3Q8DA

E. coli reco complex with ssb c-terminus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
231
Chain Sequence
EGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein recO
publication title Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 67
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3q8dA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3q8dA01
3CMAA 3GTGH 2HT1A 3UDXA 1OXSC 1Y1WH 1D8LA 2JEBI 4GN4B 1A62A 2ZM6L 4K0KQ 5ELNA 5H1SE 4EX5A 2WB1G 5IWAL 4X65Q 2KCMA 3EBEA 3NELA 1W3SA 1YIJA 1HH2P 2C35B 3JAMc 4DV1L 4JI4Q 3E9IA 2GVBA 3HOWH 2FXQA 1QVCA 1K73C 1WFQA 3H0GG 3MEFA 2BH2A 4GNXC 2NVXH 4JI3Q 2CWAA 4B3MQ 1YHBA 4PMWA 3CCMA 4IJHA 4L5SA 4X66Q 4DPGA 1KIXA 2UUCQ 4YY3L 5GAEC 3A74A 1EYGA 1X6OA 1X3EA 4DV3Q 3UDGA 4IOAA 3F8TA 4LF7L 4GS3A 3TRZA 1J5EL 4AIMA 2JA5H 3W1BA 1YHQA 4GNXA 1L1OC 2PQAB 4LFCL 2I0QA 2R7ZG 4GKKL 3TS2A 5J3BA 3CCEA 2ZJRA 3GTPH 3CP0A 1K9MC 4A76A 1C0AA 3S1MH 5C0XG 2UXBQ 2LSSA 2A19A 4EQ5A 4DR7Q 1N36L 4GKJQ 4WJ3M 5C0XI 4QQBX 1VQDA 3PUWA 1L1OA 4DNIA 2JA7H 5GAHC 4JI5Q 3PO3G 3AYHB 2JA8G 4P71A 4HIMA 2JA6G 4BXXG 1U0LA 4OWXB 4IPDA 3RR5A 2NZHA 3K80C 1XPRA 3G48A 3FKIH 3CXCA 3GTJH 3K0XA 1YJWA 1EFWA 2VW9A 3AEVA 4DUZL 4X62L 1LYLA 1K0RA 2GN5A 3HOXG 1VQKA 1EQRA 4YWLA 5JJLA 1V43A 2JA9A 3UDIA 4A75A 2NVQH 3I55A 1ASZA 3HOZH 1QUQB 4HIOA 4A3IH 1GM5A 1EIYB 4LF5Q 3CCRA 3I4MH 3DLLA 4DV6Q 4MNOA 4AYBG 3KF8B 3GTLH 2IHFA 3RLNA 2UUBL 1DGSA 4HIDA 3HOYG 1SMXA 4L5QA 4JV5L 1KQSA 4QL5A 3HFZB 3ULLA 1PH9A 3CW2C 4DR2Q 3S16H 1IBLL 2R6GA 1NBWA 1OXXK 3H0GH 3L7ZC 4FDBA 4JOIC 3BZKA 4MTNA 4BA1I 5C4JH 2DGYA 3T1YL 1FL0A 1FGUA 2N8NA 2UUAL 1HR0Q 3KOJA 5IYCG 4LFBQ 4JYAL 3CF5A 4A3JG 4JI6L 1Q1EA 1MJCA 4JBWA 4LF6L 1E1TA 2E2JH 4DR3L 3BZCA 1HZAA 4OX9Q 2VQEQ 4NXMQ 4JOIA 2IX1A 1SLJA 4DV5Q 2F3IA 4A3LG 1VQCA 3K81C 4YHHL 4DR6Q 1OXUA 2I5MX 2B63H 3S2HH 3CMEA 4J15A 4KHPL 2WFWA 3IRBA 4C2MH 2EQSA 4JBMA 4LNQA 1VCIA 2Z0SA 1PA6A 1KXLA 4BBRG 1Q86C 4JI7Q 2PQAA 2ES2A 2CFMA 1YEZA 2ATWA 3Q8DA 3PO3H 1L2FA 2AMCB 5AJ3L 5LMUL 1MJEA 2JA6H 2K14A 3J80c 4BY7G 4LWCA 4BXXH 1I94L 1X3FA 2LXKA 3JAMi 4HJAA 1VQMA 1NJIC 1LUZA 2JQOA 1X65A 2N3SA 3S1NH 3E9HA 1N33L 3HOXH 3KLWA 1L0WA 4RG1A 2CKZB 1B8AA 5C3EG 1HNXL 4B3RL 2ASBA 1EWIA 4X6AH 5ELOA 1VQGA 2OWOA 4JG2A 1O7IA 4DV7L 3MXNB 1V1QA 1BBUA 5GQOA 2XTIA 5HY6A 2QEXA 3RLFA 1VQOA 1PH5A 2UU9Q 4DUYQ 1M1KC 4BA2I 2IX0A 4LF7Q 1HZ9A 3KJPA 1W2BA 3HOYH 1G291 2PNHA 4NB3A 4AQYQ 4A3MG 2UXCL 2JJQA 4LFAQ 2H5XA 2ZJQA 3F2BA 2OQKA 1QUQA 3CC4A 1P16A 3JC66 1T9HA 5C0XJ 4IPHA 1KL9A 1FJGQ 4O0AA 2R7FA 4JI2L 1D7QA 3M4PA 1BKBA 5IE8A 3U50C 1AE2A 5IYCH 3T1HQ 3HKSA 4A3BH 4A3JH 1CSPA 1CUKA 3AFPA 5M3MG 4DKAC 3A5UA 3HKZG 4A3GG 1E3PA 1AE3A 1SR3A 2WAQG 2LXJA 3K7AH 4GOPB 3M3YH 1Q82C 4A3LH 1P8LA 4MZ9A 3U4ZA 2ZTDA 1HJPA 2RHQB 3I56A 3H3VH 5JJKA 1NMGA 1VQLA 2K50A 4TVAB 4LF4L 5DLQE 2RF4A 5HGQA 3OW2A 2KCTA 4R1JA 2PI2A 3M4OH 4IFDG 3OYYA 4QIWE 1XPOA 4IFDI 4BBRH 3UE0A 2RCNA 4BBSG 4P72A 1XMOL 2VS1A 3LGJA 2K4KA 4ALPA 4RMFA 4BY7H 1BBWA 4LUOA 2E8GA 3PO2G 3GO5A 5IYDG 4QY7A 1SE8A 3B6YA 4KHZA 3HOVG 1XMQQ 4QGUA 3J81c 2E5LL 1OXVA 4X64L 5C3EH 4NXNL 1JMCA 3GTQH 4XIGS 1Q1BA 3PCOB 1SN8A 1XNRQ 3NBHB 1VQNA 5JJIA 1IBML 3S1RH 2JK8A 4PZ6A 4KI0A 3M7NA 2VQFQ 2DUDA 2K5VA 4LF6Q 4UPAA 1SRUA 3L0OA 1VQ8A 2N78A 4HJ5A 1LTLA 4XTCS 4JI8L 3A0JA 5IP9H 4R4OA 4DV2L 4A3MH 1VQ9A 2YU9H 2F4VL 2CWPA 4A3DG 5GAGC 1RL2A 2MFIA 1UE6A 3J7A5 5M5WH 3GD7A 4A3CG 4LF8Q 2JE6I 4DR5L 2VNUD 1X56A 2UXDQ 1E22A 4B3TL 3RZDH 1HNZQ 4JBKA 4LF9Q 1YJ9A 4AYBE 4IO9A 1YI2A 1ASYA 2NZOA 1N32L 1SFOH 5M3MH 4LUVA 2F52A 2GVAA 2HIXA 1E1OA 2HIVA 3J80i 4DK3C 3PUXA 5C4XG 1K83H 3ULPA 1N8RC 4UP8A 1PH4A 4GOPC 1NE3A 4YWKA 1PH3A 4A3FG 4Y52H 3K8AA 4UY8C 3I7FA 3KF6B 3PV0A 4DV4Q 1A63A 4DV0Q 2A1AA 3AFQA 4JI1L 3D0FA 3J81j 2VZAA 1N34L 1WJJA 1JJCB 2D0OA 3CPFA 3PSIA 5JEAJ 5BR8L 1HNWL 1Z47A 4HJ9A 4NPSA 4BBSH 4GOPA 2JEAI 1VQBA 3CCLA 4DAYB 3S1QH 2Z6KC 2PMZE 4C3HH 1XTDA 2ALYB 3PO2H 1JT8A 1YNXA 3ERSX 4JBJA 2QA4A 4C3IH 4KLKA 2K5NA 5IP7G 3OTOQ 3HOVH 1QZHA 4DAMA 1WI5A 1A8VA 1TWFH 2B3GA 4A4IA 3RN2A 4K0KL 2Z6KA 2AKWB 4X65L 2D0PA 1JJGA 3CAMA 2K5HA 3UDFA 3U58A 4L5RC 4JI4L 4B3SQ 3F1ZA 2K52A 4DR1Q 3GTMH 4IJLA 1PVOA 2R7ZH 1TWCH 1XNQL 2ZTEA 2VL6A 4B3ML 4A3DH 5EAYA 4X66L 1C9OA 2OCEA 4R4IA 3CD6A 2UUCL 2ZM6Q 2L15A 1JE5A 2JA8H 5IWAQ 4HJ8A 1CSQA 4BY1G 2B29A 4POFA 4DV1Q 3CCSA 1LM0A 4C3JH 4A93G 5C4XH 5K36G 1AH9A 5IT9c 3GDEA 4A3EG 4OXPA 2VUMG 1BVSA 1CKNB 3GTOH 2UXBL 4A3FH 3TREA 1G51A 2PI2E 5M5XH 3CCJA 1QVFA 5JEAG 4GKJL 1YZ6A 1PYSB 3M85A 2V1CC 4GLAC 4JI5L 3ER0A 4YY3Q 1YITA 3FP9A 3NENA 1WOCA 3U4VA 1J5EQ 3UE1A 4YCVA 3HKZE 4LFCQ 1PYBA 2NN6G 2WAQE 3TQYA 1HZBA 4GKKQ 2NN6I 1WYDA 3KF6A 5IP7H 1XJVA 2OTLA 3CPWA 1TXYA 1YHAA 1Q81C 1E24A 2F4VQ 1Q12A 2HHHL 3M9BA 1N36Q 3ULJA 1K3RA 1VQEA 1VQFA 3PUZA 4DV6L 1PHJA 4AH6A 4LF5L 4DR4L 1RIPA 1I5FA 1R9TH 1Z9FA 3ICEA 4A3KG 1Q8KA 1VQAA 4IOCA 2JA5G 1MIUA 2N49A 4PG3A 4LF4Q 4IPCA 2Q2TA 3F2CA 1UWVA 1VQHA 4DUZQ 4X62Q 4DR2L 5GROA 1UEBA 3KYHC 3M4QA 1VQPA 1I50H 3G71A 1EQQA 3PIPA 1YVCA 3CCUA 2K75A 5FLMG 4O2DA 3ZJYC 1HR0L 4JI1Q 2E2HH 1I6HH 1JJ2A 1IBKL 2CCZA 1X9NA 1K8GA 2BA0A 2VQEL 4PZ7A 2UUBQ 4BY1H 3FKIG 4NXML 5LMNL 4DV5L 4OX9L 4JV5Q 4R4CA 3CCVA 1NMFA 1B7YB 4OWWB 2R93G 4Y7NH 2KENA 2YTYA 2ZTCA 4A3EH 1IBLQ 1KAWA 2A8VA 2R92G 5IY0A 2VUMH 3T1YQ 3HOZG 4A3IG 2UUAQ 3I4MG 3RLOA 4JI7L 4GLXA 3S14H 4JYAQ 4JI6Q 2IY5B 1GVPA 4DR3Q 1A0IA 1CKOA 2EXDA 3CQZH 4L5TA 4P73A 3DM3A 3VDYA 2NVTH 1B70B 1CKNA 4GN3B 4YHHQ 4UP9A 5M3FG 3S15H 2MQHA 4R4TA 4OONA 2KBNA 1IYJB 1Q46A 1TWAH 1IXRA 4JC0A 3RZOH 1XNQQ 3D31A 4KHPQ 2Q2IA 3KFUA 2CQOA 3I4NG 3HOUG 3A5ZB 3S24A 1VQ4A 1VQ6A 4R4QA 5IYBG 2QGQA 1KHIA 1S40A 2UU9L 4DUYL 4A3KH 4YCUA 5AJ3Q 4A3GH 3I4OA 5LMUQ 1NTGA 1I94Q 3SGIA 4ME3A 4AQYL 2YTVA 4LFAL 1Y1VG 3WWVA 2B63G 1N33Q 1GD7A 3PIOA 2Q2HA 2OTJA 3PF5A 1PH2A 2AWNA 1HNXQ 5M5YH 1FJGL 4IPGA 1E7ZA 1TWGH 3KDFB 4P75A 5FJ8G 3RNUA 4JI0L 5FLMH 1XPUA 4DV7Q 1VQIA 3T1HL 1G6PA 3GTKH 2MO1A 2YTXA 3W1GA 1K8AC 5C44G 1EUJA 1KRTA 5IYDH 1PH1A 1I3QH 1VQ7A 3S17H 1UE5A 4LW1A 2UXCQ 3I2ZA 2XGTA 2R7DA 1N9WA 3G4SA 3CC7A 2R93H 1EOVA 1X55A 2D62A 2KHJA 1X3GA 2EIFA 4LUZA 3J7ZC 1X54A 2BH8A 2R92H 1MKHA 2NVYH 4YCWA 4JI2Q 3STBD 4JCVE 2HHHQ 3PF4A 1S3OA 3RN5A 4DR4Q 1HZCA 1KRSA 2YYZA 4TQUS 2HQLA 1PV4A 1VQJA 3K7UC 4H02A 1XMQL 3PGZA 4JI3L 1OTCA 1OXTA 2BA1A 3EN2A 5M3FH 2MO0A 3TS0A 1WCMG 3AQQA 4A3CH 3BU2A 3I4NH 3HOUH 4DV3L 1QVGA 1XNRL 5IYBH 1Y14B 2I5HA 2E2IH 1FVIA 3STBC 1J6QA 4A3BG 1GKHA 3NEMA 4DK6C 1V9PA 2VQFL 1XMOQ 1IBKQ 2RHSB 3FHWA 1PH6A 4WJ4A 3F2DA 5LMNQ 1YJNA 4IFDJ 4APVA 3J81i 1Y1VH 2VY3A 2AWOA 4OWTB 4DR7L 2E5LQ 1Y1WG 1QZGA 4X64Q 4LF8L 3H3VI 4NXNQ 1EIFA 2UXDL 1UE1A 1U5KA 4HJ7A 3KJOA 5FJ8H 4LF9L 1S72A 1Q7YC 1HNZL 2MNAA 2Y0SE 1PH8A 4QJFA 2I5LX 1GO3E 4HIKA 3PUYA 1IBMQ 1NY4A 1IZ6A 3BJUA 1VQ5A 3HOWG 5C44H 1M90C 4P74A 1IL2A 4GNXB 1YBYA 4PZ8A 4YWMA 4JI8Q 4DV2Q 2Q2UA 1UE7A 2IHEA 3KDFA 3CCQA 4DV4L 3CC2A 1CKMA 2AHOB 4DV0L 2Y0SG 1H95A 2KHIA 1KD1C 4DR5Q 4OO1G 4B3TQ 1PFSA 4OO1I 1L1OB 5E7NA 2ID0A 3TEHB 1N32Q 3E0EA 1HR0W 3G6EA 2WP8J 3W5OA 4GN5A 1TWHH 5GADC 3OTOL 1VS0A 5IP9G 3L2PA 1JB7A 3H15A 1KC8C 2YV5A 4GLVB 5LMNW 2IT1A 4LFBL 1N34Q 1WCMH 2JA7G 3EIVA 5FLXc 2OQ0A 4B3RQ 1SROA 4UP7A 5BR8Q 1C7YA 4JI0Q 4POGA 3S2DH 1HNWQ 4B3SL 1PH7A 2WB1E 3PUVA 4DR1L 2ZJPA 4A93H 4DR6L
chains in the Genus database with same CATH superfamily
4NP5A 2CHBD 2JSOA 1Y1WH 4J8QA 3W3AA 3SK6A 5IGDA 5IWAL 4QB4A 1Y69U 1EYAA 3EBEA 1UNSA 3FRPB 1HH2P 3O13A 4I65A 3KUPA 3R8BA 4DV1L 1W6JA 4K8IA 1K73C 2HCIA 4K6LA 2CWAA 2EY6A 3X3NA 1KIXA 1F2LA 3ITPA 1X6OA 1F9SA 3F8TA 1WTVA 3TP8A 4LFCL 5LHY1 2J4XA 1EY9A 5J3BA 1IL8A 1QNUA 5CV6A 5E4WC 4A76A 5CV7A 2UXBQ 4EQ5A 1N36L 4AS3A 4QQBX 3PUWA 4ZUJA 4DNIA 1H9SA 4JI5Q 4HIMA 2P22B 1U0LA 1RHPA 4JBKA 2F0QA 4WORA 3BVGA 3FKIH 3GTJH 1EFWA 2VW9A 1DM0B 3KLRA 3MXPA 4X62L 3I4LA 4DUZL 3U9OA 5IT9E 2F0OA 3GQBA 3UDIA 4K5VA 1IYUA 1EIYB 3AB9A 4LF5Q 3I4MH 3H09A 3GTGB 3GTLH 1KNEA 2PNRC 1SDFA 3HOYG 4ME5A 1KQSA 4QL5A 5DNFA 2XMXA 1JICA 5ELDA 4DF7A 1IBLL 2R6GA 4MTNA 3L7ZC 1TS2A 1I6VC 5KNCA 3KOJA 2KA7A 2CVRA 4JYAL 1STEA 4JI6L 4JBWA 2JB1A 1CT1D 1MSGA 2F0TA 4IALA 3FEWX 2F0PA 3K81C 1SMYC 4DR6Q 2B63H 2I5MX 4OIJA 1O7LA 2B2VC 4KHPL 1HCZA 4C2MH 4I1TA 5EGTA 4JBMA 3VR6A 3W2DA 2Z0SA 1KNAA 2XNAC 1Q86C 4DXFA 3R2IA 4JI7Q 2CFMA 4IFDJ 2M00A 1L2FA 2KEEA 5AJ3L 2XN9C 4BXXH 4LWCA 3VR5A 1I94L 3S1NH 3E9HA 2JA7B 2EY2A 3NTHA 4R8NA 1RCVD 1HNXL 2ASBA 1EWIA 5ELOA 1HUMA 3TBIB 1VDZA 1V1QA 1BBUA 2R93B 2QEXA 1PH5A 1PRTB 1EWCA 4MTKA 1H9MA 3MZ5A 4LF7Q 4XDXA 2G9HD 5F2DA 1A15A 2FU2A 4A3IB 5LL6S 4RCOA 2H5XA 1LTAD 1LT3D 1QCBD 1JWMD 5C0XJ 4IPHA 2HUGA 1FJGQ 2F1MA 3KF8A 3M4PA 2SEBD 5IYCH 5M3FB 4A3BH 3AFPA 2QDLA 4DKAC 3HKZG 2E75C 4A3GG 4HN7A 3I4NB 4CGYB 1Q82C 1P8LA 1I4HA 4DWLA 4DA2A 1HJPA 3TZDA 1YNND 1VQLA 2B8GA 4TVAB 2EYFA 5HGQA 2KCTA 2PI2A 3M4OH 4QIWE 5I6WA 4BBRH 2RCNA 4ZK9B 1XMOL 3OIQA 4OEMB 3SK4A 4BY7H 4LUOA 1TT2A 1NAPA 1M8AA 1B2TA 3B6YA 2EYPA 3BG3A 1XYIA 2E5LL 3PO3B 4U6RA 3QB3A 3PCOB 1SNMA 2NTSA 1VQNA 2VQFQ 2DUDA 2RBMA 3L0OA 4H7BA 1EY7A 2OF1A 1A3UA 1FD7D 1LTLA 4R4OA 4A3DG 2JBWA 3GD7A 3RUZA 4DR5L 1S5ED 1LO5D 1X56A 3RZDH 1HNZQ 2MHVA 1YI2A 4IO9A 2NZOA 5M3MH 1Q8IA 4LUVA 5C4XG 1QB5D 4CJ0B 1K83H 5C3XA 1O80A 4FXGC 4H13C 1PH4A 1E2WA 3S2DB 1ZKOA 4PMBA 4A3FG 3K8AA 1ET6A 3KF6B 2ENBA 1TR5A 1A63A 2A1AA 4JI1L 2B2UC 3D0FA 3M3YB 1WJJA 2D0OA 3CPFA 4FYDA 2EXZA 2JEAI 2A6HC 1C8CA 4C3HH 3ERSX 1Y8OB 2D5DA 2R3ZA 4C3IH 4KLKA 2V6EA 4N9TA 4V0BA 1G91A 5E3FA 4A4IA 1K28A 4K0KL 4HEDA 2AKWB 4PMCA 4X65L 4KN4C 2ICEC 4JI4L 4B3SQ 2QF7A 4DR1Q 1ENCA 1TWCH 1RDPD 3DWAA 4J1MA 5EAYA 4X66L 1RTOA 1R4PB 5ELEA 5IWAQ 4F88A 1D5ZC 1CSQA 2B2TA 4DV1Q 1LM0A 5K36G 1AH9A 1B9NA 1CKNB 2A2CA 1QVFA 1U4RA 4IUQA 4OHJA 3ER0A 