 A;  1N2A A;  5G5E A;  3A5I A;  4KW6 A;  1ERU A;  3EMP A;  1UA5 A;  1EEJ A;  4MK3 A;  5ECL B;  2FWG A;  4GST A;  3D5J A;  3ZYW A;  1TU8 A;  4IBP A;  3QAG A;  3ISO A;  2OE0 A;  2K9F A;  2YCD A;  2XHF A;  3LYP A;  3FZ5 A;  4XCS A;  1V57 A;  1B9Y C;  4KE3 A;  3TJB A;  1SJZ A;  4G0K A;  2GVP A;  2CAQ A;  2E2G A;  1WWJ A;  1A0R P;  4KUN A;  2K8S A;  1HNB A;  3LFL A;  5C00 A;  1UC7 A;  1YO7 A;  1F9M A;  1J9B A;  1PX6 A;  1FAA A;  5D8I A;  5IMC A;  1MTC A;  3F4S A;  1TKD B;  4Z2R A;  4Z7H A;  2FCH A;  4N0Z A;  3ZIV A;  4EO3 A;  3MWH A;  4OMV A;  2OE3 A;  2QKE A;  1NHY A;  2O85 A;  2OKA A;  5HR2 A;  3VWU A;  3A2X A;  4V1A p;  3IAS 1;  2VOC A;  1TK8 B;  4POM A;  1ZMA A;  2FUG 1;  4GQF A;  1LBK A;  2HSH A;  1OC3 A;  1K0C A;  2IN3 A;  3UVH A;  3QDN A;  1QGV A;  3HVS A;  2H30 A;  1A8L A;  1XW9 A;  3EU3 A;  1K0O A;  3GST A;  4N10 A;  1R5P A;  1M2D A;  4EE0 A;  3KGK A;  4EUY A;  3HKR A;  2R0P A;  3F3Q A;  2FUG 2;  3IA1 A;  5ECH B;  4G2E A;  1RQM A;  1SYR A;  2C3N A;  4EVM A;  3L9S A;  3TJK A;  5ID2 B;  5DDL A;  3DEX A;  1XXU A;  4WF4 A;  4MAB A;  2K6V A;  2VL3 A;  3HA9 A;  1DE2 A;  1GWC A;  1SL1 B;  20GS A;  5H5R A;  4DSS B;  3HHV A;  2LRC A;  5LCZ A;  3DA4 A;  1OKT A;  2HNL A;  4HU9 A;  1G7O A;  1HYU A;  1ST9 A;  4TRX A;  3ZVJ A;  2A2R A;  4G0I A;  3IK7 A;  2YWN A;  4PUR A;  4HS1 A;  2H71 A;  2YOI A;  3FY7 A;  4MJB A;  5KOW A;  5F8B A;  4O1P A;  1NSW A;  2HE3 A;  5GZZ B;  2X64 A;  1QXH A;  3GIX A;  1JLV A;  3KTL A;  3O3T A;  4FYU A;  4OCF A;  4OFT A;  3Q18 A;  1O85 A;  3BCK A;  1MD4 A;  2KKM A;  4TOP A;  4MNN A;  3TGZ A;  2FWF A;  2VD1 A;  1XWC A;  4HQZ A;  1QQ2 A;  1TI3 A;  4MA9 A;  4V2L A;  4P3Y B;  3V1W A;  3GSS A;  2K18 A;  2VLT A;  4J57 E;  3GNJ A;  1T4Y A;  2DSA A;  1LU4 A;  2GQL A;  3CXG A;  1YDK A;  5LD0 A;  4GSS A;  4AGS A;  3IXR A;  2X99 A;  5D93 A;  5CP1 A;  4YKG A;  4IQA A;  2C0F A;  2PUK C;  1DUG A;  2PVQ A;  4POL A;  3R3E A;  1VRS D;  2LRN A;  2FA8 A;  2PER A;  2ON7 A;  2EC4 A;  2ZUP