3F4MA

Crystal structure of tipe2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
154
structure length
154
Chain Sequence
b'IDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor, alpha-induced protein 8-like protein
publication title Crystal structure of TIPE2 provides insights into immune homeostasis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 66
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2008-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.160 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3f4mA00
3F4MA 4Q9VA
chains in the Genus database with same CATH superfamily
2XTQA 2RIOA 4NV5A 3AJFA 4PL5A 2YFAA 2JB3A 5LNK1 4DWLA 2F6MB 2BL7A 3B55A 4PL3A 1YO7A 3FBVA 3FNBA 2L1LB 4OAUC 4AS2A 2FUG1 2FU2A 4G75A 2ZRRA 4HFVA 2RLDA 2QSBA 4YZCA 3IAS1 2A2CA 2RADA 4OAVB 2QZGA 3KP9A 4Z7GA 1U5KA 2P22B 2KKMA 3P23A 3LJ2A 2XMXA 2FEFA 3LJ1A 4GXTA 3DO9A 2F66B 2JAEA 4U6RA 2JBWA 1JQOA 2E8GA 4AS3A 1W3SA 4HEA1 3JSBA 3SDJA 3IAM1 2A2DA 3Q8DA 4G76A 1SJ8A 2YFBA 4JCVE 2ETDA 2ZW3A 3F4MA 3DA3A 3I9V1 2QGMA 3VA9A 3UITA 2GSCA 2V1CC 4YZ9A 2HGKA 4NV2A 4Z7HA 2CAZB 1TDPA 4O1OA 2K19A 3LJ0A 2MJFB 4PL4A 2JB1A 4YZDA 2IP6A 2XTRA 5HGIA 4Q9VA 2BL8A 3L0IA 4O1PA 3FVVA 3DA4A 2JB2A 4I1TA 2V6EA
chains in the Genus database with same CATH topology
2XTQA 2RIOA 4NV5A 3AJFA 4PL5A 2YFAA 2JB3A 5LNK1 4DWLA 2F6MB 4PL3A 1YO7A 3FBVA 2L1LB 4OAUC 4AS2A 2FUG1 4G75A 2ZRRA 4HFVA 4YZCA 3IAS1 2A2CA 4OAVB 3KP9A 4Z7GA 1U5KA 2P22B 2KKMA 3P23A 3LJ2A 2XMXA 3LJ1A 4GXTA 3DO9A 2F66B 2JAEA 4U6RA 2E8GA 4AS3A 1W3SA 4HEA1 3JSBA 3SDJA 3IAM1 2A2DA 3Q8DA 4G76A 1SJ8A 2YFBA 4JCVE 3F4MA 3DA3A 3I9V1 3VA9A 3UITA 2V1CC 4YZ9A 4NV2A 4Z7HA 2CAZB 4O1OA 2K19A 3LJ0A 2MJFB 4PL4A 2JB1A 4YZDA 2IP6A 2XTRA 5HGIA 4Q9VA 3L0IA 4O1PA 3DA4A 2JB2A 4I1TA 2V6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F4M A;  4Q9V A; 
#chains in the Genus database with same CATH topology
 2XTQ A;  2RIO A;  4NV5 A;  3AJF A;  4PL5 A;  2YFA A;  2JB3 A;  5LNK 1;  4DWL A;  2F6M B;  2BL7 A;  3B55 A;  4PL3 A;  1YO7 A;  3FBV A;  3FNB A;  2L1L B;  4OAU C;  4AS2 A;  2FUG 1;  2FU2 A;  4G75 A;  2ZRR A;  4HFV A;  2RLD A;  2QSB A;  4YZC A;  3IAS 1;  2A2C A;  2RAD A;  4OAV B;  2QZG A;  3KP9 A;  4Z7G A;  1U5K A;  2P22 B;  2KKM A;  3P23 A;  3LJ2 A;  2XMX A;  2FEF A;  3LJ1 A;  4GXT A;  3DO9 A;  2F66 B;  2JAE A;  4U6R A;  2JBW A;  1JQO A;  2E8G A;  4AS3 A;  1W3S A;  4HEA 1;  3JSB A;  3SDJ A;  3IAM 1;  2A2D A;  3Q8D A;  4G76 A;  1SJ8 A;  2YFB A;  4JCV E;  2ETD A;  2ZW3 A;  3F4M A;  3DA3 A;  3I9V 1;  2QGM A;  3VA9 A;  3UIT A;  2GSC A;  2V1C C;  4YZ9 A;  2HGK A;  4NV2 A;  4Z7H A;  2CAZ B;  1TDP A;  4O1O A;  2K19 A;  3LJ0 A;  2MJF B;  4PL4 A;  2JB1 A;  4YZD A;  2IP6 A;  2XTR A;  5HGI A;  4Q9V A;  2BL8 A;  3L0I A;  4O1P A;  3FVV A;  3DA4 A;  2JB2 A;  4I1T A;  2V6E A; 
#chains in the Genus database with same CATH homology
 2XTQ A;  2RIO A;  4NV5 A;  3AJF A;  4PL5 A;  2YFA A;  2JB3 A;  5LNK 1;  4DWL A;  2F6M B;  4PL3 A;  1YO7 A;  3FBV A;  2L1L B;  4OAU C;  4AS2 A;  2FUG 1;  4G75 A;  2ZRR A;  4HFV A;  4YZC A;  3IAS 1;  2A2C A;  4OAV B;  3KP9 A;  4Z7G A;  1U5K A;  2P22 B;  2KKM A;  3P23 A;  3LJ2 A;  2XMX A;  3LJ1 A;  4GXT A;  3DO9 A;  2F66 B;  2JAE A;  4U6R A;  2E8G A;  4AS3 A;  1W3S A;  4HEA 1;  3JSB A;  3SDJ A;  3IAM 1;  2A2D A;  3Q8D A;  4G76 A;  1SJ8 A;  2YFB A;  4JCV E;  3F4M A;  3DA3 A;  3I9V 1;  3VA9 A;  3UIT A;  2V1C C;  4YZ9 A;  4NV2 A;  4Z7H A;  2CAZ B;  4O1O A;  2K19 A;  3LJ0 A;  2MJF B;  4PL4 A;  2JB1 A;  4YZD A;  2IP6 A;  2XTR A;  5HGI A;  4Q9V A;  3L0I A;  4O1P A;  3DA4 A;  2JB2 A;  4I1T A;  2V6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...