1YITA 3FP9A 3NENA 3U4VA 2CH4W 3DWPA 3HKZE 4LFCQ 2NN6G 5IP7H 1KABA 1Q12A 3M9BA 1N36Q 1VQEA 1PHJA 4DV6L 3S16B 1I5FA 5CR3A 1Z9FA 3ICEA 3A7AB 2X6GA 2JA5G 2BE5C 4IPCA 3F2CA 1A3VA 1UWVA 4DUZQ 3F2UA 3FPUB 4C56C 4X62Q 5GROA 4YIJA 5JJZA 1VQPA 1CA6A 1CFMA 4KKSA 3S2HB 2R7ZB 2DJFC 3I91A 2F4IA 4Z7HA 2CCZA 1WTQA 2RKSA 4NXML 2CW0D 2M9VA 2RCFA 1H9JA 2L1LB 5KNDA 2XTRA 4OWWB 4V190 2MPMA 2L9HA 4Y7NH 1IKMA 5EPLA 2JA8B 1IBLQ 5IY0A 1TY0A 2LFNA 1QJOA 3HOZG 1AP0A 4C3JB 1JOOA 3HOXB 4JYAQ 4DNTB 1DONA 4JI6Q 5C6AA 2IY5B 1CKOA 1PRTC 1B70B 4CJ2C 2HGKA 4AYBB 4R4TA 1SNDA 2MGSA 1TWAH 2N55A 1XNQQ 1NCVA 4KHPQ 2Q2IA 3S9WA 1DJRD 1E0BA 1VQ6A 3HRZC 3GP7A 1KHIA 1ONLA 2UU9L 2E2DC 1RKNA 5AJ3Q 4A3GH 3NP8A 1I94Q 2JP1A 2YTVA 1Y1VG 3WWVA 1GD7A 4A3JB 5C4ZA 4L63B 3MXGA 1GHKA 1F9PA 3MVVA 1EEFD 3P20A 1HNXQ 4IPGA 5FJ8G 4P75A 5BN5A 1V1PB 5FLMH 1LLRD 1EQVA 4ZKBB 2MO1A 5CC4A 1K8AC 1PH1A 1I3QH 3OSOA 1VQ7A 2O4XA 4LW1A 5KEEA 3I2ZA 4UHVA 5A2QE 3P75A 2E2HB 1EY6A 1LTSD 2R93H 2V4DA 1TQOA 2KHJA 3J7ZC 1X54A 5T1GA 2YFAA 1FNVA 1MKHA 4JCVE 3RN5A 4A3EB 3GTQB 3NSWA 1VQJA 2AQ1B 4H02A 2RVLA 1SYDA 1GUTA 3EN2A 5M3FH 4N8FA 1PZKD 1UEAB 3CQZB 5KRUA 3I4NH 3ZYYX 4RA8A 5IYBH 1XNRL 4DN4M 2WINB 3SDZA 1ENFA 3URYA 1V9PA 1XMOQ 2A68C 1IBKQ 4G75A 2O2LD 2X6LA 4APVA 2FUG1 4F87A 3J81i 1B3QA 2AWOA 4FF2A 2E5LQ 2KHSA 3LX0A 1Y1WG 1SFOB 3TMEA 1IHZA 3H3VI 2FMMA 2UXDL 1UE1A 1U5KA 4HJ7A 3KJOA 2EJFC 4QJFA 5IOCA 5HURA 4O1PA 3QWNA 4FXKC 3T51B 4R9WA 5CORA 3H3VC 4XQNA 2B2VA 4QUFA 1QG7A 3CU7A 1IL2A 4N9PA 5EJWA 2B2WA 2XIWA 5I9PA 2Q2UA 4BBSB 3KDFA 2IWHA 1SEBD 4DV4L 1CKMA 1H95A 3Q22A 1KD1C 4DR5Q 2EOTA 2EVBA 1ML0D 1SE4A 5IP9G 3L2PA 1JB7A 2F0LA 5NUCA 1S5FD 4GLVB 4WJWA 3IFTA 5FLXc 4UP7A 3S2DH 4POGA 3AJFA 3DA4A 2WB1E 4DR6L 3TDQA 3CMAA 1ZEQX 1NSNS 1U9RA 4IUPA 3EQLC 1OXSC 1F77A 2DY7A 4GN4B 1A62A 4QF4A 2ZM6L 4K0KQ 5ELNA 4X65Q 2Q8TA 3NELA 1YIJA 4JI4Q 3E9IA 2GVBA 2XVSA 4X3KA 3EJIA 4XYOA 3C3LA 3K5OA 2AUJD 3MEFA 4GNXC 1BBXC 1EWHA 3G6JB 4PMWA 3KK7A 4X66Q 4DPGA 3TP5A 4XT1B 5GAEC 1DOLA 1X3EA 4LF7L 1SYGA 2MP1A 2WV6D 3TRZA 2JA5H 4AIMA 1YHQA 3EROA 1L1OC 2PQAB 1R9TB 4GKKL 3CCEA 3M4YA 3CP0A 1K9MC 1EIGA 1ZXTA 5C0XI 2WIIB 2KEDA 2K5WA 2K6AA 2K28A 1HPCA 3AMUA 1TWHB 4P71A 4BXXG 1PTOB 4OWXB 4LF4L 3G48A 3CXCA 4DK1A 4CDCC 3VA9A 5DM63 2SNSA 4O1NA 3HG9A 4KV6A 4YZDA 1CQFA 3T56B 1LABA 3HOZH 3UI2A 4HMJA 1STNA 4A93B 4H44C 4DV6Q 1GUWA 2IHFA 3RLNA 3K5MA 2VUMB 2NZ1D 1CZWA 4HIDA 1SMXA 4G7HC 4UDUC 3P23A 1JOQA 3HFZB 1PH9A 3S16H 2QKIC 1NNXA 2B2UA 1OXXK 5JOBA 4JOIC 4BA1I 2EYHA 3BZKA 3T1YL 4ZUIA 5IYCG 2N88A 4LFBQ 3FBVA 3M7GA 3Q0AA 1Q1EA 1BCPD 1MJCA 1E1TA 3Q24A 2E2JH 5IGBA 4DR3L 1HA5A 1HZAA 5D14A 4NXMQ 4P2CB 1VQCA 3S2HH 3CMEA 4A3KB 2WFWA 4KJNA 1F2ZA 1QILA 2BL7A 4BBRG 1BCPF 2ES2A 2Z8LA 3D8GA 2ATWA 4JPBW 4BY7G 2AMCB 3S1MB 5M5YB 1TWGB 5AFWA 4HJAA 4B9WA 2JQOA 1BR9A 4B9XA 5FKAC 3ERQA 3KLWA 3QOJA 3HOXH 3GTKB 2CKZB 2B2YC 4S3SA 2RDGA 2IW3A 1I4PA 2UU9Q 2QW7A 1M1KC 4CJ1B 1HZ9A 4ABNA 2K33A 2PNHA 1JQOA 1EYDA 3VR3A 3F2BA 3CC4A 1S5DD 1T9HA 3OIPA 4JI2L 1D7QA 2R61A 3E5SA 3HKSA 3MA2B 2F6MB 4A3JH 5M3MG 5FO7B 1AE3A 2WAQG 2LXJA 3K7AH 3HOUB 1RD9D 2A6EC 4MZ9A 3G7LA 3I56A 1CM9A 2MUYA 1DYQA 4DNRB 4P72A 4C3HG 3SXHA 4ZQ3A 3GO5A 4RHSA 4QY7A 4C3IG 1PMRA 1BO0A 1CK1A 5JPMC 4KD4A 2K5QA 5C44B 3GTQH 5IGFA 1Q1BA 4DAPA 1SN8A 1XNRQ 1DXMA 4RGOS 3I90A 4LF6Q 1KAAA 4UPAA 1SRUA 2IJ0A 5CV8A 2SOBA 2N78A 4HJ5A 4XTCS 5IP9H 4DV2L 4RKLA 2CWPA 1AEXA 4CHTB 1RL2A 2I46A 4HSPA 3J7A5 4A3CG 2VNUD 1CI3M 3HOYB 2UXDQ 1CQVA 2A6HD 2F0SA 3QR8A 1N32L 4YZ9A 1SFOH 1XTCD 2F52A 4X3UA 4YZCA 1K0SA 1N8RC 3LJ2A 4EGVA 1TS5A 4GOPC 1NE3A 4DU9A 2Z1CA 2DNCA 1DOMA 3QO2A 4Y52H 3I7FA 4DV4Q 4FF3A 4HEA1 2VZAA 4GXTA 4IZ8A 1SNPA 1TVXA 4HSVA 3PSIA 1HNWL 5CGKA 4QUCA 1Z47A 1WTWA 4HJ9A 5JVH3 4G76A 4BBSH 1VQBA 5T1IA 4DAYB 5IGCA 4JBJA 5IP7G 3BVZA 3HOVH 1LT5D 3LWUA 4DAMA 2KVMA 2ZRRA 2RDHA 4TRDA 2Z6KA 1AZPA 2D0PA 2C9OA 1STGA 2NVXB 3CAMA 2K5HA 4L5RC 5E4XA 3F1ZA 3GTMH 4CKCA 5M9OA 1EZ8A 1PVOA 1DCZA 4JW0A 3KLSX 1XNQL 1HFNA 2VL6A 3S1RB 2K05A 2Z4IA 2ZM6Q 2L15A 3GTPB 4HJ8A 3F4MA 2B29A 5ELCA 1PTOC 2EYJA 4MIUA 1PDQA 2F0EA 1SYBA 5IT9c 3H6MA 4KKUA 3DUZA 1GUOA 2F0VA 1YZ6A 3I72A 3NTKA 3M85A 2M2LA 4WRDA 1QWYA 1WOCA 3MTSA 2AUKA 2NVQB 4YCVA 3JAME 1PYBA 3TQYA 2WAQE 2K32A 4GKKQ 3KF6A 3LNNA 1XJVA 1TXYA 1Q81C 4K5XA 1X32A 3IAM1 1K3RA 1GHJA 1VQFA 3OMCA 4K8JA 4KK7A 4AH6A 1ILPA 1VMPA 5IT9L 1R9TH 1VQAA 3H0GB 3OMGA 5C4JB 4PG3A 4LF4Q 2Q2TA 3IKJA 4DR2L 1LTTD 3M4QA 3HEJA 2QCPX 3PIPA 2K75A 1H9KA 5FLMG 1HR0L 1I6HH 1JWUD 1PRTD 1IBKL 4EQPA 2CAZB 1B7YB 2R93G 3U9SA 2YTYA 1PZID 3BDCA 2JA6B 2VUMH 3T1YQ 1HTLD 1STBA 5JEAH 4A3IG 2J0TD 2L4NA 2FMCA 3S14H 2QEJC 4DR3Q 2EXDA 3TN2A 5BN3A 3VDYA 4A3FB 4P73A 2PPBC 1O7YA 4M1UB 1CKNA 4GN3B 5JAVA 4UP9A 5M3FG 3RZOH 3NPPA 4KY5A 5D3IB 4F8MA 3KFUA 2CQOA 3I4NG 3A5ZB 1VQ4A 5IYBG 1RF2D 4DUYL 2CQAA 4A3KH 1F9RA 4QMGA 4PL5A 5HGTA 4AQYL 4LFAL 1RTNA 2Q2HA 1HRJA 3E0JA 2RSOA 2A69D 1PH2A 2AWNA 2DN8A 5M5YH 2F0MA 1TWGH 3OWFA 4EQOA 4IUTA 2IPKD 1VQIA 3MXUA 3T1HL 3HP3A 1HQRD 3GTKH 2F0NA 4LAAA 4G7OC 1EYCA 3J80E 3BS1A 1UE5A 3DWQA 2R7DA 1FNWA 1N9WA 2NBFA 2RLDA 1B4OA 2D62A 4LUZA 1KDBA 2BH8A 4RWSC 4KN7C 2NTTA 2HHHQ 4JI2Q 1B3AA 2A68D 2F0WA 1B50A 4TQUS 5C3EB 1PV4A 2L12A 1AZQA 3H94A 2XWBB 1TS4A 1XMQL 2I07B 5EKKA 2MO0A 2ZT9C 3AQQA 4TSSA 4A3CH 3HOUH 2F3WA 4Z9CB 4A3MB 1J6QA 4ZCKA 4DK6C 3I3CA 4E6IA 1O7ZA 4N8X1 4ULLA 2QZGA 5M5WB 4FVMA 4HTHA 4WJ4A 1BXTA 3F2DA 5LMNQ 1HUNA 4F7XA 3FDTA 4ZLTF 1DOKA 3FPPA 4ILWA 4ODGA 2QGMA 4KTAA 3MAQA 2PZUA 1JQYD 1S72A 1PH8A 1VF5C 1LTRD 3J7YW 4XYQA 2K1BA 4XQJA 1U4PA 5L37A 5C44H 4P74A 3CRLC 4GNXB 1YBYA 4DV2Q 3P1HA 3J81E 4XT3B 3S1QB 1V1PA 3CC2A 2AHOB 2FEFA 4I7ZC 3PO2B 1LACA 4OO1I 1L1OB 2H1EA 1N32Q 1TWFB 4OAUC 2QILA 2WP8J 2NVYB 4ZAIA 3G6EA 4GN5A 3H15A 3NQIA 3VR4A 2K7VA 2IT1A 4LFBL 1DZ1A 3EIVA 5C3WA 2OQ0A 1C7YA 1HNWQ 2Z6BA 3PUVA 1S4ZA 1HQMC 3GTGH 2HT1A 3NTIA 4HR7B 3Q6SA 5H1SE 4FP5D 2WB1G 4K5WA 2KCMA 1HA6A 4O42A 2C35B 1J8IA 1K8OA 1G8ZD 4KD3A 1SNOA 1QVCA 2BH2A 3NE5B 2NVXH 4JI3Q 2K19A 3CCMA 4IJHA 1ICWA 4EQNA 1V8QA 3A74A 1EYGA 4NW2A 4OO1H 4DV3Q 4NV5A 3UDGA 1PFMA 4IOAA 1KLGD 1LTGD 1J5EL 2FHTA 3VYRA 2PW5A 2BDNA 1NR2A 5EKLA 2R7ZG 3TS2A 5ISRA 4LK1C 2ZJRA 3GTPH 4K14A 4ZYSA 1C0AA 4JK1C 2F0FA 5C0XG 2LSSA 2A19A 4O1OA 3KBGA 4MHEA 2JA7H 2JYOA 3AYHB 2JA8G 4IPDA 3RR5A 3K0XA 3AEVA 4OAVB 1M4VA 1VF7A 1A6XA 1LYLA 2GN5A 3HOXG 4OL7A 1VQKA 1EQRA 4YWLA 2JA9A 3NQTA 4BY1B 2NVQH 4ZRZA 3I55A 3TSSA 1QUQB 4A3IH 5CV4A 4AYBG 5EKIA 5KIXA 1DGSA 4JV5L 3L0IA 3ULLA 3CW2C 4DR2Q 3K5LA 1MD2D 5IGEA 1NBWA 3H0GH 5C4JH 2NVTB 1FL0A 2N8NA 3V05A 5CMDA 2UUAL 2B39A 1HR0Q 3S15B 4A3JG 4LF6L 3QG1A 4PL4A 2IX1A 2F3IA 1EY0A 1AFPA 5DEHA 4YHHL 1OXUA 1I4QA 1CZGA 3IRBA 2EQSA 2B8FA 1PA6A 1KXLA 3PIP3 4OGQC 2PQAA 3PO3H 5FLXE 4ID6A 4OELB 2JA6H 4KJOA 5LMUL 3T53B 1U4LA 1X3FA 1QOHA 3CKIB 3AU7A 1VQMA 1NJIC 2Z4HA 1X65A 3DO9A 3J7AV 1L0WA 4RG1A 4X6AH 3FKIB 1VQGA 3HS0C 1D5MC 3GTJB 4JG2A 5I6YA 4DV7L 3MXNB 1NUCA 5HY6A 2IL8A 5GQOA 2JB3A 2XTIA 4DUYQ 2R92B 3MFYA 3IAS1 2PCFB 1W2BA 1G291 4B08A 1STAA 4AQYQ 3I4MB 2UXCL 4LFAQ 4IUVA 3T4AC 1XX8A 2OQKA 3GTLB 4IN3A 1EEID 3JC66 3ONAB 5CBEE 1KL9A 1MBYA 3ND8A 5A2QL 1AE2A 3T1HQ 2F0HA 1E3PA 1Z7TA 5IIFA 3LJ0A 2LMCB 4GOPB 3A8JE 5I2XA 3M3YH 2E2IB 4A3LH 1SYFA 3H3VH 3QOLA 1NMGA 2MJ8A 3D6WA 2RF4A 3OW2A 1D1KA 1LV9A 4IFDI 2B63B 4BBSG 2PZWA 2C5CA 3DA3A 2VS1A 2K4KA 3LGJA 4RMFA 2E8GA 1D2BA 4FNFA 1G6ZA 3HOVG 2EYOA 1XMQQ 4QGUA 5BN4A 1OXVA 3DHQA 5C3EH 5TSSA 2KOLA 1JMCA 4XIGS 1F2MA 3EA6A 3NBHB 5JJIA 3S1NB 3HZXA 4PZ6A 4KI0A 3M7NA 2ETDA 2F0UA 1VQ9A 4A3MH 2KCNA 2F66B 1E2VA 3OWEB 1Y8NB 2MFIA 3VYSA 5M5WH 4DFAA 1E22A 1UAPA 4B3TL 4AYBE 4ZKCB 1ASYA 4FXDA 2GVAA 2HIXA 1WCMB 1W6KA 3PUXA 4UP8A 5J1ZA 1PH3A 1R4QB 4A3BB 1T5XD 1IW7C 4UY8C 1A3TA 3AFQA 3J81j 2O5JC 4IFDH 1JJCB 4DK0A 1SMYD 3S1QH 2RDFA 3PO2H 1HHVA 4IUNA 5EPJA 3H91A 2L5TA 1QZHA 2OT2A 1WI5A 2VB3X 1TWFH 1TDPA 2B3GA 3HOWB 1GOZA 3RN2A 1PFNA 2EDGA 1ICFB 3MEHA 1FR3A 1PTOD 3UDFA 3NWTA 2Y0SB 2R7ZH 1K8MA 4C1NK 2B2TC 2E74C 4AS2A 2JXMB 4B3ML 1A2UA 5E1FA 5C0XH 2ZXRA 2DY8A 3CD6A 2UUCL 2EYLA 1JE5A 3LJ1A 2JA8H 4CDDC 2P5ZX 5G3LD 1MHWC 3GV3A 4POFA 4A93G 4C3JH 1ZYRC 2CH4A 1STHA 3RZDB 4OXPA 2VUMG 3TREA 1G51A 3A7LA 4GKJL 4RHRA 3CCJA 5JEAG 3RD4A 3JSBA 2FINB 1SAPA 4BS9A 2ZW3A 1J5EQ 5D3DA 3UE1A 4TKOB 1HZBA 2OTLA 3CPWA 1E24A 3E3XA 2F4VQ 2HHHL 3K59A 1JOKA 4RCNA 3ULJA 1RIPA 4GZYC 4DAYA 4A3KG 1Q8KA 3MWYW 4IOCA 2NYZD 1MIUA 2N49A 2A74C 1VQHA 4NKLA 4QIWB 3L9AX 1SE3A 2K03A 1OO9B 4JVZA 3TP7A 3CCUA 4PL3A 1TKWB 4LJZC 5KYLA 3P7JA 1BF4A 2EPBA 1EIHA 2E2HH 3BZDB 1X9NA 4OX9L 2VQEL 4PZ7A 4BY1H 5LMNL 4DV5L 4JV5Q 4R4CA 2YFBA 5EQ0A 4K2KA 3FVVA 2HDMA 2KENA 3WDNA 2ZTCA 1C48A 4A3EH 1KAWA 2A8VA 3I8ZA 4KHVA 1L0XB 3K6OA 3NWSA 2K04A 2UUAQ 3OW7A 5COYA 3RLOA 5K5PA 3C2PA 1QE6A 1RODA 4GLXA 1EOTA 4LMQD 1GVPA 5DM73 1BUVT 3CQZH 4L5TA 2NVTH 3J7AF 4YHHQ 4FO2A 3D3RA 5J22A 3S15H 2MQHA 4OONA 4HCSA 2KBNA 2QSBA 1IYJB 1Q46A 1IXRA 3SDJA 1TIID 4JC0A 4XXEA 3B55A 3HOUG 3DM1A 1S40A 4KKTA 3CHBD 4YCUA 5LMUQ 3QJYA 1NTGA 3GV6A 1MGSA 3SGIA 1MI2A 4ME3A 3K58A 1JCKB 3PIOA 2OTJA 3PF5A 3RNUA 3D4RA 4DV7Q 3TZUA 2GSCA 2ZXOA 4RAUC 5IODA 2VB2X 5C44G 1EUJA 2RADA 1B44D 3C1FA 2UXCQ 2XGTA 3G4SA 3A56A 1Q90A 1SJED 1X3GA 1GUGA 2R92H 5J39A 1X3PA 3PF4A 1S3OA 4DR4Q 1YNJC 4Y7NB 1HZCA 1KRSA 2YYZA 3BDOA 1SSOA 3IFDA 1OTCA 3D4DA 3PGZA 4JI3L 1OXTA 4Q9VA 4DGZA 1LT6D 4DV3L 1QVGA 2E2IH 2YU9B 1FVIA 3STBC 2X69A 1GKHA 4UAIA 1TWAB 2L55A 2NWGA 1EQTA 1IYVA 1FYCA 2VY3A 4OWTB 1V1OA 3VR2A 1QZGA 3HKZB 3CRKC 4A3GB 4LF8L 2PYKA 1PYWD 1WD1A 2B2WC 4LF9L 3KLSA 1LTBD 2BE5D 2Y0SE 2MNAA 5CBAE 1AW7A 4K6DA 1JR0D 3PUYA 1NY4A 3BJUA 1EU3A 1BCPC 2K01A 1JE4A 4YWMA 2PW7A 4PZ8A 1IKLA 2O5IC 3CCQA 4RH6A 4DV0L 2KHIA 3SR1A 1I3QB 