A;  1T8E B;  1XWK A;  2R0C A;  4CDO A;  1G6Y A;  3KH7 A;  4TXO A;  3BOA A;  3L4N A;  2CV4 A;  2IMI A;  2DJ2 A;  6GSX A;  3VFI A;  4ZB6 A;  4IS0 A;  3LJ2 A;  5DCG A;  3HXS A;  2M80 A;  2F8F A;  4F2I A;  4YAV A;  4I6X A;  3F4T A;  1BX9 A;  1X9W B;  3APS A;  3M9K A;  1FW1 A;  1LJR A;  2WS2 A;  3FK8 A;  4MP4 A;  4MDC A;  3L0I A;  1AW9 A;  3APO A;  4MZW A;  3EU4 A;  2YPM A;  2AAW A;  4A5P A;  1JHB A;  4USS A;  1CQH A;  4V1A g;  1X0R A;  2JAC A;  3ERG A;  2I3Y A;  4ML1 A;  1KTE A;  5DAK B;  3TKS E;  2GQK A;  4TXV A;  1SEN A;  2DML A;  1CQG A;  3KMN A;  3LSZ A;  3DXB A;  3I6A A;  1A2L A;  3LJR A;  2PN8 A;  2GQM A;  4F03 A;  3E9J B;  1EZK A;  5CRD A;  1XIY A;  1M0U A;  1F6M C;  1GRX A;  1W4V A;  3A2W A;  2OE1 A;  5IPG A;  5B6M A;  2PGT A;  1WOU A;  1XWG A;  2KLX A;  1WJK A;  1YY7 A;  2IFQ B;  3ERW A;  5D9T A;  3F0I A;  3M0F A;  1RK4 A;  1GTB A;  2DJK A;  4EC0 A;  2IIY A;  4KGI A;  4ECI A;  5DCH A;  3O6T A;  3ZML A;  1U6T A;  1VF4 A;  5IOX A;  2VIM A;  3IK9 A;  4WXT A;  2P5Q A;  2A4H A;  2D2Z A;  2K19 A;  2I81 A;  4JE1 A;  2P5R A;  4Q5N A;  2B5Y A;  2OAC A;  3ME8 A;  2IME A;  2HRK A;  2RUE A;  10GS A;  1URM A;  4ZIJ A;  2JAD A;  2R2J A;  1XCC A;  2KUC A;  2P0G A;  2VL9 A;  4YQU A;  3QR6 A;  4HI7 A;  2RII A;  1TTZ A;  3F3R A;  4YZD A;  2AB6 A;  5A4W A;  1GUM A;  3TKS C;  1FOV A;  3MNG A;  2L6C A;  2GST A;  1ZYN A;  3VI7 A;  3F4M A;  2XC2 A;  1U5K A;  4J2F A;  2JSY A;  1MD3 A;  3WGX A;  3PIN A;  5F05 A;  3QPM A;  1WIK A;  1SD9 A;  1NM3 A;  4K2D A;  2C1Y A;  5G2Z A;  1GSY A;  3LEF A;  3UAR A;  4LL4 B;  2C4J A;  4WF5 A;  5G31 A;  1TW9 A;  1S3A A;  4XIH A;  4TW5 A;  1EOG A;  3KH9 A;  8GSS A;  2JZR A;  2KOK A;  4O5U A;  2E2M A;  2JL4 A;  2V2G A;  3FBV A;  4WKW A;  1K0B A;  2G2Q A;  5CRE A;  2REM A;  3ZFL A;  5KN1 A;  2L6D A;  5A4V A;  3BD2 A;  3LJ0 A;  3N5O A;  4PTS A;  4X4J A;  1TRU A;  3GKM A;  1OC9 A;  5EY6 A;  2VD0 A;  4XRA A;  4DSR A;  3IE3 A;  3ERF A;  1KEB A;  2CA8 A;  4PQ1 A;  2E0Q A;  5ENU