4OO1G 4B3TQ 1SYCA 1PFSA 1H9SB 2WKDA 5E7NA 2ID0A 3TEHB 3E0EA 1HR0W 2LS01 3W5OA 1TWHH 3OTOL 3UITA 1VS0A 1EY5A 1PTOH 1KC8C 3R93A 4BWGB 4DAVA 1XXGA 1WCMH 5JVG3 2JA7G 1BQQT 1SROA 2L1BA 4JI0Q 3K57A 4A3DB 1PH7A 2ZJPA 1CTMA 1SBBB 4A93H 2D2CC 5D65A 2J7ZA 1RJTA 2DNEA 5EBDA 1BDOA 3UDXA 3VYUA 5I4DA 4R8IA 1D8LA 2JEBI 4RGMA 5C4XB 1PRTF 4EX5A 3GTOB 5JPNC 1ET9A 1W3SA 5M5XB 3JAMc 4G4KA 4Q0FA 1QNKA 3HOWH 2FXQA 1WFQA 3H0GG 3V2TA 4B3MQ 4KY6A 1YHBA 4L5SA 3RMHA 1WTRA 2UUCQ 4YY3L 3I9V1 3D6CA 3DEOA 4GS3A 3SVMA 1LT4D 3W1BA 3LWEA 4GNXA 2I0QA 5HGIA 4PQXA 1TU2B 2EY5A 3I70A 1SE2A 3S1MH 3HGBA 2PMZB 1FNUA 4DR7Q 1VMCA 2A73B 3JAML 4GKJQ 5C5MA 4WJ3M 1VQDA 1L1OA 3IAYA 1F2YA 5GAHC 1I50B 2RSNA 5FOBB 4OIKA 3PO3G 2JA6G 3X3MA 1XPRA 1GJXA 3FNBA 2NZHA 3K80C 1I4GA 3DMUA 1YJWA 3OHXC 5JJLA 1K0RA 1V43A 3NHHA 4A75A 1EY4A 4C1NI 1ASZA 3ND9A 1GM5A 3CCRA 3DLLA 4MNOA 2IX3A 3KF8B 4KY7A 3EFXD 2D9UA 3C1EA 2F0GA 2UUBL 4L5QA 1ESRA 3A55A 2SDFA 3D4WA 2XSCA 4IURA 4FDBA 1SJHD 2DGYA 1FGUA 3WOFA 3SHLA 3CF5A 2NB0A 3BDLA 1WTOA 1ENAA 3IL8A 3BZCA 4OX9Q 2VQEQ 4JOIA 5FO8B 1SLJA 4DV5Q 4A3LG 3SE0A 3E6ZX 4J15A 2AQ3B 2JA5B 2H4OA 1ESFA 3EVQA 4LNQA 1VCIA 1LTID 1JC7A 3NXWA 4FF4A 4RGNA 4X3TA 1YEZA 1PZJD 3Q8DA 1D6EC 1MJEA 3DXJC 2K14A 3J80c 2LXKA 3JAMi 4CKEA 1EZ6A 1LUZA 2HCCA 2N3SA 3A8IE 1N33L 5C3EG 1B8AA 1XWEA 3A54A 4B3RL 1WTPA 3S17B 2OWOA 1O7IA 1O78A 1K3BC 3RLFA 1VQOA 1A2TA 4BA2I 2IX0A 3KJPA 4G7ZC 3HOYH 2B2YA 3K5NA 3HOZB 4NB3A 2EY1A 4A3MG 2JJQA 2ZJQA 3V96A 1QUQA 1P16A 2WB1B 3J80L 1GXDC 4O0AA 2R7FA 3WOEA 1BKBA 5IE8A 3U50C 1CSPA 1CUKA 2DJGC 3A5UA 1Y8PB 1SR3A 1EL0A 2F03A 3U4ZA 2ZTDA 2RQXA 2RHQB 4KMUC 5JJKA 2E2JB 1SNQA 2K50A 3PIO3 1GUSA 5DLQE 3Q23A 4R1JA 4IFDG 3OYYA 1XPOA 2KECA 1Y1VB 4G57A 3UE0A 4CKBA 5LL6X 4ALPA 5KYIA 5EBCA 1BBWA 3PO2G 2NUCA 5EPKA 5IYDG 1SE8A 4KHZA 3J81c 4X64L 4NXNL 1YNNC 3OOCA 4HMIA 4EVOA 1IBML 3S1RH 2JK8A 2EJGC 2K5VA 1D1IA 1VQ8A 3BYYB 4JI8L 3A0JA 2Z9HA 1IW7D 2YU9H 2F4VL 5GAGC 1UE6A 3MXNA 4I7AA 4LF8Q 2JE6I 2F3VA 3BYTB 2Q8IB 4LF9Q 1G2SA 1WVLA 3J81L 1YJ9A 3N52A 3BVMA 4DK3C 4HIOA 4C3JG 1F9QA 1E1OA 2HIVA 3J80i 3ULPA 1C4QA 4L6TB 4YWKA 3N6RA 2BDOA 5ELFA 3PV0A 4DV0Q 1N34L 2L11A 2VXWA 3K7AB 2BOSA 3QIAA 1I4XA 5JEAJ 5BR8L 3R2TA 4L8JA 4NPSA 3L3OC 4GOPA 3CCLA 1Y1WB 4U68A 2Z6KC 2PMZE 1DD2A 1X3QA 1XTDA 2ALYB 4Z7GA 5DAUA 1YNXA 2QA4A 1JT8A 2HQEA 2K5NA 3OTOQ 2G9DA 3OPOA 1WTHA 1ILQA 1CHPD 5ELBA 2OXPA 1A8VA 5C5LA 2A69C 2F0DA 2WKCA 2KUMA 1JJGA 3NUCA 1D5XC 3U58A 2BCOA 3KP9A 1UUPA 2PZTA 1ZYRD 4CDFC 2K52A 4IJLA 2ICIA 4IUUA 2ZTEA 2BL8A 4A3DH 1II3A 4RKBA 1C9OA 2OCEA 3NBHA 4R4IA 5CV5A 3MC0B 2ZXPA 4BY1G 4J6HA 3FVQA 3CCSA 4DXGA 1B9MA 3MHBA 5C4XH 3K0YA 2KCCA 3GDEA 1EY8A 4A3EG 4NMZA 3GTOH 1BVSA 2XTQA 2UXBL 4A3FH 2PI2E 5M5XH 1KDCA 3PQIA 2MJFB 1KTKA 1U4MA 1PYSB 2G5DA 1E2ZA 2V1CC 4GLAC 2TSSA 4JI5L 4YY3Q 4PV1C 1KDAA 2A6ED 3KBXA 2K5DA 5CYUA 1CHQD 2NN6I 1WYDA 5FK9C 1I4RA 1YHAA 2XRSD 2HDLA 4RFBA 2OEOA 1WTXA 3PUZA 4LF5L 4DR4L 3SK5A 3HOVB 3PMFA 1NR4A 1YO7A 2AQ2B 1WD0A 1UEBA 3KYHC 1Q3LA 1I50H 3G71A 2HD3A 1EQQA 2KJXA 1PLFA 1YVCA 4CDEC 4RGTA 4O2DA 3ZJYC 4K2LA 3GTMB 4JI1Q 3R3OA 1JJ2A 4C2MB 1K8GA 2BA0A 2UUBQ 3FKIG 1HFGA 3CCVA 1NMFA 5K36H 2FFKB 1Z6HA 2R92G 1HXYD 3I4MG 2LY7A 4Q5VA 4JI7L 4IQZA 1A0IA 4CBVA 3DM3A 4FF1A 1JB3A 2SNMA 1SJ8A 2CW0C 5KNBA 2NN6H 2QDBA 5FLXL 2XRQD 4XQQA 2LKVA 5CV9A 3D31A 4M8AA 2XWJB 1AN8A 4H0LC 1KLUD 3S24A 4R4QA 5IGGA 2QGQA 1HTPA 2EE1A 3FMCA 5C4HA 3I4OA 3NK9A 4WFN3 1B53A 2B63G 1N33Q 2JB2A 4MN3A 1CA5A 1FJGL 4B3RQ 1E7ZA 3KDFB 4JI0L 1YNJD 2WACA 3I73A 2TMPA 1XPUA 3A8KE 4NDXA 1G6PA 1TY2A 1BCPB 2KQ3A 2YTXA 2IP6A 3W1GA 1KRTA 5IYDH 2F0IA 2PQEA 3M4OB 3S17H 4BBRB 1I6HB 3CC7A 1EOVA 1X55A 4BY7B 2EIFA 3DEPA 2NVYH 3STBD 4YCWA 2EZVA 2EYMA 1T5EA 5I2YA 1BNZA 2HQLA 1BOSA 2GA4B 3K7UC 2E76C 2RIOA 1SYEA 2BA1A 3S14B 1MSHA 3TS0A 4U673 1JORA 1WCMG 2FJ2A 3BU2A 2JAEA 1PTOF 1Y14B 2I5HA 3MFGA 2L0CA 4A3BG 3NEMA 1JWSD 1S5BD 2VQFL 3RZOB 3NBIA 1EFID 2RHSB 3FHWA 2F0KA 2JN4A 2RA4A 1PH6A 1YJNA 1J9OA 5KGUA 1Y1VH 4NV2A 4DR7L 2KKMA 5M3MB 2PO4A 5FO9B 4X64Q 4NXNQ 3VA7A 2WAQB 1K83B 1EIFA 5A35A 5G3LF 5FJ8H 4PNYA 1PFBA 3SEBA 1Q7YC 1HNZL 2F0JA 2I5LX 1GO3E 4HIKA 1IBMQ 1S5CD 2EJMA 1IZ6A 1FGBD 1TS3A 1VQ5A 3HOWG 1GUNA 1M90C 3T16A 3VYTA 5I9OA 4JI8Q 3SK8A 1UE7A 2IHEA 4X3SA 4C3HB 1EU4A 2Y0SG 4C3IB 1L0YB 4HFVA 3VA5A 5LNK1 5GADC 1SNCA 4QCLA 2YV5A 1H9RA 5LMNW 3C46A 1B1ZA 4HAEA 1N34Q 3TP6A 1STYA 1TWCB 5BR8Q 2A2DA 1G2TA 3T13A 2A5HA 4B3SL 1SXTA 4DR1L 1PXUA 4HCEA 2Q8RE
chains in the Genus database with same CATH topology
3CMAA 3GTGH 2HT1A 3UDXA 1OXSC 1Y1WH 1D8LA 2JEBI 4GN4B 1A62A 2ZM6L 4K0KQ 5ELNA 5H1SE 4EX5A 2WB1G 5IWAL 4X65Q 2KCMA 3EBEA 3NELA 1W3SA 1YIJA 1HH2P 2C35B 3JAMc 4DV1L 4JI4Q 3E9IA 2GVBA 3HOWH 2FXQA 1QVCA 1K73C 1WFQA 3H0GG 3MEFA 2BH2A 4GNXC 2NVXH 4JI3Q 2CWAA 4B3MQ 2K19A 1YHBA 4PMWA 3CCMA 4IJHA 4L5SA 4X66Q 4DPGA 1KIXA 2UUCQ 4YY3L 3I9V1 5GAEC 3A74A 1EYGA 1X6OA 1X3EA 4DV3Q 4NV5A 3UDGA 3F8TA 4LF7L 4IOAA 4GS3A 3TRZA 1J5EL 4AIMA 2JA5H 3W1BA 1YHQA 4GNXA 1L1OC 2PQAB 4LFCL 2I0QA 5HGIA 2R7ZG 4GKKL 3TS2A 5J3BA 3CCEA 2ZJRA 3GTPH 3CP0A 1K9MC 4A76A 1C0AA 3S1MH 5C0XG 2UXBQ 2LSSA 2A19A 4EQ5A 4DR7Q 1N36L 4GKJQ 4WJ3M 4O1OA 4AS3A 5C0XI 4QQBX 1VQDA 3PUWA 1L1OA 4DNIA 2JA7H 5GAHC 4JI5Q 3PO3G 3AYHB 2JA8G 4P71A 4HIMA 2P22B 2JA6G 1U0LA 4BXXG 4OWXB 4IPDA 3RR5A 2NZHA 3K80C 1XPRA 3G48A 3FKIH 3CXCA 3GTJH 3K0XA 1YJWA 4OAVB 2VW9A 1EFWA 3AEVA 4DUZL 4X62L 3VA9A 1LYLA 1K0RA 2GN5A 3HOXG 1VQKA 1EQRA 4YWLA 5JJLA 1V43A 2JA9A 3UDIA 4YZDA 4A75A 2NVQH 3I55A 1ASZA 3HOZH 1QUQB 4HIOA 4A3IH 1GM5A 1EIYB 4LF5Q 3CCRA 3I4MH 3DLLA 4DV6Q 4MNOA 4AYBG 3KF8B 3GTLH 2IHFA 3RLNA 2UUBL 1DGSA 4HIDA 3HOYG 1SMXA 4L5QA 4JV5L 3P23A 1KQSA 4QL5A 3L0IA 3HFZB 3ULLA 1PH9A 3CW2C 4DR2Q 3S16H 2XMXA 1IBLL 2R6GA 1NBWA 1OXXK 3H0GH 3L7ZC 4FDBA 4JOIC 3BZKA 4MTNA 4BA1I 5C4JH 2DGYA 3T1YL 1FL0A 1FGUA 2N8NA 2UUAL 1HR0Q 3KOJA 5IYCG 4LFBQ 4JYAL 3FBVA 3CF5A 4A3JG 4JI6L 1Q1EA 1MJCA 4JBWA 4LF6L 4OX9L 1E1TA 2JB1A 2E2JH 4DR3L 3BZCA 1HZAA 4PL4A 2VQEQ 4OX9Q 4NXMQ 4JOIA 2IX1A 1SLJA 4DV5Q 2F3IA 4A3LG 1VQCA 3K81C 4YHHL 4DR6Q 1OXUA 2I5MX 2B63H 3S2HH 3CMEA 4J15A 4KHPL 2WFWA 3IRBA 4C2MH 2EQSA 4I1TA 4JBMA 4LNQA 1VCIA 2Z0SA 1PA6A 1KXLA 4BBRG 1Q86C 4JI7Q 2PQAA 2ES2A 2CFMA 1YEZA 2ATWA 3Q8DA 3PO3H 1L2FA 2AMCB 5AJ3L 5LMUL 1MJEA 2JA6H 2K14A 3J80c 4BY7G 4LWCA 4BXXH 1I94L 1X3FA 2LXKA 3JAMi 4HJAA 1VQMA 1NJIC 1LUZA 2JQOA 1X65A 2N3SA 3S1NH 3E9HA 1N33L 3DO9A 3HOXH 3KLWA 1L0WA 4RG1A 2CKZB 1B8AA 5C3EG 1HNXL 4B3RL 2ASBA 1EWIA 4X6AH 5ELOA 1VQGA 2OWOA 4JG2A 1O7IA 4DV7L 3MXNB 1V1QA 1BBUA 5GQOA 2JB3A 2XTIA 5HY6A 2QEXA 3RLFA 1VQOA 1PH5A 2UU9Q 4DUYQ 1M1KC 4BA2I 2IX0A 4LF7Q 3IAS1 1HZ9A 3KJPA 1W2BA 3HOYH 1G291 2PNHA 4NB3A 4AQYQ 4A3MG 2UXCL 2JJQA 4LFAQ 2H5XA 2ZJQA 3F2BA 2OQKA 1QUQA 3CC4A 1P16A 3JC66 1T9HA 5C0XJ 4IPHA 1KL9A 1FJGQ 4O0AA 2R7FA 4JI2L 1D7QA 3M4PA 1BKBA 5IE8A 3U50C 1AE2A 5IYCH 3T1HQ 3HKSA 4A3BH 2F6MB 4A3JH 1CSPA 1CUKA 3AFPA 5M3MG 4DKAC 3A5UA 3HKZG 4A3GG 1E3PA 1AE3A 1SR3A 3LJ0A 2WAQG 2LXJA 3K7AH 4GOPB 3M3YH 1Q82C 4A3LH 1P8LA 4MZ9A 4DWLA 3U4ZA 2ZTDA 1HJPA 2RHQB 3I56A 3H3VH 5JJKA 1NMGA 1VQLA 2K50A 4TVAB 4LF4L 5DLQE 2RF4A 5HGQA 3OW2A 2KCTA 4R1JA 2PI2A 3M4OH 4IFDG 3OYYA 4QIWE 1XPOA 4IFDI 4BBRH 3UE0A 2RCNA 4BBSG 4P72A 1XMOL 3DA3A 2VS1A 2K4KA 3LGJA 4RMFA 4ALPA 4BY7H 1BBWA 4LUOA 2E8GA 3PO2G 3GO5A 5IYDG 4QY7A 1SE8A 3B6YA 4KHZA 3HOVG 1XMQQ 4QGUA 3J81c 2E5LL 1OXVA 4X64L 5C3EH 4NXNL 1JMCA 3GTQH 4XIGS 4U6RA 1Q1BA 3PCOB 1SN8A 1XNRQ 3NBHB 1VQNA 5JJIA 1IBML 3S1RH 2JK8A 4PZ6A 4KI0A 3M7NA 2VQFQ 2DUDA 2K5VA 4LF6Q 4UPAA 1SRUA 3L0OA 1VQ8A 2N78A 4HJ5A 1LTLA 4XTCS 4JI8L 3A0JA 5IP9H 4R4OA 4DV2L 4A3MH 1VQ9A 2YU9H 2F4VL 2F66B 2CWPA 4A3DG 5GAGC 1RL2A 2MFIA 1UE6A 3J7A5 5M5WH 3GD7A 4A3CG 4LF8Q 2JE6I 4DR5L 2VNUD 1X56A 2UXDQ 1E22A 4B3TL 3RZDH 1HNZQ 4JBKA 4LF9Q 1YJ9A 4AYBE 4IO9A 1YI2A 1ASYA 2NZOA 1N32L 4YZ9A 5M3MH 4LUVA 2F52A 2GVAA 2HIVA 1E1OA 2HIXA 3J80i 4DK3C 3PUXA 4YZCA 5C4XG 1K83H 3ULPA 1N8RC 3LJ2A 4UP8A 1PH4A 4GOPC 1NE3A 4YWKA 1PH3A 4A3FG 4Y52H 3K8AA 4UY8C 3I7FA 3KF6B 3PV0A 4DV4Q 1A63A 4DV0Q 2A1AA 3AFQA 4HEA1 3D0FA 4JI1L 2VZAA 4GXTA 3J81j 1N34L 1WJJA 1JJCB 2D0OA 3CPFA 3PSIA 5JEAJ 5BR8L 1HNWL 1Z47A 4HJ9A 4NPSA 4G76A 4BBSH 4GOPA 2JEAI 1VQBA 3CCLA 4DAYB 3S1QH 2Z6KC 2PMZE 4C3HH 1XTDA 2ALYB 3PO2H 4Z7GA 1JT8A 1YNXA 3ERSX 4JBJA 2QA4A 4C3IH 4KLKA 2K5NA 5IP7G 3OTOQ 3HOVH 2V6EA 1QZHA 4DAMA 1WI5A 1A8VA 1TWFH 2ZRRA 2B3GA 4A4IA 3RN2A 4K0KL 2Z6KA 2AKWB 4X65L 2D0PA 1JJGA 3CAMA 2K5HA 3UDFA 3U58A 3KP9A 4L5RC 4JI4L 4B3SQ 3F1ZA 2K52A 4DR1Q 3GTMH 4IJLA 1PVOA 2R7ZH 1TWCH 1XNQL 4AS2A 2VL6A 2ZTEA 4B3ML 4A3DH 5EAYA 4X66L 1C9OA 2OCEA 4R4IA 3CD6A 2UUCL 2ZM6Q 2L15A 1JE5A 3LJ1A 2JA8H 5IWAQ 4HJ8A 3F4MA 1CSQA 4BY1G 2B29A 4POFA 4DV1Q 3CCSA 1LM0A 4C3JH 4A93G 5C4XH 5K36G 1AH9A 5IT9c 3GDEA 4A3EG 4OXPA 2VUMG 1BVSA 2XTQA 1CKNB 3GTOH 2UXBL 4A3FH 3TREA 1SFOH 1G51A 2PI2E 5M5XH 2A2CA 3CCJA 5JEAG 1QVFA 2MJFB 4GKJL 1YZ6A 1PYSB 3JSBA 3M85A 2V1CC 4GLAC 4JI5L 3ER0A 4YY3Q 1YITA 3FP9A 3NENA 1WOCA 3U4VA 1J5EQ 3UE1A 4YCVA 3HKZE 4LFCQ 1PYBA 2NN6G 2WAQE 3TQYA 1HZBA 4GKKQ 2NN6I 1WYDA 3KF6A 5IP7H 1XJVA 2OTLA 3CPWA 1TXYA 1YHAA 1Q81C 1E24A 2F4VQ 1Q12A 2HHHL 3M9BA 1N36Q 3ULJA 3IAM1 1K3RA 1VQEA 1VQFA 3PUZA 4DV6L 1PHJA 4AH6A 4LF5L 4DR4L 1RIPA 1I5FA 1R9TH 1Z9FA 3ICEA 4A3KG 1Q8KA 1VQAA 4IOCA 2JA5G 1MIUA 2N49A 4PG3A 4LF4Q 4IPCA 2Q2TA 3F2CA 1UWVA 1VQHA 4DUZQ 1YO7A 4X62Q 5GROA 4DR2L 1UEBA 3KYHC 3M4QA 1VQPA 1I50H 3G71A 1EQQA 3PIPA 4PL3A 1YVCA 2K75A 3CCUA 5FLMG 4O2DA 3ZJYC 1HR0L 4JI1Q 2E2HH 1I6HH 1JJ2A 4Z7HA 1IBKL 2CCZA 1X9NA 1K8GA 2BA0A 2VQEL 4PZ7A 2CAZB 2UUBQ 3FKIG 4BY1H 5LMNL 4DV5L 4NXML 4JV5Q 4R4CA 3CCVA 2YFBA 1NMFA 2L1LB 1B7YB 2XTRA 4OWWB 2R93G 4Y7NH 2KENA 2YTYA 2ZTCA 4A3EH 1IBLQ 1KAWA 2A8VA 2R92G 5IY0A 2VUMH 3T1YQ 3HOZG 4A3IG 2UUAQ 3I4MG 3RLOA 4JI7L 4GLXA 3S14H 4JYAQ 4JI6Q 2IY5B 1GVPA 4DR3Q 1A0IA 1CKOA 2EXDA 3CQZH 4L5TA 4P73A 3DM3A 3VDYA 2NVTH 1B70B 1SJ8A 1CKNA 4GN3B 4YHHQ 4UP9A 5M3FG 3S15H 2MQHA 4R4TA 4OONA 2KBNA 1IYJB 1Q46A 1TWAH 1IXRA 3SDJA 4JC0A 1XNQQ 3D31A 3RZOH 2Q2IA 4KHPQ 3KFUA 2CQOA 3I4NG 3HOUG 3A5ZB 3S24A 1VQ4A 1VQ6A 4R4QA 5IYBG 2QGQA 1KHIA 1S40A 2UU9L 4DUYL 4A3KH 4YCUA 5AJ3Q 4A3GH 3I4OA 5LMUQ 1NTGA 4PL5A 1I94Q 3SGIA 4ME3A 4AQYL 2YTVA 4LFAL 1Y1VG 3WWVA 2B63G 1N33Q 1GD7A 3PIOA 2JB2A 2Q2HA 2OTJA 3PF5A 1PH2A 2AWNA 1HNXQ 5M5YH 1FJGL 4IPGA 1E7ZA 1TWGH 3KDFB 4P75A 5FJ8G 3RNUA 4JI0L 5FLMH 1XPUA 4DV7Q 1VQIA 3T1HL 1G6PA 3GTKH 2MO1A 2YTXA 2IP6A 3W1GA 1K8AC 5C44G 1EUJA 1KRTA 5IYDH 1PH1A 1I3QH 1VQ7A 3S17H 1UE5A 4LW1A 2UXCQ 3I2ZA 2XGTA 2R7DA 1N9WA 3G4SA 3CC7A 2R93H 1EOVA 1X55A 2D62A 2KHJA 1X3GA 2EIFA 4LUZA 3J7ZC 1X54A 2BH8A 2R92H 2YFAA 1MKHA 2NVYH 4YCWA 4JI2Q 4JCVE 3STBD 2HHHQ 3PF4A 1S3OA 3RN5A 4DR4Q 1HZCA 1KRSA 2YYZA 4TQUS 2HQLA 1PV4A 1VQJA 3K7UC 4H02A 1XMQL 3PGZA 2RIOA 4JI3L 1OTCA 1OXTA 2BA1A 3EN2A 5M3FH 2MO0A 4Q9VA 3TS0A 1WCMG 3AQQA 4A3CH 3BU2A 2JAEA 3HOUH 4DV3L 3I4NH 1QVGA 1XNRL 5IYBH 1Y14B 2I5HA 2E2IH 1FVIA 3STBC 1J6QA 4A3BG 1GKHA 3NEMA 4DK6C 1V9PA 2VQFL 1XMOQ 1IBKQ 4G75A 2RHSB 3FHWA 1PH6A 4WJ4A 3F2DA 5LMNQ 1YJNA 4IFDJ 4APVA 2FUG1 3J81i 1Y1VH 2VY3A 4NV2A 2AWOA 4OWTB 4DR7L 2E5LQ 1Y1WG 2KKMA 1QZGA 4X64Q 4LF8L 3H3VI 4NXNQ 1EIFA 2UXDL 1UE1A 1U5KA 4HJ7A 3KJOA 5FJ8H 4LF9L 1S72A 1Q7YC 1HNZL 2MNAA 2Y0SE 1PH8A 4QJFA 2I5LX 1GO3E 4HIKA 3PUYA 4O1PA 1IBMQ 1NY4A 1IZ6A 3BJUA 1VQ5A 3HOWG 5C44H 1M90C 4P74A 1IL2A 4GNXB 1YBYA 4PZ8A 4YWMA 4JI8Q 4DV2Q 2Q2UA 1UE7A 2IHEA 3KDFA 3CCQA 4DV4L 3CC2A 1CKMA 2AHOB 4DV0L 2Y0SG 1H95A 2KHIA 1KD1C 4DR5Q 4OO1G 4B3TQ 1PFSA 4OO1I 1L1OB 5E7NA 2ID0A 4HFVA 3TEHB 1N32Q 3E0EA 1HR0W 5LNK1 4OAUC 2WP8J 3G6EA 3W5OA 4GN5A 1TWHH 5GADC 3OTOL 3UITA 1VS0A 5IP9G 3L2PA 1JB7A 3H15A 1KC8C 2YV5A 4GLVB 5LMNW 2IT1A 4LFBL 1N34Q 1WCMH 2JA7G 3EIVA 5FLXc 2OQ0A 4B3RQ 1SROA 4UP7A 5BR8Q 2A2DA 1C7YA 4JI0Q 4POGA 3AJFA 3S2DH 1HNWQ 3DA4A 4B3SL 1PH7A 2WB1E 3PUVA 4DR1L 2ZJPA 4A93H 4DR6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA A;  3GTG H;  2HT1 A;  3UDX A;  1OXS C;  1Y1W H;  1D8L A;  2JEB I;  4GN4 B;  1A62 A;  2ZM6 L;  4K0K Q;  5ELN A;  5H1S E;  4EX5 A;  2WB1 G;  5IWA L;  4X65 Q;  2KCM A;  3EBE A;  3NEL A;  1W3S A;  1YIJ A;  1HH2 P;  2C35 B;  3JAM c;  4DV1 L;  4JI4 Q;  3E9I A;  2GVB A;  3HOW H;  2FXQ A;  1QVC A;  1K73 C;  1WFQ A;  3H0G G;  3MEF A;  2BH2 A;  4GNX C;  2NVX H;  4JI3 Q;  2CWA A;  4B3M Q;  1YHB A;  4PMW A;  3CCM A;  4IJH A;  4L5S A;  4X66 Q;  4DPG A;  1KIX A;  2UUC Q;  4YY3 L;  5GAE C;  3A74 A;  1EYG A;  1X6O A;  1X3E A;  4DV3 Q;  3UDG A;  4IOA A;  3F8T A;  4LF7 L;  4GS3 A;  3TRZ A;  1J5E L;  4AIM A;  2JA5 H;  3W1B A;  1YHQ A;  4GNX A;  1L1O C;  2PQA B;  4LFC L;  2I0Q A;  2R7Z G;  4GKK L;  3TS2 A;  5J3B A;  3CCE A;  2ZJR A;  3GTP H;  3CP0 A;  1K9M C;  4A76 A;  1C0A A;  3S1M H;  5C0X G;  2UXB Q;  2LSS A;  2A19 A;  4EQ5 A;  4DR7 Q;  1N36 L;  4GKJ Q;  4WJ3 M;  5C0X I;  4QQB X;  1VQD A;  3PUW A;  1L1O A;  4DNI A;  2JA7 H;  5GAH C;  4JI5 Q;  3PO3 G;  3AYH B;  2JA8 G;  4P71 A;  4HIM A;  2JA6 G;  4BXX G;  1U0L A;  4OWX B;  4IPD A;  3RR5 A;  2NZH A;  3K80 C;  1XPR A;  3G48 A;  3FKI H;  3CXC A;  3GTJ H;  3K0X A;  1YJW A;  1EFW A;  2VW9 A;  3AEV A;  4DUZ L;  4X62 L;  1LYL A;  1K0R A;  2GN5 A;  3HOX G;  1VQK A;  1EQR A;  4YWL A;  5JJL A;  1V43 A;  2JA9 A;  3UDI A;  4A75 A;  2NVQ H;  3I55 A;  1ASZ A;  3HOZ H;  1QUQ B;  4HIO A;  4A3I H;  1GM5 A;  1EIY B;  4LF5 Q;  3CCR A;  3I4M H;  3DLL A;  4DV6 Q;  4MNO A;  4AYB G;  3KF8 B;  3GTL H;  2IHF A;  3RLN A;  2UUB L;  1DGS A;  4HID A;  3HOY G;  1SMX A;  4L5Q A;  4JV5 L;  1KQS A;  4QL5 A;  3HFZ B;  3ULL A;  1PH9 A;  3CW2 C;  4DR2 Q;  3S16 H;  1IBL L;  2R6G A;  1NBW A;  1OXX K;  3H0G H;  3L7Z C;  4FDB A;  4JOI C;  3BZK A;  4MTN A;  4BA1 I;  5C4J H;  2DGY A;  3T1Y L;  1FL0 A;  1FGU A;  2N8N A;  2UUA L;  1HR0 Q;  3KOJ A;  5IYC G;  4LFB Q;  4JYA L;  3CF5 A;  4A3J G;  4JI6 L;  1Q1E A;  1MJC A;  4JBW A;  4LF6 L;  1E1T A;  2E2J H;  4DR3 L;  3BZC A;  1HZA A;  4OX9 Q;  2VQE Q;  4NXM Q;  4JOI A;  2IX1 A;  1SLJ A;  4DV5 Q;  2F3I A;  4A3L G;  1VQC A;  3K81 C;  4YHH L;  4DR6 Q;  1OXU A;  2I5M X;  2B63 H;  3S2H H;  3CME A;  4J15 A;  4KHP L;  2WFW A;  3IRB A;  4C2M H;  2EQS A;  4JBM A;  4LNQ A;  1VCI A;  2Z0S A;  1PA6 A;  1KXL A;  4BBR G;  1Q86 C;  4JI7 Q;  2PQA A;  2ES2 A;  2CFM A;  1YEZ A;  2ATW A;  3Q8D A;  3PO3 H;  1L2F A;  2AMC B;  5AJ3 L;  5LMU L;  1MJE A;  2JA6 H;  2K14 A;  3J80 c;  4BY7 G;  4LWC A;  4BXX H;  1I94 L;  1X3F A;  2LXK A;  3JAM i;  4HJA A;  1VQM A;  1NJI C;  1LUZ A;  2JQO A;  1X65 A;  2N3S A;  3S1N H;  3E9H A;  1N33 L;  3HOX H;  3KLW A;  1L0W A;  4RG1 A;  2CKZ B;  1B8A A;  5C3E G;  1HNX L;  4B3R L;  2ASB A;  1EWI A;  4X6A H;  5ELO A;  1VQG A;  2OWO A;  4JG2 A;  1O7I A;  4DV7 L;  3MXN B;  1V1Q A;  1BBU A;  5GQO A;  2XTI A;  5HY6 A;  2QEX A;  3RLF A;  1VQO A;  1PH5 A;  2UU9 Q;  4DUY Q;  1M1K C;  4BA2 I;  2IX0 A;  4LF7 Q;  1HZ9 A;  3KJP A;  1W2B A;  3HOY H;  1G29 1;  2PNH A;  4NB3 A;  4AQY Q;  4A3M G;  2UXC L;  2JJQ A;  4LFA Q;  2H5X A;  2ZJQ A;  3F2B A;  2OQK A;  1QUQ A;  3CC4 A;  1P16 A;  3JC6 6;  1T9H A;  5C0X J;  4IPH A;  1KL9 A;  1FJG Q;  4O0A A;  2R7F A;  4JI2 L;  1D7Q A;  3M4P A;  1BKB A;  5IE8 A;  3U50 C;  1AE2 A;  5IYC H;  3T1H Q;  3HKS A;  4A3B H;  4A3J H;  1CSP A;  1CUK A;  3AFP A;  5M3M G;  4DKA C;  3A5U A;  3HKZ G;  4A3G G;  1E3P A;  1AE3 A;  1SR3 A;  2WAQ G;  2LXJ A;  3K7A H;  4GOP B;  3M3Y H;  1Q82 C;  4A3L H;  1P8L A;  4MZ9 A;  3U4Z A;  2ZTD A;  1HJP A;  2RHQ B;  3I56 A;  3H3V H;  5JJK A;  1NMG A;  1VQL A;  2K50 A;  4TVA B;  4LF4 L;  5DLQ E;  2RF4 A;  5HGQ A;  3OW2 A;  2KCT A;  4R1J A;  2PI2 A;  3M4O H;  4IFD G;  3OYY A;  4QIW E;  1XPO A;  4IFD I;  4BBR H;  3UE0 A;  2RCN A;  4BBS G;  4P72 A;  1XMO L;  2VS1 A;  3LGJ A;  2K4K A;  4ALP A;  4RMF A;  4BY7 H;  1BBW A;  4LUO A;  2E8G A;  3PO2 G;  3GO5 A;  5IYD G;  4QY7 A;  1SE8 A;  3B6Y A;  4KHZ A;  3HOV G;  1XMQ Q;  4QGU A;  3J81 c;  2E5L L;  1OXV A;  4X64 L;  5C3E H;  4NXN L;  1JMC A;  3GTQ H;  4XIG S;  1Q1B A;  3PCO B;  1SN8 A;  1XNR Q;  3NBH B;  1VQN A;  5JJI A;  1IBM L;  3S1R H;  2JK8 A;  4PZ6 A;  4KI0 A;  3M7N A;  2VQF Q;  2DUD A;  2K5V A;  4LF6 Q;  4UPA A;  1SRU A;  3L0O A;  1VQ8 A;  2N78 A;  4HJ5 A;  1LTL A;  4XTC S;  4JI8 L;  3A0J A;  5IP9 H;  4R4O A;  4DV2 L;  4A3M H;  1VQ9 A;  2YU9 H;  2F4V L;  2CWP A;  4A3D G;  5GAG C;  1RL2 A;  2MFI A;  1UE6 A;  3J7A 5;  5M5W H;  3GD7 A;  4A3C G;  4LF8 Q;  2JE6 I;  4DR5 L;  2VNU D;  1X56 A;  2UXD Q;  1E22 A;  4B3T L;  3RZD H;  1HNZ Q;  4JBK A;  4LF9 Q;  1YJ9 A;  4AYB E;  4IO9 A;  1YI2 A;  1ASY A;  2NZO A;  1N32 L;  1SFO H;  5M3M H;  4LUV A;  2F52 A;  2GVA A;  2HIX A;  1E1O A;  2HIV A;  3J80 i;  4DK3 C;  3PUX A;  5C4X G;  1K83 H;  3ULP A;  1N8R C;  4UP8 A;  1PH4 A;  4GOP C;  1NE3 A;  4YWK A;  1PH3 A;  4A3F G;  4Y52 H;  3K8A A;  4UY8 C;  3I7F A;  3KF6 B;  3PV0 A;  4DV4 Q;  1A63 A;  4DV0 Q;  2A1A A;  3AFQ A;  4JI1 L;  3D0F A;  3J81 j;  2VZA A;  1N34 L;  1WJJ A;  1JJC B;  2D0O A;  3CPF A;  3PSI A;  5JEA J;  5BR8 L;  1HNW L;  1Z47 A;  4HJ9 A;  4NPS A;  4BBS H;  4GOP A;  2JEA I;  1VQB A;  3CCL A;  4DAY B;  3S1Q H;  2Z6K C;  2PMZ E;  4C3H H;  1XTD A;  2ALY B;  3PO2 H;  1JT8 A;  1YNX A;  3ERS X;  4JBJ A;  2QA4 A;  4C3I H;  4KLK A;  2K5N A;  5IP7 G;  3OTO Q;  3HOV H;  1QZH A;  4DAM A;  1WI5 A;  1A8V A;  1TWF H;  2B3G A;  4A4I A;  3RN2 A;  4K0K L;  2Z6K A;  2AKW B;  4X65 L;  2D0P A;  1JJG A;  3CAM A;  2K5H A;  3UDF A;  3U58 A;  4L5R C;  4JI4 L;  4B3S Q;  3F1Z A;  2K52 A;  4DR1 Q;  3GTM H;  4IJL A;  1PVO A;  2R7Z H;  1TWC H;  1XNQ L;  2ZTE A;  2VL6 A;  4B3M L;  4A3D H;  5EAY A;  4X66 L;  1C9O A;  2OCE A;  4R4I A;  3CD6 A;  2UUC L;  2ZM6 Q;  2L15 A;  1JE5 A;  2JA8 H;  5IWA Q;  4HJ8 A;  1CSQ A;  4BY1 G;  2B29 A;  4POF A;  4DV1 Q;  3CCS A;  1LM0 A;  4C3J H;  4A93 G;  5C4X H;  5K36 G;  1AH9 A;  5IT9 c;  3GDE A;  4A3E G;  4OXP A;  2VUM G;  1BVS A;  1CKN B;  3GTO H;  2UXB L;  4A3F H;  3TRE A;  1G51 A;  2PI2 E;  5M5X H;  3CCJ A;  1QVF A;  5JEA G;  4GKJ L;  1YZ6 A;  1PYS B;  3M85 A;  2V1C C;  4GLA C;  4JI5 L;  3ER0 A;  4YY3 Q;  1YIT A;  3FP9 A;  3NEN A;  1WOC A;  3U4V A;  1J5E Q;  3UE1 A;  4YCV A;  3HKZ E;  4LFC Q;  1PYB A;  2NN6 G;  2WAQ E;  3TQY A;  1HZB A;  4GKK Q;  2NN6 I;  1WYD A;  3KF6 A;  5IP7 H;  1XJV A;  2OTL A;  3CPW A;  1TXY A;  1YHA A;  1Q81 C;  1E24 A;  2F4V Q;  1Q12 A;  2HHH L;  3M9B A;  1N36 Q;  3ULJ A;  1K3R A;  1VQE A;  1VQF A;  3PUZ A;  4DV6 L;  1PHJ A;  4AH6 A;  4LF5 L;  4DR4 L;  1RIP A;  1I5F A;  1R9T H;  1Z9F A;  3ICE A;  4A3K G;  1Q8K A;  1VQA A;  4IOC A;  2JA5 G;  1MIU A;  2N49 A;  4PG3 A;  4LF4 Q;  4IPC A;  2Q2T A;  3F2C A;  1UWV A;  1VQH A;  4DUZ Q;  4X62 Q;  4DR2 L;  5GRO A;  1UEB A;  3KYH C;  3M4Q A;  1VQP A;  1I50 H;  3G71 A;  1EQQ A;  3PIP A;  1YVC A;  3CCU A;  2K75 A;  5FLM G;  4O2D A;  3ZJY C;  1HR0 L;  4JI1 Q;  2E2H H;  1I6H H;  1JJ2 A;  1IBK L;  2CCZ A;  1X9N A;  1K8G A;  2BA0 A;  2VQE L;  4PZ7 A;  2UUB Q;  4BY1 H;  3FKI G;  4NXM L;  5LMN L;  4DV5 L;  4OX9 L;  4JV5 Q;  4R4C A;  3CCV A;  1NMF A;  1B7Y B;  4OWW B;  2R93 G;  4Y7N H;  2KEN A;  2YTY A;  2ZTC A;  4A3E H;  1IBL Q;  1KAW A;  2A8V A;  2R92 G;  5IY0 A;  2VUM H;  3T1Y Q;  3HOZ G;  4A3I G;  2UUA Q;  3I4M G;  3RLO A;  4JI7 L;  4GLX A;  3S14 H;  4JYA Q;  4JI6 Q;  2IY5 B;  1GVP A;  4DR3 Q;  1A0I A;  1CKO A;  2EXD