A;  1R4W A;  1AQW A;  3GL3 A;  4MH2 A;  1EV4 A;  2R37 A;  1FVK A;  5ECN B;  4WBJ A;  4BVX A;  1A0F A;  2V41 A;  4JED A;  3UIW A;  3LYK A;  3US3 A;  4TR1 A;  1ZGN A;  2X8G A;  3DO9 A;  2DC5 A;  3RHB A;  3C71 A;  5KOX A;  1SJ8 A;  3HZ4 A;  1V58 A;  2MZC A;  4EDZ A;  1JFU A;  1K3O A;  2FWE A;  2VM1 A;  4CW9 A;  5L71 A;  4G9H A;  3RPN A;  11GS A;  2GGT A;  6GSU A;  4GWR A;  1A2J A;  3GKK A;  4MH3 A;  1O81 A;  4OO4 A;  3VUR A;  1U88 A;  2XMX A;  4ECB A;  2DMM A;  1FVJ A;  3M3M A;  2ES7 A;  1WRY A;  2OJL A;  1G6W A;  2FY6 A;  2V1M A;  3DML A;  4ZL9 A;  4MLY A;  5F0G A;  2HI7 A;  2FHE A;  4DWL A;  2MMA A;  1C72 A;  4WET A;  1TP9 A;  1XFL A;  3CTF A;  1IYH A;  2DJ0 A;  1B9X C;  1H75 A;  3MYD A;  2MMO A;  5AIS A;  3KEB A;  6GST A;  2B5E A;  4AS2 A;  2LTK A;  1TK0 B;  3HY2 A;  5J9B A;  3SBC A;  2H74 A;  4I2T A;  3VPQ A;  3TOT A;  4EKZ A;  2YZU A;  3IC4 A;  1SKS B;  4L0W A;  3I43 A;  3A3T A;  3D21 A;  2C0G A;  4TXO B;  2JZT A;  4HU7 A;  3ZVJ D;  1B4P A;  3JCM L;  1EOH A;  4KH7 A;  1YF1 A;  3KZQ A;  4ZB9 A;  5D9W A;  1V98 A;  2WCI A;  1TDI A;  2B3S A;  2H1D A;  3A2V A;  1M2A A;  5D9X A;  3EIN A;  5DJL A;  3P23 A;  3AJF A;  5IOW A;  3G7J A;  4OD7 A;  3GX0 A;  4IEL A;  2WDU A;  4HOJ A;  2WUL A;  3F6D A;  5ECM B;  3IBH A;  2GT5 A;  2IPA A;  4AS3 A;  3IC8 A;  3UOM A;  4JR6 A;  1BJX A;  3C1R A;  3MDK A;  1PKZ A;  2B7J A;  4FYB A;  2VCV A;  2VCX A;  2XBQ A;  3UIT A;  1PA3 A;  2X4A A;  3D0Z A;  3G9B A;  4LMW A;  1GL8 A;  3LGC A;  1F3A A;  4RI6 A;  3ZFB A;  5HR3 A;  3WGD A;  4K0N A;  1MDI A;  3QD9 A;  5KEJ A;  5F06 A;  4K2X A;  4LLR A;  1V2A A;  4GRF A;  2GTU A;  1XOB A;  3WT1 A;  3O76 A;  3APQ A;  1M99 A;  2HZE A;  1FB0 A;  3F63 A;  4K9Z A;  4HDE A;  1G0T A;  2M72 A;  2A4V A;  4O92 A;  1JZR A;  4L0U A;  2HFD A;  1GSU A;  1ON4 A;  2H73 A;  3NOF A;  4WBR D;  1AIU A;  3DVW A;  3PR8 A;  3DRN A;  1ILO A;  5HR1 A;  5C04 A;  2RM5 A;  3EMX A;  3WD6 A;  2HRF A;  1TU7 A;  3GUR A;  4OO5 A;  4GF0 A;  4E8H A;  3TUE