A;  3CQZ H;  4L5T A;  4P73 A;  3DM3 A;  3VDY A;  2NVT H;  1B70 B;  1CKN A;  4GN3 B;  4YHH Q;  4UP9 A;  5M3F G;  3S15 H;  2MQH A;  4R4T A;  4OON A;  2KBN A;  1IYJ B;  1Q46 A;  1TWA H;  1IXR A;  4JC0 A;  3RZO H;  1XNQ Q;  3D31 A;  4KHP Q;  2Q2I A;  3KFU A;  2CQO A;  3I4N G;  3HOU G;  3A5Z B;  3S24 A;  1VQ4 A;  1VQ6 A;  4R4Q A;  5IYB G;  2QGQ A;  1KHI A;  1S40 A;  2UU9 L;  4DUY L;  4A3K H;  4YCU A;  5AJ3 Q;  4A3G H;  3I4O A;  5LMU Q;  1NTG A;  1I94 Q;  3SGI A;  4ME3 A;  4AQY L;  2YTV A;  4LFA L;  1Y1V G;  3WWV A;  2B63 G;  1N33 Q;  1GD7 A;  3PIO A;  2Q2H A;  2OTJ A;  3PF5 A;  1PH2 A;  2AWN A;  1HNX Q;  5M5Y H;  1FJG L;  4IPG A;  1E7Z A;  1TWG H;  3KDF B;  4P75 A;  5FJ8 G;  3RNU A;  4JI0 L;  5FLM H;  1XPU A;  4DV7 Q;  1VQI A;  3T1H L;  1G6P A;  3GTK H;  2MO1 A;  2YTX A;  3W1G A;  1K8A C;  5C44 G;  1EUJ A;  1KRT A;  5IYD H;  1PH1 A;  1I3Q H;  1VQ7 A;  3S17 H;  1UE5 A;  4LW1 A;  2UXC Q;  3I2Z A;  2XGT A;  2R7D A;  1N9W A;  3G4S A;  3CC7 A;  2R93 H;  1EOV A;  1X55 A;  2D62 A;  2KHJ A;  1X3G A;  2EIF A;  4LUZ A;  3J7Z C;  1X54 A;  2BH8 A;  2R92 H;  1MKH A;  2NVY H;  4YCW A;  4JI2 Q;  3STB D;  4JCV E;  2HHH Q;  3PF4 A;  1S3O A;  3RN5 A;  4DR4 Q;  1HZC A;  1KRS A;  2YYZ A;  4TQU S;  2HQL A;  1PV4 A;  1VQJ A;  3K7U C;  4H02 A;  1XMQ L;  3PGZ A;  4JI3 L;  1OTC A;  1OXT A;  2BA1 A;  3EN2 A;  5M3F H;  2MO0 A;  3TS0 A;  1WCM G;  3AQQ A;  4A3C H;  3BU2 A;  3I4N H;  3HOU H;  4DV3 L;  1QVG A;  1XNR L;  5IYB H;  1Y14 B;  2I5H A;  2E2I H;  1FVI A;  3STB C;  1J6Q A;  4A3B G;  1GKH A;  3NEM A;  4DK6 C;  1V9P A;  2VQF L;  1XMO Q;  1IBK Q;  2RHS B;  3FHW A;  1PH6 A;  4WJ4 A;  3F2D A;  5LMN Q;  1YJN A;  4IFD J;  4APV A;  3J81 i;  1Y1V H;  2VY3 A;  2AWO A;  4OWT B;  4DR7 L;  2E5L Q;  1Y1W G;  1QZG A;  4X64 Q;  4LF8 L;  3H3V I;  4NXN Q;  1EIF A;  2UXD L;  1UE1 A;  1U5K A;  4HJ7 A;  3KJO A;  5FJ8 H;  4LF9 L;  1S72 A;  1Q7Y C;  1HNZ L;  2MNA A;  2Y0S E;  1PH8 A;  4QJF A;  2I5L X;  1GO3 E;  4HIK A;  3PUY A;  1IBM Q;  1NY4 A;  1IZ6 A;  3BJU A;  1VQ5 A;  3HOW G;  5C44 H;  1M90 C;  4P74 A;  1IL2 A;  4GNX B;  1YBY A;  4PZ8 A;  4YWM A;  4JI8 Q;  4DV2 Q;  2Q2U A;  1UE7 A;  2IHE A;  3KDF A;  3CCQ A;  4DV4 L;  3CC2 A;  1CKM A;  2AHO B;  4DV0 L;  2Y0S G;  1H95 A;  2KHI A;  1KD1 C;  4DR5 Q;  4OO1 G;  4B3T Q;  1PFS A;  4OO1 I;  1L1O B;  5E7N A;  2ID0 A;  3TEH B;  1N32 Q;  3E0E A;  1HR0 W;  3G6E A;  2WP8 J;  3W5O A;  4GN5 A;  1TWH H;  5GAD C;  3OTO L;  1VS0 A;  5IP9 G;  3L2P A;  1JB7 A;  3H15 A;  1KC8 C;  2YV5 A;  4GLV B;  5LMN W;  2IT1 A;  4LFB L;  1N34 Q;  1WCM H;  2JA7 G;  3EIV A;  5FLX c;  2OQ0 A;  4B3R Q;  1SRO A;  4UP7 A;  5BR8 Q;  1C7Y A;  4JI0 Q;  4POG A;  3S2D H;  1HNW Q;  4B3S L;  1PH7 A;  2WB1 E;  3PUV A;  4DR1 L;  2ZJP A;  4A93 H;  4DR6 L; 
#chains in the Genus database with same CATH topology
 4NP5 A;  2CHB D;  2JSO A;  1Y1W H;  4J8Q A;  3W3A A;  3SK6 A;  5IGD A;  5IWA L;  4QB4 A;  1Y69 U;  1EYA A;  3EBE A;  1UNS A;  3FRP B;  1HH2 P;  3O13 A;  4I65 A;  3KUP A;  3R8B A;  4DV1 L;  1W6J A;  4K8I A;  1K73 C;  2HCI A;  4K6L A;  2CWA A;  2EY6 A;  3X3N A;  1KIX A;  1F2L A;  3ITP A;  1X6O A;  1F9S A;  3F8T A;  1WTV A;  3TP8 A;  4LFC L;  5LHY 1;  2J4X A;  1EY9 A;  5J3B A;  1IL8 A;  1QNU A;  5CV6 A;  5E4W C;  4A76 A;  5CV7 A;  2UXB Q;  4EQ5 A;  1N36 L;  4AS3 A;  4QQB X;  3PUW A;  4ZUJ A;  4DNI A;  1H9S A;  4JI5 Q;  4HIM A;  2P22 B;  1U0L A;  1RHP A;  4JBK A;  2F0Q A;  4WOR A;  3BVG A;  3FKI H;  3GTJ H;  1EFW A;  2VW9 A;  1DM0 B;  3KLR A;  3MXP A;  4X62 L;  3I4L A;  4DUZ L;  3U9O A;  5IT9 E;  2F0O A;  3GQB A;  3UDI A;  4K5V A;  1IYU A;  1EIY B;  3AB9 A;  4LF5 Q;  3I4M H;  3H09 A;  3GTG B;  3GTL H;  1KNE A;  2PNR C;  1SDF A;  3HOY G;  4ME5 A;  1KQS A;  4QL5 A;  5DNF A;  2XMX A;  1JIC A;  5ELD A;  4DF7 A;  1IBL L;  2R6G A;  4MTN A;  3L7Z C;  1TS2 A;  1I6V C;  5KNC A;  3KOJ A;  2KA7 A;  2CVR A;  4JYA L;  1STE A;  4JI6 L;  4JBW A;  2JB1 A;  1CT1 D;  1MSG A;  2F0T A;  4IAL A;  3FEW X;  2F0P A;  3K81 C;  1SMY C;  4DR6 Q;  2B63 H;  2I5M X;  4OIJ A;  1O7L A;  2B2V C;  4KHP L;  1HCZ A;  4C2M H;  4I1T A;  5EGT A;  4JBM A;  3VR6 A;  3W2D A;  2Z0S A;  1KNA A;  2XNA C;  1Q86 C;  4DXF A;  3R2I A;  4JI7 Q;  2CFM A;  4IFD J;  2M00 A;  1L2F A;  2KEE A;  5AJ3 L;  2XN9 C;  4BXX H;  4LWC A;  3VR5 A;  1I94 L;  3S1N H;  3E9H A;  2JA7 B;  2EY2 A;  3NTH A;  4R8N A;  1RCV D;  1HNX L;  2ASB A;  1EWI A;  5ELO A;  1HUM A;  3TBI B;  1VDZ A;  1V1Q A;  1BBU A;  2R93 B;  2QEX A;  1PH5 A;  1PRT B;  1EWC A;  4MTK A;  1H9M A;  3MZ5 A;  4LF7 Q;  4XDX A;  2G9H D;  5F2D A;  1A15 A;  2FU2 A;  4A3I B;  5LL6 S;  4RCO A;  2H5X A;  1LTA D;  1LT3 D;  1QCB D;  1JWM D;  5C0X J;  4IPH A;  2HUG A;  1FJG Q;  2F1M A;  3KF8 A;  3M4P A;  2SEB D;  5IYC H;  5M3F B;  4A3B H;  3AFP A;  2QDL A;  4DKA C;  3HKZ G;  2E75 C;  4A3G G;  4HN7 A;  3I4N B;  4CGY B;  1Q82 C;  1P8L A;  1I4H A;  4DWL A;  4DA2 A;  1HJP A;  3TZD A;  1YNN D;  1VQL A;  2B8G A;  4TVA B;  2EYF A;  5HGQ A;  2KCT A;  2PI2 A;  3M4O H;  4QIW E;  5I6W A;  4BBR H;  2RCN A;  4ZK9 B;  1XMO L;  3OIQ A;  4OEM B;  3SK4 A;  4BY7 H;  4LUO A;  1TT2 A;  1NAP A;  1M8A A;  1B2T A;  3B6Y A;  2EYP A;  3BG3 A;  1XYI A;  2E5L L;  3PO3 B;  4U6R A;  3QB3 A;  3PCO B;  1SNM A;  2NTS A;  1VQN A;  2VQF Q;  2DUD A;  2RBM A;  3L0O A;  4H7B A;  1EY7 A;  2OF1 A;  1A3U A;  1FD7 D;  1LTL A;  4R4O A;  4A3D G;  2JBW A;  3GD7 A;  3RUZ A;  4DR5 L;  1S5E D;  1LO5 D;  1X56 A;  3RZD H;  1HNZ Q;  2MHV A;  1YI2 A;  4IO9 A;  2NZO A;  5M3M H;  1Q8I A;  4LUV A;  5C4X G;  1QB5 D;  4CJ0 B;  1K83 H;  5C3X A;  1O80 A;  4FXG C;  4H13 C;  1PH4 A;  1E2W A;  3S2D B;  1ZKO A;  4PMB A;  4A3F G;  3K8A A;  1ET6 A;  3KF6 B;  2ENB A;  1TR5 A;  1A63 A;  2A1A A;  4JI1 L;  2B2U C;  3D0F A;  3M3Y B;  1WJJ A;  2D0O A;  3CPF A;  4FYD A;  2EXZ A;  2JEA I;  2A6H C;  1C8C A;  4C3H H;  3ERS X;  1Y8O B;  2D5D A;  2R3Z A;  4C3I H;  4KLK A;  2V6E A;  4N9T A;  4V0B A;  1G91 A;  5E3F A;  4A4I A;  1K28 A;  4K0K L;  4HED A;  2AKW B;  4PMC A;  4X65 L;  4KN4 C;  2ICE C;  4JI4 L;  4B3S Q;  2QF7 A;  4DR1 Q;  1ENC A;  1TWC H;  1RDP D;  3DWA A;  4J1M A;  5EAY A;  4X66 L;  1RTO A;  1R4P B;  5ELE A;  5IWA Q;  4F88 A;  1D5Z C;  1CSQ A;  2B2T A;  4DV1 Q;  1LM0 A;  5K36 G;  1AH9 A;  1B9N A;  1CKN B;  2A2C A;  1QVF A;  1U4R A;  4IUQ A;  4OHJ A;  3ER0 A;  1YIT A;  3FP9 A;  3NEN A;  3U4V A;  2CH4 W;  3DWP A;  3HKZ E;  4LFC Q;  2NN6 G;  5IP7 H;  1KAB A;  1Q12 A;  3M9B A;  1N36 Q;  1VQE A;  1PHJ A;  4DV6 L;  3S16 B;  1I5F A;  5CR3 A;  1Z9F A;  3ICE A;  3A7A B;  2X6G A;  2JA5 G;  2BE5 C;  4IPC A;  3F2C A;  1A3V A;  1UWV A;  4DUZ Q;  3F2U A;  3FPU B;  4C56 C;  4X62 Q;  5GRO A;  4YIJ A;  5JJZ A;  1VQP A;  1CA6 A;  1CFM A;  4KKS A;  3S2H B;  2R7Z B;  2DJF C;  3I91 A;  2F4I A;  4Z7H A;  2CCZ A;  1WTQ A;  2RKS A;  4NXM L;  2CW0 D;  2M9V A;  2RCF A;  1H9J A;  2L1L B;  5KND A;  2XTR A;  4OWW B;  4V19 0;  2MPM A;  2L9H A;  4Y7N H;  1IKM A;  5EPL A;  2JA8 B;  1IBL Q;  5IY0 A;  1TY0 A;  2LFN A;  1QJO A;  3HOZ G;  1AP0 A;  4C3J B;  1JOO A;  3HOX B;  4JYA Q;  4DNT B;  1DON A;  4JI6 Q;  5C6A A;  2IY5 B;  1CKO A;  1PRT C;  1B70 B;  4CJ2 C;  2HGK A;  4AYB B;  4R4T A;  1SND A;  2MGS A;  1TWA H;  2N55 A;  1XNQ Q;  1NCV A;  4KHP Q;  2Q2I A;  3S9W A;  1DJR D;  1E0B A;  1VQ6 A;  3HRZ C;  3GP7 A;  1KHI A;  1ONL A;  2UU9 L;  2E2D C;  1RKN A;  5AJ3 Q;  4A3G H;  3NP8 A;  1I94 Q;  2JP1 A;  2YTV A;  1Y1V G;  3WWV A;  1GD7 A;  4A3J B;  5C4Z A;  4L63 B;  3MXG A;  1GHK A;  1F9P A;  3MVV A;  1EEF D;  3P20 A;  1HNX Q;  4IPG A;  5FJ8 G;  4P75 A;  5BN5 A;  1V1P B;  5FLM H;  1LLR D;  1EQV A;  4ZKB B;  2MO1 A;  5CC4 A;  1K8A C;  1PH1 A;  1I3Q H;  3OSO A;  1VQ7 A;  2O4X A;  4LW1 A;  5KEE A;  3I2Z A;  4UHV A;  5A2Q E;  3P75 A;  2E2H B;  1EY6 A;  1LTS D;  2R93 H;  2V4D A;  1TQO A;  2KHJ A;  3J7Z C;  1X54 A;  5T1G A;  2YFA A;  1FNV A;  1MKH A;  4JCV E;  3RN5 A;  4A3E B;  3GTQ B;  3NSW A;  1VQJ A;  2AQ1 B;  4H02 A;  2RVL A;  1SYD A;  1GUT A;  3EN2 A;  5M3F H;  4N8F A;  1PZK D;  1UEA B;  3CQZ B;  5KRU A;  3I4N H;  3ZYY X;  4RA8 A;  5IYB H;  1XNR L;  4DN4 M;  2WIN B;  3SDZ A;  1ENF A;  3URY A;  1V9P A;  1XMO Q;  2A68 C;  1IBK Q;  4G75 A;  2O2L D;  2X6L A;  4APV A;  2FUG 1;  4F87 A;  3J81 i;  1B3Q A;  2AWO A;  4FF2 A;  2E5L Q;  2KHS A;  3LX0 A;  1Y1W G;  1SFO B;  3TME A;  1IHZ A;  3H3V I;  2FMM A;  2UXD L;  1UE1 A;  1U5K A;  4HJ7 A;  3KJO A;  2EJF C;  4QJF A;  5IOC A;  5HUR A;  4O1P A;  3QWN A;  4FXK C;  3T51 B;  4R9W A;  5COR A;  3H3V C;  4XQN A;  2B2V A;  4QUF A;  1QG7 A;  3CU7 A;  1IL2 A;  4N9P A;  5EJW A;  2B2W A;  2XIW A;  5I9P A;  2Q2U A;  4BBS B;  3KDF A;  2IWH A;  1SEB D;  4DV4 L;  1CKM A;  1H95 A;  3Q22 A;  1KD1 C;  4DR5 Q;  2EOT A;  2EVB A;  1ML0 D;  1SE4 A;  5IP9 G;  3L2P A;  1JB7 A;  2F0L A;  5NUC A;  1S5F D;  4GLV B;  4WJW A;  3IFT A;  5FLX c;  4UP7 A;  3S2D H;  4POG A;  3AJF A;  3DA4 A;  2WB1 E;  4DR6 L;  3TDQ A;  3CMA A;  1ZEQ X;  1NSN S;  1U9R A;  4IUP A;  3EQL C;  1OXS C;  1F77 A;  2DY7 A;  4GN4 B;  1A62 A;  4QF4 A;  2ZM6 L;  4K0K Q;  5ELN A;  4X65 Q;  2Q8T A;  3NEL A;  1YIJ A;  4JI4 Q;  3E9I A;  2GVB A;  2XVS A;  4X3K A;  3EJI A;  4XYO A;  3C3L A;  3K5O A;  2AUJ D;  3MEF A;  4GNX C;  1BBX C;  1EWH A;  3G6J B;  4PMW A;  3KK7 A;  4X66 Q;  4DPG A;  3TP5 A;  4XT1 B;  5GAE C;  1DOL A;  1X3E A;  4LF7 L;  1SYG A;  2MP1 A;  2WV6 D;  3TRZ A;  2JA5 H;  4AIM A;  1YHQ A;  3ERO A;  1L1O C;  2PQA B;  1R9T B;  4GKK L;  3CCE A;  3M4Y A;  3CP0 A;  1K9M C;  1EIG A;  1ZXT A;  5C0X I;  2WII B;  2KED A;  2K5W A;  2K6A