A;  3ZIT A;  4MZC A;  3GFK A;  2OA7 A;  5BMU A;  1YQ1 A;  3IAS 2;  4TR0 A;  2MMZ A;  1PKW A;  4KSM A;  5AN1 A;  3ZMK A;  3MAK A;  5CNW A;  1Q98 A;  1EP7 A;  2UZ8 A;  4ICY A;  1YEP A;  4ISD A;  4KCE A;  1TOF A;  4GTU A;  3MSZ A;  1AC1 A;  1EP8 A;  1M7T A;  4FIW A;  1A24 A;  1FO5 A;  2JB3 A;  4BA7 A;  1O73 A;  5GAN D;  4NHW A;  5ELG A;  3U5R E;  5F07 A;  4MJE A;  2GSQ A;  3BJ5 A;  3GUS A;  1GH2 A;  5FT3 A;  3H79 A;  4ZBD A;  3TKS A;  3H1N A;  2TIR A;  1GTI A;  2XPE A;  3TKP A;  3FEU A;  3BBY A;  3GX8 A;  3MIX A;  2GS3 A;  3UL3 A;  1PL1 A;  1PL2 A;  5GST A;  4L5O A;  3IRA A;  1ABA A;  2NBS A;  4PX1 A;  3R2Q A;  4IN0 A;  3C8E A;  2MYG A;  3HZ8 A;  1S3C A;  1J0F A;  2X8H A;  5BRT A;  3Q6O A;  4XRD A;  3M8N A;  1IYI A;  3BCI A;  3P2A A;  3GHA A;  12GS A;  3GMF A;  2YFA A;  4F0B A;  1T4Z A;  1YKA A;  4XS6 A;  3IHQ A;  1TK5 B;  4POB A;  4EL1 A;  2FGX A;  4I2U A;  4ZBB A;  4PXO A;  3C73 A;  2LNT A;  2L4C A;  2LQO A;  1YKC A;  2IMD A;  1RW1 A;  3CRU A;  2DJJ A;  2MMN A;  4WR4 A;  3E3E A;  1XW5 A;  1Y25 A;  4N11 A;  2HSY A;  2DLX A;  3KP8 A;  2JZS A;  2F6M B;  2H70 A;  5IIZ A;  4KDY A;  5IO2 A;  1YEX A;  2B1L A;  2GSR A;  3LOR A;  3H8Q A;  1K0A A;  4Q9V A;  2QGV A;  2YN1 A;  2LUS A;  1AXD A;  1DE1 A;  1OC9 B;  1FB6 A;  5DBQ A;  1VGL A;  13GS A;  22GS A;  4NXI A;  2R3X A;  2VLV A;  2I9H A;  2VL2 C;  2L5O A;  2RIO A;  3D4T A;  4IW9 A;  2H0I A;  3DVX A;  2XTQ A;  3HJO A;  5AIV A;  1GUH A;  2L57 A;  1V40 A;  2NVL A;  4BVX B;  4HJM A;  2HRN A;  5IMF A;  4TR1 B;  1TRV A;  3J7Y b;  1ERT A;  1OKD A;  6GSY A;  4GQC A;  5ELA A;  1S3D A;  4HQS A;  2C3Q A;  2CX3 A;  1JZW A;  1GTU A;  4IJ3 A;  5JCU A;  17GS A;  3LWA A;  5EPF A;  4QL9 A;  1XWA A;  2CQ9 A;  4KA0 A;  2N5B A;  4ZL8 A;  4J56 E;  4ECC A;  2R4V A;  6GSS A;  4IHU A;  3GH9 A;  3CRT A;  2EIO A;  3IDV A;  2A2D A;  2HRA A;  4PGT A;  3IOS A;  1F3B A;  2H0G A;  5E59 A;  3TDG A;  4RQR A;  2GSS A;  4XS1 A;  4BPY A;  1Z3E A;  3CYN A;  3SWL A;  1T7P B;  3DIE A;  2DIZ A;  5G5F A;  2VM2 A;  2IWT A;  1M9A A;  1BYE A;  1UN2 A;  2YFB A;  1K0D A;  2VCW A;  3P90 A;  5D9V A;  2RUF A;  2HYX A;  1OE7 A;  3L78 A;  1SJI A;  4Z2T A;  1Z6M A;  2YAN A;  2H1A A;  4ACS A;  2M46 A;  4AJ7 A;  1OC8 A;  2LV3 A;  4RUV A;  3GKN A;  1TXX A;  4K7O A;  4HZ2 A;  4Q5Q A;  1O6J A;  3QFA C;  4F0C A;  4EXJ A;  2FA4 A;  2R6K A;  4XHM A;  4HFV A;  2GT6 A;  3VWX A;  2E7P A;  4L5L A;  2OBI A;  1X5C A;  2H1G A;  1YF0 A;  4OAU C;  4HEA 1;  5COH A;  4PQI A;  5A5K A;  4PQH A;  1TRW A;  5IMD A;  2YWI A;  5CAX A;  5DAL B;  4KX4 A;  4BWS A;  2AUV A;  4K6X A;  2B7K A;  3KMO A;  2IMK A;  1W3S A;  1ERV A;  1MDK A;  1SJ6 A;  1Z9H A;  3D6I A;  5J4U A;  1OAZ A;  3D22 A;  4MPF A;  2RM6 A;  4HJ2 A;  1V9W A;  1HNC A;  2JU5 A;  4KCA A;  1HQO A;  2PVO C;  2KP2 A;  4BWQ A;  1PGT A;  3L9V A;  1QK8 A;  3GRX A;  4E8E A;  5JCW A;  5IPH A;  2O8V B;  3TKQ A;  1JLW A;  2E8G A;  2PWJ A;  4YQV A;  3DKS A;  3IR4 A;  4YZC A;  1E2Y A;  4FQU A;  2HZE B;  3HJM A;  2AHE A;  2C3T A;  1SL0 B;  2CX4 A;  3LG6 A;  1GNE A;  3TKR A;  3N9J A;  3J7Y k;  4ILF A;  4K8M A;  4NMU A;  1USB A;  2IP6 A;  4KF9 A;  4N0V A;  3M1G A;  4F9Z A;  3RHC A;  2LST A;  1N8J A;  1ZYE A;  4KND A;  3L0H A;  1TI1 A;  5GSS A;  3EPT A;  2VUP A;  1UVZ A;  3W6G A;  4OFM A;  1PD2 1;  5ECO B;  1Y6E A;  3LXT A;  3RPP A;  3G7I A;  2NTO A;  3E0U A;  3GL5 A;  5E4W A;  4ZBA A;  2LEG A;  3RDW A;  2LS5 A;  2WZ9 A;  2PPT A;  3KM6 A;  2HLS A;  4FH8 A;  2J23 A;  3LW9 A;  2IJY A;  3KP9 A;  4X0X A;  4H86 A;  3IAM 1;  2LJA A;  5A4U A;  1VF2 A;  1T00 A;  1YZX A;  3HVV A;  3UEM A;  4YAP A;  2H6Z A;  2OBK A;  1SK1 A;  2J9H A;  3Q19 A;  2QA2 A;  1EWX A;  2DJ3 A;  1DBY A;  3TB2 A;  2PU9 C;  3UVT A;  5J5N A;  1GSS A;  4K1F A;  3IAM 2;  5ECP B;  3FZA A;  1QUW A;  1Z7R A;  4TR4 A;  3ZLP A;  3L9U A;  1SKW B;  5B7C A;  5IMA A;  3FR3 A;  4DVC A;  2VLU A;  1X5D A;  3JSB A;  4Q5F A;  4K0G A;  4ZB8 A;  1M2B A;  3H93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...