A;  2K28 A;  1HPC A;  3AMU A;  1TWH B;  4P71 A;  4BXX G;  1PTO B;  4OWX B;  4LF4 L;  3G48 A;  3CXC A;  4DK1 A;  4CDC C;  3VA9 A;  5DM6 3;  2SNS A;  4O1N A;  3HG9 A;  4KV6 A;  4YZD A;  1CQF A;  3T56 B;  1LAB A;  3HOZ H;  3UI2 A;  4HMJ A;  1STN A;  4A93 B;  4H44 C;  4DV6 Q;  1GUW A;  2IHF A;  3RLN A;  3K5M A;  2VUM B;  2NZ1 D;  1CZW A;  4HID A;  1SMX A;  4G7H C;  4UDU C;  3P23 A;  1JOQ A;  3HFZ B;  1PH9 A;  3S16 H;  2QKI C;  1NNX A;  2B2U A;  1OXX K;  5JOB A;  4JOI C;  4BA1 I;  2EYH A;  3BZK A;  3T1Y L;  4ZUI A;  5IYC G;  2N88 A;  4LFB Q;  3FBV A;  3M7G A;  3Q0A A;  1Q1E A;  1BCP D;  1MJC A;  1E1T A;  3Q24 A;  2E2J H;  5IGB A;  4DR3 L;  1HA5 A;  1HZA A;  5D14 A;  4NXM Q;  4P2C B;  1VQC A;  3S2H H;  3CME A;  4A3K B;  2WFW A;  4KJN A;  1F2Z A;  1QIL A;  2BL7 A;  4BBR G;  1BCP F;  2ES2 A;  2Z8L A;  3D8G A;  2ATW A;  4JPB W;  4BY7 G;  2AMC B;  3S1M B;  5M5Y B;  1TWG B;  5AFW A;  4HJA A;  4B9W A;  2JQO A;  1BR9 A;  4B9X A;  5FKA C;  3ERQ A;  3KLW A;  3QOJ A;  3HOX H;  3GTK B;  2CKZ B;  2B2Y C;  4S3S A;  2RDG A;  2IW3 A;  1I4P A;  2UU9 Q;  2QW7 A;  1M1K C;  4CJ1 B;  1HZ9 A;  4ABN A;  2K33 A;  2PNH A;  1JQO A;  1EYD A;  3VR3 A;  3F2B A;  3CC4 A;  1S5D D;  1T9H A;  3OIP A;  4JI2 L;  1D7Q A;  2R61 A;  3E5S A;  3HKS A;  3MA2 B;  2F6M B;  4A3J H;  5M3M G;  5FO7 B;  1AE3 A;  2WAQ G;  2LXJ A;  3K7A H;  3HOU B;  1RD9 D;  2A6E C;  4MZ9 A;  3G7L A;  3I56 A;  1CM9 A;  2MUY A;  1DYQ A;  4DNR B;  4P72 A;  4C3H G;  3SXH A;  4ZQ3 A;  3GO5 A;  4RHS A;  4QY7 A;  4C3I G;  1PMR A;  1BO0 A;  1CK1 A;  5JPM C;  4KD4 A;  2K5Q A;  5C44 B;  3GTQ H;  5IGF A;  1Q1B A;  4DAP A;  1SN8 A;  1XNR Q;  1DXM A;  4RGO S;  3I90 A;  4LF6 Q;  1KAA A;  4UPA A;  1SRU A;  2IJ0 A;  5CV8 A;  2SOB A;  2N78 A;  4HJ5 A;  4XTC S;  5IP9 H;  4DV2 L;  4RKL A;  2CWP A;  1AEX A;  4CHT B;  1RL2 A;  2I46 A;  4HSP A;  3J7A 5;  4A3C G;  2VNU D;  1CI3 M;  3HOY B;  2UXD Q;  1CQV A;  2A6H D;  2F0S A;  3QR8 A;  1N32 L;  4YZ9 A;  1SFO H;  1XTC D;  2F52 A;  4X3U A;  4YZC A;  1K0S A;  1N8R C;  3LJ2 A;  4EGV A;  1TS5 A;  4GOP C;  1NE3 A;  4DU9 A;  2Z1C A;  2DNC A;  1DOM A;  3QO2 A;  4Y52 H;  3I7F A;  4DV4 Q;  4FF3 A;  4HEA 1;  2VZA A;  4GXT A;  4IZ8 A;  1SNP A;  1TVX A;  4HSV A;  3PSI A;  1HNW L;  5CGK A;  4QUC A;  1Z47 A;  1WTW A;  4HJ9 A;  5JVH 3;  4G76 A;  4BBS H;  1VQB A;  5T1I A;  4DAY B;  5IGC A;  4JBJ A;  5IP7 G;  3BVZ A;  3HOV H;  1LT5 D;  3LWU A;  4DAM A;  2KVM A;  2ZRR A;  2RDH A;  4TRD A;  2Z6K A;  1AZP A;  2D0P A;  2C9O A;  1STG A;  2NVX B;  3CAM A;  2K5H A;  4L5R C;  5E4X A;  3F1Z A;  3GTM H;  4CKC A;  5M9O A;  1EZ8 A;  1PVO A;  1DCZ A;  4JW0 A;  3KLS X;  1XNQ L;  1HFN A;  2VL6 A;  3S1R B;  2K05 A;  2Z4I A;  2ZM6 Q;  2L15 A;  3GTP B;  4HJ8 A;  3F4M A;  2B29 A;  5ELC A;  1PTO C;  2EYJ A;  4MIU A;  1PDQ A;  2F0E A;  1SYB A;  5IT9 c;  3H6M A;  4KKU A;  3DUZ A;  1GUO A;  2F0V A;  1YZ6 A;  3I72 A;  3NTK A;  3M85 A;  2M2L A;  4WRD A;  1QWY A;  1WOC A;  3MTS A;  2AUK A;  2NVQ B;  4YCV A;  3JAM E;  1PYB A;  3TQY A;  2WAQ E;  2K32 A;  4GKK Q;  3KF6 A;  3LNN A;  1XJV A;  1TXY A;  1Q81 C;  4K5X A;  1X32 A;  3IAM 1;  1K3R A;  1GHJ A;  1VQF A;  3OMC A;  4K8J A;  4KK7 A;  4AH6 A;  1ILP A;  1VMP A;  5IT9 L;  1R9T H;  1VQA A;  3H0G B;  3OMG A;  5C4J B;  4PG3 A;  4LF4 Q;  2Q2T A;  3IKJ A;  4DR2 L;  1LTT D;  3M4Q A;  3HEJ A;  2QCP X;  3PIP A;  2K75 A;  1H9K A;  5FLM G;  1HR0 L;  1I6H H;  1JWU D;  1PRT D;  1IBK L;  4EQP A;  2CAZ B;  1B7Y B;  2R93 G;  3U9S A;  2YTY A;  1PZI D;  3BDC A;  2JA6 B;  2VUM H;  3T1Y Q;  1HTL D;  1STB A;  5JEA H;  4A3I G;  2J0T D;  2L4N A;  2FMC A;  3S14 H;  2QEJ C;  4DR3 Q;  2EXD A;  3TN2 A;  5BN3 A;  3VDY A;  4A3F B;  4P73 A;  2PPB C;  1O7Y A;  4M1U B;  1CKN A;  4GN3 B;  5JAV A;  4UP9 A;  5M3F G;  3RZO H;  3NPP A;  4KY5 A;  5D3I B;  4F8M A;  3KFU A;  2CQO A;  3I4N G;  3A5Z B;  1VQ4 A;  5IYB G;  1RF2 D;  4DUY L;  2CQA A;  4A3K H;  1F9R A;  4QMG A;  4PL5 A;  5HGT A;  4AQY L;  4LFA L;  1RTN A;  2Q2H A;  1HRJ A;  3E0J A;  2RSO A;  2A69 D;  1PH2 A;  2AWN A;  2DN8 A;  5M5Y H;  2F0M A;  1TWG H;  3OWF A;  4EQO A;  4IUT A;  2IPK D;  1VQI A;  3MXU A;  3T1H L;  3HP3 A;  1HQR D;  3GTK H;  2F0N A;  4LAA A;  4G7O C;  1EYC A;  3J80 E;  3BS1 A;  1UE5 A;  3DWQ A;  2R7D A;  1FNW A;  1N9W A;  2NBF A;  2RLD A;  1B4O A;  2D62 A;  4LUZ A;  1KDB A;  2BH8 A;  4RWS C;  4KN7 C;  2NTT A;  2HHH Q;  4JI2 Q;  1B3A A;  2A68 D;  2F0W A;  1B50 A;  4TQU S;  5C3E B;  1PV4 A;  2L12 A;  1AZQ A;  3H94 A;  2XWB B;  1TS4 A;  1XMQ L;  2I07 B;  5EKK A;  2MO0 A;  2ZT9 C;  3AQQ A;  4TSS A;  4A3C H;  3HOU H;  2F3W A;  4Z9C B;  4A3M B;  1J6Q A;  4ZCK A;  4DK6 C;  3I3C A;  4E6I A;  1O7Z A;  4N8X 1;  4ULL A;  2QZG A;  5M5W B;  4FVM A;  4HTH A;  4WJ4 A;  1BXT A;  3F2D A;  5LMN Q;  1HUN A;  4F7X A;  3FDT A;  4ZLT F;  1DOK A;  3FPP A;  4ILW A;  4ODG A;  2QGM A;  4KTA A;  3MAQ A;  2PZU A;  1JQY D;  1S72 A;  1PH8 A;  1VF5 C;  1LTR D;  3J7Y W;  4XYQ A;  2K1B A;  4XQJ A;  1U4P A;  5L37 A;  5C44 H;  4P74 A;  3CRL C;  4GNX B;  1YBY A;  4DV2 Q;  3P1H A;  3J81 E;  4XT3 B;  3S1Q B;  1V1P A;  3CC2 A;  2AHO B;  2FEF A;  4I7Z C;  3PO2 B;  1LAC A;  4OO1 I;  1L1O B;  2H1E A;  1N32 Q;  1TWF B;  4OAU C;  2QIL A;  2WP8 J;  2NVY B;  4ZAI A;  3G6E A;  4GN5 A;  3H15 A;  3NQI A;  3VR4 A;  2K7V A;  2IT1 A;  4LFB L;  1DZ1 A;  3EIV A;  5C3W A;  2OQ0 A;  1C7Y A;  1HNW Q;  2Z6B A;  3PUV A;  1S4Z A;  1HQM C;  3GTG H;  2HT1 A;  3NTI A;  4HR7 B;  3Q6S A;  5H1S E;  4FP5 D;  2WB1 G;  4K5W A;  2KCM A;  1HA6 A;  4O42 A;  2C35 B;  1J8I A;  1K8O A;  1G8Z D;  4KD3 A;  1SNO A;  1QVC A;  2BH2 A;  3NE5 B;  2NVX H;  4JI3 Q;  2K19 A;  3CCM A;  4IJH A;  1ICW A;  4EQN A;  1V8Q A;  3A74 A;  1EYG A;  4NW2 A;  4OO1 H;  4DV3 Q;  4NV5 A;  3UDG A;  1PFM A;  4IOA A;  1KLG D;  1LTG D;  1J5E L;  2FHT A;  3VYR A;  2PW5 A;  2BDN A;  1NR2 A;  5EKL A;  2R7Z G;  3TS2 A;  5ISR A;  4LK1 C;  2ZJR A;  3GTP H;  4K14 A;  4ZYS A;  1C0A A;  4JK1 C;  2F0F A;  5C0X G;  2LSS A;  2A19 A;  4O1O A;  3KBG A;  4MHE A;  2JA7 H;  2JYO A;  3AYH B;  2JA8 G;  4IPD A;  3RR5 A;  3K0X A;  3AEV A;  4OAV B;  1M4V A;  1VF7 A;  1A6X A;  1LYL A;  2GN5 A;  3HOX G;  4OL7 A;  1VQK A;  1EQR A;  4YWL A;  2JA9 A;  3NQT A;  4BY1 B;  2NVQ H;  4ZRZ A;  3I55 A;  3TSS A;  1QUQ B;  4A3I H;  5CV4 A;  4AYB G;  5EKI A;  5KIX A;  1DGS A;  4JV5 L;  3L0I A;  3ULL A;  3CW2 C;  4DR2 Q;  3K5L A;  1MD2 D;  5IGE A;  1NBW A;  3H0G H;  5C4J H;  2NVT B;  1FL0 A;  2N8N A;  3V05 A;  5CMD A;  2UUA L;  2B39 A;  1HR0 Q;  3S15 B;  4A3J G;  4LF6 L;  3QG1 A;  4PL4 A;  2IX1 A;  2F3I A;  1EY0 A;  1AFP A;  5DEH A;  4YHH L;  1OXU A;  1I4Q A;  1CZG A;  3IRB A;  2EQS A;  2B8F A;  1PA6 A;  1KXL A;  3PIP 3;  4OGQ C;  2PQA A;  3PO3 H;  5FLX E;  4ID6 A;  4OEL B;  2JA6 H;  4KJO A;  5LMU L;  3T53 B;  1U4L A;  1X3F A;  1QOH A;  3CKI B;  3AU7 A;  1VQM A;  1NJI C;  2Z4H A;  1X65 A;  3DO9 A;  3J7A V;  1L0W A;  4RG1 A;  4X6A H;  3FKI B;  1VQG A;  3HS0 C;  1D5M C;  3GTJ B;  4JG2 A;  5I6Y A;  4DV7 L;  3MXN B;  1NUC A;  5HY6 A;  2IL8 A;  5GQO A;  2JB3 A;  2XTI A;  4DUY Q;  2R92 B;  3MFY A;  3IAS 1;  2PCF B;  1W2B A;  1G29 1;  4B08 A;  1STA A;  4AQY Q;  3I4M B;  2UXC L;  4LFA Q;  4IUV A;  3T4A C;  1XX8 A;  2OQK A;  3GTL B;  4IN3 A;  1EEI D;  3JC6 6;  3ONA B;  5CBE E;  1KL9 A;  1MBY A;  3ND8 A;  5A2Q L;  1AE2 A;  3T1H Q;  2F0H A;  1E3P A;  1Z7T A;  5IIF A;  3LJ0 A;  2LMC B;  4GOP B;  3A8J E;  5I2X A;  3M3Y H;  2E2I B;  4A3L H;  1SYF A;  3H3V H;  3QOL A;  1NMG A;  2MJ8 A;  3D6W A;  2RF4 A;  3OW2 A;  1D1K A;  1LV9 A;  4IFD I;  2B63 B;  4BBS G;  2PZW A;  2C5C A;  3DA3 A;  2VS1 A;  2K4K A;  3LGJ A;  4RMF A;  2E8G A;  1D2B A;  4FNF A;  1G6Z A;  3HOV G;  2EYO A;  1XMQ Q;  4QGU A;  5BN4 A;  1OXV A;  3DHQ A;  5C3E H;  5TSS A;  2KOL A;  1JMC A;  4XIG S;  1F2M A;  3EA6 A;  3NBH B;  5JJI A;  3S1N B;  3HZX A;  4PZ6 A;  4KI0 A;  3M7N A;  2ETD A;  2F0U A;  1VQ9 A;  4A3M H;  2KCN A;  2F66 B;  1E2V A;  3OWE B;  1Y8N B;  2MFI A;  3VYS A;  5M5W H;  4DFA A;  1E22 A;  1UAP A;  4B3T L;  4AYB E;  4ZKC B;  1ASY A;  4FXD A;  2GVA A;  2HIX A;  1WCM B;  1W6K A;  3PUX A;  4UP8 A;  5J1Z A;  1PH3 A;  1R4Q B;  4A3B B;  1T5X D;  1IW7 C;  4UY8 C;  1A3T A;  3AFQ A;  3J81 j;  2O5J C;  4IFD H;  1JJC B;  4DK0 A;  1SMY D;  3S1Q H;  2RDF A;  3PO2 H;  1HHV A;  4IUN A;  5EPJ A;  3H91 A;  2L5T A;  1QZH A;  2OT2 A;  1WI5 A;  2VB3 X;  1TWF H;  1TDP A;  2B3G A;  3HOW B;  1GOZ A;  3RN2 A;  1PFN A;  2EDG A;  1ICF B;  3MEH A;  1FR3 A;  1PTO D;  3UDF A;  3NWT A;  2Y0S B;  2R7Z H;  1K8M A;  4C1N K;  2B2T C;  2E74 C;  4AS2 A;  2JXM B;  4B3M L;  1A2U A;  5E1F A;  5C0X H;  2ZXR A;  2DY8 A;  3CD6 A;  2UUC L;  2EYL A;  1JE5 A;  3LJ1 A;  2JA8 H;  4CDD C;  2P5Z X;  5G3L D;  1MHW C;  3GV3 A;  4POF A;  4A93 G;  4C3J H;  1ZYR C;  2CH4 A;  1STH A;  3RZD B;  4OXP A;  2VUM G;  3TRE A;  1G51 A;  3A7L A;  4GKJ L;  4RHR A;  3CCJ A;  5JEA G;  3RD4 A;  3JSB A;  2FIN B;  1SAP A;  4BS9 A;  2ZW3 A;  1J5E Q;  5D3D A;  3UE1 A;  4TKO B;  1HZB A;  2OTL A;  3CPW A;  1E24 A;  3E3X A;  2F4V Q;  2HHH L;  3K59 A;  1JOK A;  4RCN A;  3ULJ A;  1RIP A;  4GZY C;  4DAY A;  4A3K G;  1Q8K A;  3MWY W;  4IOC A;  2NYZ D;  1MIU A;  2N49 A;  2A74 C;  1VQH A;  4NKL A;  4QIW B;  3L9A X;  1SE3 A;  2K03 A;  1OO9 B;  4JVZ A;  3TP7 A;  3CCU A;  4PL3 A;  1TKW B;  4LJZ C;  5KYL A;  3P7J A;  1BF4 A;  2EPB A;  1EIH A;  2E2H H;  3BZD B;  1X9N A;  4OX9 L;  2VQE L;  4PZ7 A;  4BY1 H;  5LMN L;  4DV5 L;  4JV5 Q;  4R4C A;  2YFB A;  5EQ0 A;  4K2K A;  3FVV A;  2HDM A;  2KEN A;  3WDN A;  2ZTC A;  1C48 A;  4A3E H;  1KAW A;  2A8V A;  3I8Z A;  4KHV A;  1L0X B;  3K6O A;  3NWS A;  2K04 A;  2UUA Q;  3OW7 A;  5COY A;  3RLO A;  5K5P A;  3C2P A;  1QE6 A;  1ROD A;  4GLX A;  1EOT A;  4LMQ D;  1GVP A;  5DM7 3;  1BUV T;  3CQZ H;  4L5T A;  2NVT H;  3J7A F;  4YHH Q;  4FO2 A;  3D3R A;  5J22 A;  3S15 H;  2MQH A;  4OON A;  4HCS A;  2KBN A;  2QSB A;  1IYJ B;  1Q46 A;  1IXR A;  3SDJ A;  1TII D;  4JC0 A;  4XXE A;  3B55 A;  3HOU G;  3DM1 A;  1S40 A;  4KKT A;  3CHB D;  4YCU A;  5LMU Q;  3QJY A;  1NTG A;  3GV6 A;  1MGS A;  3SGI A;  1MI2 A;  4ME3 A;  3K58 A;  1JCK B;  3PIO A;  2OTJ A;  3PF5 A;  3RNU A;  3D4R A;  4DV7 Q;  3TZU A;  2GSC A;  2ZXO A;  4RAU C;  5IOD A;  2VB2 X;  5C44 G;  1EUJ A;  2RAD A;  1B44 D;  3C1F A;  2UXC Q;  2XGT A;  3G4S A;  3A56 A;  1Q90 A;  1SJE D;  1X3G A;  1GUG A;  2R92 H;  5J39 A;  1X3P A;  3PF4 A;  1S3O A;  4DR4 Q;  1YNJ C;  4Y7N B;  1HZC A;  1KRS A;  2YYZ A;  3BDO A;  1SSO A;  3IFD A;  1OTC A;  3D4D A;  3PGZ A;  4JI3 L;  1OXT A;  4Q9V A;  4DGZ A;  1LT6 D;  4DV3 L;  1QVG A;  2E2I H;  2YU9 B;  1FVI A;  3STB C;  2X69 A;  1GKH A;  4UAI A;  1TWA B;  2L55 A;  2NWG A;  1EQT A;  1IYV A;  1FYC A;  2VY3 A;  4OWT B;  1V1O A;  3VR2 A;  1QZG A;  3HKZ B;  3CRK C;  4A3G B;  4LF8 L;  2PYK A;  1PYW D;  1WD1 A;  2B2W C;  4LF9 L;  3KLS A;  1LTB D;  2BE5 D;  2Y0S E;  2MNA A;  5CBA E;  1AW7 A;  4K6D A;  1JR0 D;  3PUY A;  1NY4 A;  3BJU A;  1EU3 A;  1BCP C;  2K01 A;  1JE4 A;  4YWM A;  2PW7 A;  4PZ8 A;  1IKL A;  2O5I C;  3CCQ A;  4RH6 A;  4DV0 L;  2KHI A;  3SR1 A;  1I3Q B;  4OO1 G;  4B3T Q;  1SYC A;  1PFS A;  1H9S B;  2WKD A;  5E7N A;  2ID0 A;  3TEH B;  3E0E A;  1HR0 W;  2LS0 1;  3W5O A;  1TWH H;  3OTO L;  3UIT A;  1VS0 A;  1EY5 A;  1PTO H;  1KC8 C;  3R93 A;  4BWG B;  4DAV A;  1XXG A;  1WCM H;  5JVG 3;  2JA7 G;  1BQQ T;  1SRO A;  2L1B A;  4JI0 Q;  3K57 A;  4A3D B;  1PH7 A;  2ZJP A;  1CTM A;  1SBB B;  4A93 H;  2D2C C;  5D65 A;  2J7Z A;  1RJT A;  2DNE A;  5EBD A;  1BDO A;  3UDX A;  3VYU A;  5I4D A;  4R8I A;  1D8L A;  2JEB I;  4RGM A;  5C4X B;  1PRT F;  4EX5 A;  3GTO B;  5JPN C;  1ET9 A;  1W3S A;  5M5X B;  3JAM c;  4G4K A;  4Q0F A;  1QNK A;  3HOW H;  2FXQ A;  1WFQ A;  3H0G G;  3V2T A;  4B3M Q;  4KY6 A;  1YHB A;  4L5S A;  3RMH A;  1WTR A;  2UUC Q;  4YY3 L;  3I9V 1;  3D6C A;  3DEO A;  4GS3 A;  3SVM A;  1LT4 D;  3W1B A;  3LWE A;  4GNX A;  2I0Q A;  5HGI A;  4PQX A;  1TU2 B;  2EY5 A;  3I70 A;  1SE2 A;  3S1M H;  3HGB A;  2PMZ B;  1FNU A;  4DR7 Q;  1VMC A;  2A73 B;  3JAM L;  4GKJ Q;  5C5M A;  4WJ3 M;  1VQD A;  1L1O A;  3IAY A;  1F2Y A;  5GAH C;  1I50 B;  2RSN A;  5FOB B;  4OIK A;  3PO3 G;  2JA6 G;  3X3M A;  1XPR A;  1GJX A;  3FNB A;  2NZH A;  3K80 C;  1I4G A;  3DMU A;  1YJW A;  3OHX C;  5JJL A;  1K0R A;  1V43 A;  3NHH A;  4A75 A;  1EY4 A;  4C1N I;  1ASZ A;  3ND9 A;  1GM5 A;  3CCR A;  3DLL A;  4MNO A;  2IX3 A;  3KF8 B;  4KY7 A;  3EFX D;  2D9U A;  3C1E A;  2F0G A;  2UUB L;  4L5Q A;  1ESR A;  3A55 A;  2SDF A;  3D4W A;  2XSC A;  4IUR A;  4FDB A;  1SJH D;  2DGY A;  1FGU A;  3WOF A;  3SHL A;  3CF5 A;  2NB0 A;  3BDL A;  1WTO A;  1ENA A;  3IL8 A;  3BZC A;  4OX9 Q;  2VQE Q;  4JOI A;  5FO8 B;  1SLJ A;  4DV5 Q;  4A3L G;  3SE0 A;  3E6Z X;  4J15 A;  2AQ3 B;  2JA5 B;  2H4O A;  1ESF A;  3EVQ A;  4LNQ A;  1VCI A;  1LTI D;  1JC7 A;  3NXW A;  4FF4 A;  4RGN A;  4X3T A;  1YEZ A;  1PZJ D;  3Q8D A;  1D6E C;  1MJE A;  3DXJ C;  2K14 A;  3J80 c;  2LXK A;  3JAM i;  4CKE A;  1EZ6 A;  1LUZ A;  2HCC A;  2N3S A;  3A8I E;  1N33 L;  5C3E G;  1B8A A;  1XWE A;  3A54 A;  4B3R L;  1WTP A;  3S17 B;  2OWO A;  1O7I A;  1O78 A;  1K3B C;  3RLF A;  1VQO A;  1A2T A;  4BA2 I;  2IX0 A;  3KJP A;  4G7Z C;  3HOY H;  2B2Y A;  3K5N A;  3HOZ B;  4NB3 A;  2EY1 A;  4A3M G;  2JJQ A;  2ZJQ A;  3V96 A;  1QUQ A;  1P16 A;  2WB1 B;  3J80 L;  1GXD C;  4O0A A;  2R7F A;  3WOE A;  1BKB A;  5IE8 A;  3U50 C;  1CSP A;  1CUK A;  2DJG C;  3A5U A;  1Y8P B;  1SR3 A;  1EL0 A;  2F03 A;  3U4Z A;  2ZTD A;  2RQX A;  2RHQ B;  4KMU C;  5JJK A;  2E2J B;  1SNQ A;  2K50 A;  3PIO 3;  1GUS A;  5DLQ E;  3Q23 A;  4R1J A;  4IFD G;  3OYY A;  1XPO A;  2KEC A;  1Y1V B;  4G57 A;  3UE0 A;  4CKB A;  5LL6 X;  4ALP A;  5KYI A;  5EBC A;  1BBW A;  3PO2 G;  2NUC A;  5EPK A;  5IYD G;  1SE8 A;  4KHZ A;  3J81 c;  4X64 L;  4NXN L;  1YNN C;  3OOC A;  4HMI A;  4EVO A;  1IBM L;  3S1R H;  2JK8 A;  2EJG C;  2K5V A;  1D1I A;  1VQ8 A;  3BYY B;  4JI8 L;  3A0J A;  2Z9H A;  1IW7 D;  2YU9 H;  2F4V L;  5GAG C;  1UE6 A;  3MXN A;  4I7A A;  4LF8 Q;  2JE6 I;  2F3V A;  3BYT B;  2Q8I B;  4LF9 Q;  1G2S A;  1WVL A;  3J81 L;  1YJ9 A;  3N52 A;  3BVM A;  4DK3 C;  4HIO A;  4C3J G;  1F9Q A;  1E1O A;  2HIV A;  3J80 i;  3ULP A;  1C4Q A;  4L6T B;  4YWK A;  3N6R A;  2BDO A;  5ELF A;  3PV0 A;  4DV0 Q;  1N34 L;  2L11 A;  2VXW A;  3K7A B;  2BOS A;  3QIA A;  1I4X A;  5JEA J;  5BR8 L;  3R2T A;  4L8J A;  4NPS A;  3L3O C;  4GOP A;  3CCL A;  1Y1W B;  4U68 A;  2Z6K C;  2PMZ E;  1DD2 A;  1X3Q A;  1XTD A;  2ALY B;  4Z7G A;  5DAU A;  1YNX A;  2QA4 A;  1JT8 A;  2HQE A;  2K5N A;  3OTO Q;  2G9D A;  3OPO A;  1WTH A;  1ILQ A;  1CHP D;  5ELB A;  2OXP A;  1A8V A;  5C5L A;  2A69 C;  2F0D A;  2WKC A;  2KUM A;  1JJG A;  3NUC A;  1D5X C;  3U58 A;  2BCO A;  3KP9 A;  1UUP A;  2PZT A;  1ZYR D;  4CDF C;  2K52 A;  4IJL A;  2ICI A;  4IUU A;  2ZTE A;  2BL8 A;  4A3D H;  1II3 A;  4RKB A;  1C9O A;  2OCE A;  3NBH A;  4R4I A;  5CV5 A;  3MC0 B;  2ZXP A;  4BY1 G;  4J6H A;  3FVQ A;  3CCS A;  4DXG A;  1B9M A;  3MHB A;  5C4X H;  3K0Y A;  2KCC A;  3GDE A;  1EY8 A;  4A3E G;  4NMZ A;  3GTO H;  1BVS A;  2XTQ A;  2UXB L;  4A3F H;  2PI2 E;  5M5X H;  1KDC A;  3PQI A;  2MJF B;  1KTK A;  1U4M A;  1PYS B;  2G5D A;  1E2Z A;  2V1C C;  4GLA C;  2TSS A;  4JI5 L;  4YY3 Q;  4PV1 C;  1KDA A;  2A6E D;  3KBX A;  2K5D A;  5CYU A;  1CHQ D;  2NN6 I;  1WYD A;  5FK9 C;  1I4R A;  1YHA A;  2XRS D;  2HDL A;  4RFB A;  2OEO A;  1WTX A;  3PUZ A;  4LF5 L;  4DR4 L;  3SK5 A;  3HOV B;  3PMF A;  1NR4 A;  1YO7 A;  2AQ2 B;  1WD0 A;  1UEB A;  3KYH C;  1Q3L A;  1I50 H;  3G71 A;  2HD3 A;  1EQQ A;  2KJX A;  1PLF A;  1YVC A;  4CDE C;  4RGT A;  4O2D A;  3ZJY C;  4K2L A;  3GTM B;  4JI1 Q;  3R3O A;  1JJ2 A;  4C2M B;  1K8G A;  2BA0 A;  2UUB Q;  3FKI G;  1HFG A;  3CCV A;  1NMF A;  5K36 H;  2FFK B;  1Z6H A;  2R92 G;  1HXY D;  3I4M G;  2LY7 A;  4Q5V A;  4JI7 L;  4IQZ A;  1A0I A;  4CBV A;  3DM3 A;  4FF1 A;  1JB3 A;  2SNM A;  1SJ8 A;  2CW0 C;  5KNB A;  2NN6 H;  2QDB A;  5FLX L;  2XRQ D;  4XQQ A;  2LKV A;  5CV9 A;  3D31 A;  4M8A A;  2XWJ B;  1AN8 A;  4H0L C;  1KLU D;  3S24 A;  4R4Q A;  5IGG A;  2QGQ A;  1HTP A;  2EE1 A;  3FMC A;  5C4H A;  3I4O A;  3NK9 A;  4WFN 3;  1B53 A;  2B63 G;  1N33 Q;  2JB2 A;  4MN3 A;  1CA5 A;  1FJG L;  4B3R Q;  1E7Z A;  3KDF B;  4JI0 L;  1YNJ D;  2WAC A;  3I73 A;  2TMP A;  1XPU A;  3A8K E;  4NDX A;  1G6P A;  1TY2 A;  1BCP B;  2KQ3 A;  2YTX A;  2IP6 A;  3W1G A;  1KRT A;  5IYD H;  2F0I A;  2PQE A;  3M4O B;  3S17 H;  4BBR B;  1I6H B;  3CC7 A;  1EOV A;  1X55 A;  4BY7 B;  2EIF A;  3DEP A;  2NVY H;  3STB D;  4YCW A;  2EZV A;  2EYM A;  1T5E A;  5I2Y A;  1BNZ A;  2HQL A;  1BOS A;  2GA4 B;  3K7U C;  2E76 C;  2RIO A;  1SYE A;  2BA1 A;  3S14 B;  1MSH A;  3TS0 A;  4U67 3;  1JOR A;  1WCM G;  2FJ2 A;  3BU2 A;  2JAE A;  1PTO F;  1Y14 B;  2I5H A;  3MFG A;  2L0C A;  4A3B G;  3NEM A;  1JWS D;  1S5B D;  2VQF L;  3RZO B;  3NBI A;  1EFI D;  2RHS B;  3FHW A;  2F0K A;  2JN4 A;  2RA4 A;  1PH6 A;  1YJN A;  1J9O A;  5KGU A;  1Y1V H;  4NV2 A;  4DR7 L;  2KKM A;  5M3M B;  2PO4 A;  5FO9 B;  4X64 Q;  4NXN Q;  3VA7 A;  2WAQ B;  1K83 B;  1EIF A;  5A35 A;  5G3L F;  5FJ8 H;  4PNY A;  1PFB A;  3SEB A;  1Q7Y C;  1HNZ L;  2F0J A;  2I5L X;  1GO3 E;  4HIK A;  1IBM Q;  1S5C D;  2EJM A;  1IZ6 A;  1FGB D;  1TS3 A;  1VQ5 A;  3HOW G;  1GUN A;  1M90 C;  3T16 A;  3VYT A;  5I9O A;  4JI8 Q;  3SK8 A;  1UE7 A;  2IHE A;  4X3S A;  4C3H B;  1EU4 A;  2Y0S G;  4C3I B;  1L0Y B;  4HFV A;  3VA5 A;  5LNK 1;  5GAD C;  1SNC A;  4QCL A;  2YV5 A;  1H9R A;  5LMN W;  3C46 A;  1B1Z A;  4HAE A;  1N34 Q;  3TP6 A;  1STY A;  1TWC B;  5BR8 Q;  2A2D A;  1G2T A;  3T13 A;  2A5H A;  4B3S L;  1SXT A;  4DR1 L;  1PXU A;  4HCE A;  2Q8R E; 
#chains in the Genus database with same CATH homology
 3CMA A;  3GTG H;  2HT1 A;  3UDX A;  1OXS C;  1Y1W H;  1D8L A;  2JEB I;  4GN4 B;  1A62 A;  2ZM6 L;  4K0K Q;  5ELN A;  5H1S E;  4EX5 A;  2WB1 G;  5IWA L;  4X65 Q;  2KCM A;  3EBE A;  3NEL A;  1W3S A;  1YIJ A;  1HH2 P;  2C35 B;  3JAM c;  4DV1 L;  4JI4 Q;  3E9I A;  2GVB A;  3HOW H;  2FXQ A;  1QVC A;  1K73 C;  1WFQ A;  3H0G G;  3MEF A;  2BH2 A;  4GNX C;  2NVX H;  4JI3 Q;  2CWA A;  4B3M Q;  2K19 A;  1YHB A;  4PMW A;  3CCM A;  4IJH A;  4L5S A;  4X66 Q;  4DPG A;  1KIX A;  2UUC Q;  4YY3 L;  3I9V 1;  5GAE C;  3A74 A;  1EYG A;  1X6O A;  1X3E A;  4DV3 Q;  4NV5 A;  3UDG A;  3F8T A;  4LF7 L;  4IOA A;  4GS3 A;  3TRZ A;  1J5E L;  4AIM A;  2JA5 H;  3W1B A;  1YHQ A;  4GNX A;  1L1O C;  2PQA B;  4LFC L;  2I0Q A;  5HGI A;  2R7Z G;  4GKK L;  3TS2 A;  5J3B A;  3CCE A;  2ZJR A;  3GTP H;  3CP0 A;  1K9M C;  4A76 A;  1C0A A;  3S1M H;  5C0X G;  2UXB Q;  2LSS A;  2A19 A;  4EQ5 A;  4DR7 Q;  1N36 L;  4GKJ Q;  4WJ3 M;  4O1O A;  4AS3 A;  5C0X I;  4QQB X;  1VQD A;  3PUW A;  1L1O A;  4DNI A;  2JA7 H;  5GAH C;  4JI5 Q;  3PO3 G;  3AYH B;  2JA8 G;  4P71 A;  4HIM A;  2P22 B;  2JA6 G;  1U0L A;  4BXX G;  4OWX B;  4IPD A;  3RR5 A;  2NZH A;  3K80 C;  1XPR A;  3G48 A;  3FKI H;  3CXC A;  3GTJ H;  3K0X A;  1YJW A;  4OAV B;  2VW9 A;  1EFW A;  3AEV A;  4DUZ L;  4X62 L;  3VA9 A;  1LYL A;  1K0R A;  2GN5 A;  3HOX G;  1VQK A;  1EQR A;  4YWL A;  5JJL A;  1V43 A;  2JA9 A;  3UDI A;  4YZD A;  4A75 A;  2NVQ H;  3I55 A;  1ASZ A;  3HOZ H;  1QUQ B;  4HIO A;  4A3I H;  1GM5 A;  1EIY B;  4LF5 Q;  3CCR A;  3I4M H;  3DLL A;  4DV6 Q;  4MNO A;  4AYB G;  3KF8 B;  3GTL H;  2IHF A;  3RLN A;  2UUB L;  1DGS A;  4HID A;  3HOY G;  1SMX A;  4L5Q A;  4JV5 L;  3P23 A;  1KQS A;  4QL5 A;  3L0I A;  3HFZ B;  3ULL A;  1PH9 A;  3CW2 C;  4DR2 Q;  3S16 H;  2XMX A;  1IBL L;  2R6G A;  1NBW A;  1OXX K;  3H0G H;  3L7Z C;  4FDB A;  4JOI C;  3BZK A;  4MTN A;  4BA1 I;  5C4J H;  2DGY A;  3T1Y L;  1FL0 A;  1FGU A;  2N8N A;  2UUA L;  1HR0 Q;  3KOJ A;  5IYC G;  4LFB Q;  4JYA L;  3FBV A;  3CF5 A;  4A3J G;  4JI6 L;  1Q1E A;  1MJC A;  4JBW A;  4LF6 L;  4OX9 L;  1E1T A;  2JB1 A;  2E2J H;  4DR3 L;  3BZC A;  1HZA A;  4PL4 A;  2VQE Q;  4OX9 Q;  4NXM Q;  4JOI A;  2IX1 A;  1SLJ A;  4DV5 Q;  2F3I A;  4A3L G;  1VQC A;  3K81 C;  4YHH L;  4DR6 Q;  1OXU A;  2I5M X;  2B63 H;  3S2H H;  3CME A;  4J15 A;  4KHP L;  2WFW A;  3IRB A;  4C2M H;  2EQS A;  4I1T A;  4JBM A;  4LNQ A;  1VCI A;  2Z0S A;  1PA6 A;  1KXL A;  4BBR G;  1Q86 C;  4JI7 Q;  2PQA A;  2ES2 A;  2CFM A;  1YEZ A;  2ATW A;  3Q8D A;  3PO3 H;  1L2F A;  2AMC B;  5AJ3 L;  5LMU L;  1MJE A;  2JA6 H;  2K14 A;  3J80 c;  4BY7 G;  4LWC A;  4BXX H;  1I94 L;  1X3F A;  2LXK A;  3JAM i;  4HJA A;  1VQM A;  1NJI C;  1LUZ A;  2JQO A;  1X65 A;  2N3S A;  3S1N H;  3E9H A;  1N33 L;  3DO9 A;  3HOX H;  3KLW A;  1L0W A;  4RG1 A;  2CKZ B;  1B8A A;  5C3E G;  1HNX L;  4B3R L;  2ASB A;  1EWI A;  4X6A H;  5ELO A;  1VQG A;  2OWO A;  4JG2 A;  1O7I A;  4DV7 L;  3MXN B;  1V1Q A;  1BBU A;  5GQO A;  2JB3 A;  2XTI A;  5HY6 A;  2QEX A;  3RLF A;  1VQO A;  1PH5 A;  2UU9 Q;  4DUY Q;  1M1K C;  4BA2 I;  2IX0 A;  4LF7 Q;  3IAS 1;  1HZ9 A;  3KJP A;  1W2B A;  3HOY H;  1G29 1;  2PNH A;  4NB3 A;  4AQY Q;  4A3M G;  2UXC L;  2JJQ A;  4LFA Q;  2H5X A;  2ZJQ A;  3F2B A;  2OQK A;  1QUQ A;  3CC4 A;  1P16 A;  3JC6 6;  1T9H A;  5C0X J;  4IPH A;  1KL9 A;  1FJG Q;  4O0A A;  2R7F A;  4JI2 L;  1D7Q A;  3M4P A;  1BKB A;  5IE8 A;  3U50 C;  1AE2 A;  5IYC H;  3T1H Q;  3HKS A;  4A3B H;  2F6M B;  4A3J H;  1CSP A;  1CUK A;  3AFP A;  5M3M G;  4DKA C;  3A5U A;  3HKZ G;  4A3G G;  1E3P A;  1AE3 A;  1SR3 A;  3LJ0 A;  2WAQ G;  2LXJ A;  3K7A H;  4GOP B;  3M3Y H;  1Q82 C;  4A3L H;  1P8L A;  4MZ9 A;  4DWL A;  3U4Z A;  2ZTD A;  1HJP A;  2RHQ B;  3I56 A;  3H3V H;  5JJK A;  1NMG A;  1VQL A;  2K50 A;  4TVA B;  4LF4 L;  5DLQ E;  2RF4 A;  5HGQ A;  3OW2 A;  2KCT A;  4R1J A;  2PI2 A;  3M4O H;  4IFD G;  3OYY A;  4QIW E;  1XPO A;  4IFD I;  4BBR H;  3UE0 A;  2RCN A;  4BBS G;  4P72 A;  1XMO L;  3DA3 A;  2VS1 A;  2K4K A;  3LGJ A;  4RMF A;  4ALP A;  4BY7 H;  1BBW A;  4LUO A;  2E8G A;  3PO2 G;  3GO5 A;  5IYD G;  4QY7 A;  1SE8 A;  3B6Y A;  4KHZ A;  3HOV G;  1XMQ Q;  4QGU A;  3J81 c;  2E5L L;  1OXV A;  4X64 L;  5C3E H;  4NXN L;  1JMC A;  3GTQ H;  4XIG S;  4U6R A;  1Q1B A;  3PCO B;  1SN8 A;  1XNR Q;  3NBH B;  1VQN A;  5JJI A;  1IBM L;  3S1R H;  2JK8 A;  4PZ6 A;  4KI0 A;  3M7N A;  2VQF Q;  2DUD A;  2K5V A;  4LF6 Q;  4UPA A;  1SRU A;  3L0O A;  1VQ8 A;  2N78 A;  4HJ5 A;  1LTL A;  4XTC S;  4JI8 L;  3A0J A;  5IP9 H;  4R4O A;  4DV2 L;  4A3M H;  1VQ9 A;  2YU9 H;  2F4V L;  2F66 B;  2CWP A;  4A3D G;  5GAG C;  1RL2 A;  2MFI A;  1UE6 A;  3J7A 5;  5M5W H;  3GD7 A;  4A3C G;  4LF8 Q;  2JE6 I;  4DR5 L;  2VNU D;  1X56 A;  2UXD Q;  1E22 A;  4B3T L;  3RZD H;  1HNZ Q;  4JBK A;  4LF9 Q;  1YJ9 A;  4AYB E;  4IO9 A;  1YI2 A;  1ASY A;  2NZO A;  1N32 L;  4YZ9 A;  5M3M H;  4LUV A;  2F52 A;  2GVA A;  2HIV A;  1E1O A;  2HIX A;  3J80 i;  4DK3 C;  3PUX A;  4YZC A;  5C4X G;  1K83 H;  3ULP A;  1N8R C;  3LJ2 A;  4UP8 A;  1PH4 A;  4GOP C;  1NE3 A;  4YWK A;  1PH3 A;  4A3F G;  4Y52 H;  3K8A A;  4UY8 C;  3I7F A;  3KF6 B;  3PV0 A;  4DV4 Q;  1A63 A;  4DV0 Q;  2A1A A;  3AFQ A;  4HEA 1;  3D0F A;  4JI1 L;  2VZA A;  4GXT A;  3J81 j;  1N34 L;  1WJJ A;  1JJC B;  2D0O A;  3CPF A;  3PSI A;  5JEA J;  5BR8 L;  1HNW L;  1Z47 A;  4HJ9 A;  4NPS A;  4G76 A;  4BBS H;  4GOP A;  2JEA I;  1VQB A;  3CCL A;  4DAY B;  3S1Q H;  2Z6K C;  2PMZ E;  4C3H H;  1XTD A;  2ALY B;  3PO2 H;  4Z7G A;  1JT8 A;  1YNX A;  3ERS X;  4JBJ A;  2QA4 A;  4C3I H;  4KLK A;  2K5N A;  5IP7 G;  3OTO Q;  3HOV H;  2V6E A;  1QZH A;  4DAM A;  1WI5 A;  1A8V A;  1TWF H;  2ZRR A;  2B3G A;  4A4I A;  3RN2 A;  4K0K L;  2Z6K A;  2AKW B;  4X65 L;  2D0P A;  1JJG A;  3CAM A;  2K5H A;  3UDF A;  3U58 A;  3KP9 A;  4L5R C;  4JI4 L;  4B3S Q;  3F1Z A;  2K52 A;  4DR1 Q;  3GTM H;  4IJL A;  1PVO A;  2R7Z H;  1TWC H;  1XNQ L;  4AS2 A;  2VL6 A;  2ZTE A;  4B3M L;  4A3D H;  5EAY A;  4X66 L;  1C9O A;  2OCE A;  4R4I A;  3CD6 A;  2UUC L;  2ZM6 Q;  2L15 A;  1JE5 A;  3LJ1 A;  2JA8 H;  5IWA Q;  4HJ8 A;  3F4M A;  1CSQ A;  4BY1 G;  2B29 A;  4POF A;  4DV1 Q;  3CCS A;  1LM0 A;  4C3J H;  4A93 G;  5C4X H;  5K36 G;  1AH9 A;  5IT9 c;  3GDE A;  4A3E G;  4OXP A;  2VUM G;  1BVS A;  2XTQ A;  1CKN B;  3GTO H;  2UXB L;  4A3F H;  3TRE A;  1SFO H;  1G51 A;  2PI2 E;  5M5X H;  2A2C A;  3CCJ A;  5JEA G;  1QVF A;  2MJF B;  4GKJ L;  1YZ6 A;  1PYS B;  3JSB A;  3M85 A;  2V1C C;  4GLA C;  4JI5 L;  3ER0 A;  4YY3 Q;  1YIT A;  3FP9 A;  3NEN A;  1WOC A;  3U4V A;  1J5E Q;  3UE1 A;  4YCV A;  3HKZ E;  4LFC Q;  1PYB A;  2NN6 G;  2WAQ E;  3TQY A;  1HZB A;  4GKK Q;  2NN6 I;  1WYD A;  3KF6 A;  5IP7 H;  1XJV A;  2OTL A;  3CPW A;  1TXY A;  1YHA A;  1Q81 C;  1E24 A;  2F4V Q;  1Q12 A;  2HHH L;  3M9B A;  1N36 Q;  3ULJ A;  3IAM 1;  1K3R A;  1VQE A;  1VQF A;  3PUZ A;  4DV6 L;  1PHJ A;  4AH6 A;  4LF5 L;  4DR4 L;  1RIP A;  1I5F A;  1R9T H;  1Z9F A;  3ICE A;  4A3K G;  1Q8K A;  1VQA A;  4IOC A;  2JA5 G;  1MIU A;  2N49 A;  4PG3 A;  4LF4 Q;  4IPC A;  2Q2T A;  3F2C A;  1UWV A;  1VQH A;  4DUZ Q;  1YO7 A;  4X62 Q;  5GRO A;  4DR2 L;  1UEB A;  3KYH C;  3M4Q A;  1VQP A;  1I50 H;  3G71 A;  1EQQ A;  3PIP A;  4PL3 A;  1YVC A;  2K75 A;  3CCU A;  5FLM G;  4O2D A;  3ZJY C;  1HR0 L;  4JI1 Q;  2E2H H;  1I6H H;  1JJ2 A;  4Z7H A;  1IBK L;  2CCZ A;  1X9N A;  1K8G A;  2BA0 A;  2VQE L;  4PZ7 A;  2CAZ B;  2UUB Q;  3FKI G;  4BY1 H;  5LMN L;  4DV5 L;  4NXM L;  4JV5 Q;  4R4C A;  3CCV A;  2YFB A;  1NMF A;  2L1L B;  1B7Y B;  2XTR A;  4OWW B;  2R93 G;  4Y7N H;  2KEN A;  2YTY A;  2ZTC A;  4A3E H;  1IBL Q;  1KAW A;  2A8V A;  2R92 G;  5IY0 A;  2VUM H;  3T1Y Q;  3HOZ G;  4A3I G;  2UUA Q;  3I4M G;  3RLO A;  4JI7 L;  4GLX A;  3S14 H;  4JYA Q;  4JI6 Q;  2IY5 B;  1GVP A;  4DR3 Q;  1A0I A;  1CKO A;  2EXD A;  3CQZ H;  4L5T A;  4P73 A;  3DM3 A;  3VDY A;  2NVT H;  1B70 B;  1SJ8 A;  1CKN A;  4GN3 B;  4YHH Q;  4UP9 A;  5M3F G;  3S15 H;  2MQH A;  4R4T A;  4OON A;  2KBN A;  1IYJ B;  1Q46 A;  1TWA H;  1IXR A;  3SDJ A;  4JC0 A;  1XNQ Q;  3D31 A;  3RZO H;  2Q2I A;  4KHP Q;  3KFU A;  2CQO A;  3I4N G;  3HOU G;  3A5Z B;  3S24 A;  1VQ4 A;  1VQ6 A;  4R4Q A;  5IYB G;  2QGQ A;  1KHI A;  1S40 A;  2UU9 L;  4DUY L;  4A3K H;  4YCU A;  5AJ3 Q;  4A3G H;  3I4O A;  5LMU Q;  1NTG A;  4PL5 A;  1I94 Q;  3SGI A;  4ME3 A;  4AQY L;  2YTV A;  4LFA L;  1Y1V G;  3WWV A;  2B63 G;  1N33 Q;  1GD7 A;  3PIO A;  2JB2 A;  2Q2H A;  2OTJ A;  3PF5 A;  1PH2 A;  2AWN A;  1HNX Q;  5M5Y H;  1FJG L;  4IPG A;  1E7Z A;  1TWG H;  3KDF B;  4P75 A;  5FJ8 G;  3RNU A;  4JI0 L;  5FLM H;  1XPU A;  4DV7 Q;  1VQI A;  3T1H L;  1G6P A;  3GTK H;  2MO1 A;  2YTX A;  2IP6 A;  3W1G A;  1K8A C;  5C44 G;  1EUJ A;  1KRT A;  5IYD H;  1PH1 A;  1I3Q H;  1VQ7 A;  3S17 H;  1UE5 A;  4LW1 A;  2UXC Q;  3I2Z A;  2XGT A;  2R7D A;  1N9W A;  3G4S A;  3CC7 A;  2R93 H;  1EOV A;  1X55 A;  2D62 A;  2KHJ A;  1X3G A;  2EIF A;  4LUZ A;  3J7Z C;  1X54 A;  2BH8 A;  2R92 H;  2YFA A;  1MKH A;  2NVY H;  4YCW A;  4JI2 Q;  4JCV E;  3STB D;  2HHH Q;  3PF4 A;  1S3O A;  3RN5 A;  4DR4 Q;  1HZC A;  1KRS A;  2YYZ A;  4TQU S;  2HQL A;  1PV4 A;  1VQJ A;  3K7U C;  4H02 A;  1XMQ L;  3PGZ A;  2RIO A;  4JI3 L;  1OTC A;  1OXT A;  2BA1 A;  3EN2 A;  5M3F H;  2MO0 A;  4Q9V A;  3TS0 A;  1WCM G;  3AQQ A;  4A3C H;  3BU2 A;  2JAE A;  3HOU H;  4DV3 L;  3I4N H;  1QVG A;  1XNR L;  5IYB H;  1Y14 B;  2I5H A;  2E2I H;  1FVI A;  3STB C;  1J6Q A;  4A3B G;  1GKH A;  3NEM A;  4DK6 C;  1V9P A;  2VQF L;  1XMO Q;  1IBK Q;  4G75 A;  2RHS B;  3FHW A;  1PH6 A;  4WJ4 A;  3F2D A;  5LMN Q;  1YJN A;  4IFD J;  4APV A;  2FUG 1;  3J81 i;  1Y1V H;  2VY3 A;  4NV2 A;  2AWO A;  4OWT B;  4DR7 L;  2E5L Q;  1Y1W G;  2KKM A;  1QZG A;  4X64 Q;  4LF8 L;  3H3V I;  4NXN Q;  1EIF A;  2UXD L;  1UE1 A;  1U5K A;  4HJ7 A;  3KJO A;  5FJ8 H;  4LF9 L;  1S72 A;  1Q7Y C;  1HNZ L;  2MNA A;  2Y0S E;  1PH8 A;  4QJF A;  2I5L X;  1GO3 E;  4HIK A;  3PUY A;  4O1P A;  1IBM Q;  1NY4 A;  1IZ6 A;  3BJU A;  1VQ5 A;  3HOW G;  5C44 H;  1M90 C;  4P74 A;  1IL2 A;  4GNX B;  1YBY A;  4PZ8 A;  4YWM A;  4JI8 Q;  4DV2 Q;  2Q2U A;  1UE7 A;  2IHE A;  3KDF A;  3CCQ A;  4DV4 L;  3CC2 A;  1CKM A;  2AHO B;  4DV0 L;  2Y0S G;  1H95 A;  2KHI A;  1KD1 C;  4DR5 Q;  4OO1 G;  4B3T Q;  1PFS A;  4OO1 I;  1L1O B;  5E7N A;  2ID0 A;  4HFV A;  3TEH B;  1N32 Q;  3E0E A;  1HR0 W;  5LNK 1;  4OAU C;  2WP8 J;  3G6E A;  3W5O A;  4GN5 A;  1TWH H;  5GAD C;  3OTO L;  3UIT A;  1VS0 A;  5IP9 G;  3L2P A;  1JB7 A;  3H15 A;  1KC8 C;  2YV5 A;  4GLV B;  5LMN W;  2IT1 A;  4LFB L;  1N34 Q;  1WCM H;  2JA7 G;  3EIV A;  5FLX c;  2OQ0 A;  4B3R Q;  1SRO A;  4UP7 A;  5BR8 Q;  2A2D A;  1C7Y A;  4JI0 Q;  4POG A;  3AJF A;  3S2D H;  1HNW Q;  3DA4 A;  4B3S L;  1PH7 A;  2WB1 E;  3PUV A;  4DR1 L;  2ZJP A;  4A93 H;  4DR6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...