3Q8DA

E. coli reco complex with ssb c-terminus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
231
Chain Sequence
EGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA repair protein recO
publication title Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
pubmed doi rcsb
source organism Escherichia coli
total genus 67
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3q8dA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3q8dA01
2K14A 1KD1C 3STBD 1OXTA 1SN8A 2Q2UA 4LF4L 4LF8L 3HOXG 4DR7Q 1J6QA 2WAQE 1CKMA 4JI5Q 4P73A 1K83H 4MNOA 2R93H 4X66Q 4HJ8A 1XMOL 1XMQQ 5IP9H 1PV4A 2CKZB 1GKHA 3JC66 1AE2A 1H95A 2WB1G 5GROA 4A3MH 1CSPA 3D31A 3K7UC 1PHJA 1IL2A 4B3SL 4DV3Q 2D0OA 3ER0A 4JI1Q 3JAMi 3M4QA 4DV2Q 3OW2A 5JJIA 4DV7Q 4XTCS 3U4VA 4YHHQ 4JI7Q 3UDFA 2ES2A 2VL6A 2E2HH 2PI2E 2JA7G 1EWIA 3CD6A 4R1JA 3KFUA 4YY3L 2LSSA 1A0IA 4AQYQ 4A3EH 4OX9L 4UP8A 3JAMc 4B3RQ 4LW1A 5GAEC 1Q1BA 2D0PA 2K52A 4GOPC 4JI0L 4B3MQ 2F4VQ 2N8NA 3CPFA 1PH4A 3PF4A 2I0QA 3EIVA 2JA6H 3GO5A 1RIPA 3W5OA 2EXDA 4IFDJ 4GN5A 2NZHA 1VQMA 2IHFA 3KOJA 4DR4L 4HJAA 1WCMG 1HNXL 4JV5L 4A3JG 1YITA 3KF8B 3U4ZA 4POFA 5M3MG 2NN6I 2Z6KA 2NVQH 1K73C 3CMEA 2MO0A 1OXUA 3CCSA 3KJOA 3F2DA 1G291 4A76A 1JT8A 4OWWB 1MJCA 4GNXB 5IP9G 2EIFA 3M4OH 1XTDA 4LFAQ 2ZM6Q 3CC4A 2ASBA 4TQUS 1VQ4A 1B70B 2VQFQ 4A3DH 4JBKA 2B63H 4NPSA 1PYBA 3AFQA 1XNRL 1VQEA 4LF6Q 4DR3Q 1NJIC 2PQAB 4IPGA 3GTOH 3M4PA 3T1HL 1EOVA 4GKKQ 1N36Q 2Z0SA 3A5UA 3HFZB 2K4KA 2AKWB 2R7ZH 1S72A 3M85A 1HR0L 2YYZA 1UE7A 3UE1A 3G6EA 1IBML 4NXMQ 2BH8A 2JE6I 3CXCA 4C3IH 4DV7L 4YCVA 4YHHL 1JE5A 5H1SE 4JI7L 1KIXA 4JI2Q 1Q46A 2JA6G 3HOUH 1D7QA 4DNIA 1HZCA 3HOWH 1P16A 4AQYL 4DAYB 3I4MH 4OXPA 1VQBA 2Q2TA 3GTMH 3S17H 4B3RL 5IE8A 4KLKA 3LGJA 1S40A 3L0OA 2YTXA 3PO3G 5IYDH 3Q8DA 4B3ML 3TS0A 2F4VL 2R6GA 1EIYB 2UU9L 5LMNL 3F1ZA 2Q2HA 3F8TA 5JEAG 5HY6A 4P71A 1QVFA 1BBWA 1XNQL 4IPHA 1DGSA 1XPRA 2JA8H 2ALYB 2JQOA 4LF4Q 1LYLA 4KI0A 4LF8Q 2UUCQ 2RHQB 4YWLA 3UDIA 1VQIA 2UXDQ 4K0KL 1EYGA 1UEBA 3U50C 3TRZA 5C44H 3PCOB 4DPGA 1XMOQ 4HIOA 3I4NG 3J81j 2B63G 4BBSH 1YHQA 1E1TA 1LTLA 4R4CA 2UUBL 1FL0A 4A3FG 3GD7A 4APVA 1YJNA 4B3TQ 3CW2C 2KBNA 2UXCQ 2OQKA 4GOPB 1KRSA 3HOXH 2KCMA 1V1QA 2Y0SG 2K5NA 4JOIC 2NZOA 4DKAC 2R7ZG 2ZM6L 1HZAA 4PZ7A 1PH2A 4LF6L 4DR3L 4NXNL 4HIDA 4YY3Q 2GN5A 1Q1EA 3PV0A 1PFSA 4GLVB 1L0WA 3CCVA 2CCZA 1PH6A 1PH1A 2JEAI 4IJHA 5J3BA 1WYDA 1VQPA 3DLLA 4QQBX 1UE6A 1Z9FA 4IO9A 3HOWG 2JA7H 1E7ZA 1SRUA 3I4MG 1A63A 2JEBI 1B7YB 1YHAA 1D8LA 1LUZA 1N9WA 1VCIA 1VQGA 4DR5L 4GOPA 2NVTH 3GTGH 3EBEA 1GVPA 1ASYA 4PZ8A 3GTLH 5JEAJ 4JI2L 1HNXQ 2IY5B 1E22A 1YBYA 1MIUA 3NBHB 4IJLA 3TREA 1C9OA 2ATWA 5FLMG 2VQEL 3CMAA 1GM5A 2JK8A 3CAMA 4A3KG 5IYCH 1W3SA 4JBWA 3KJPA 1IBLQ 2OTLA 4LUZA 1YZ6A 1WCMH 4C3JH 1EUJA 1SMXA 1FJGL 4KHPL 4DAMA 4DV1L 5M3MH 2BA1A 2B3GA 3NEMA 1OXVA 3K0XA 1NBWA 1MKHA 4AYBE 4DV5L 1HH2P 2UUCL 1XNRQ 2F52A 2LXKA 3S1QH 2UXDL 1PH9A 4C3HH 2R7FA 3T1HQ 5BR8L 2HQLA 4TVAB 2OCEA 3RLOA 1K0RA 4X62L 4IOAA 2R7DA 2IX1A 2YV5A 2RHSB 3HKZE 4QIWE 3STBC 1QVGA 3RN5A 1K3RA 1TWFH 4PMWA 1EQQA 1HR0Q 4R4QA 3VDYA 4B3TL 2UXCL 1L1OC 1C7YA 1VQJA 1IBMQ 4BXXH 1AH9A 1VQ7A 2R92G 3ZJYC 2PMZE 3PSIA 3HOZH 2WAQG 2XGTA 3AQQA 4EQ5A 4JCVE 1HJPA 2E2IH 2HHHL 5DLQE 1O7IA 1VS0A 4DUYL 4X64Q 3UDXA 1Y14B 3HKZG 3CPWA 4WJ3M 1PH8A 3F2BA 2AWNA 1E24A 3BJUA 4PZ6A 3HKSA 4DR1Q 3CCLA 1R9TH 4O2DA 1YHBA 4JI6Q 2UU9Q 4BY7H 5LMNQ 1E3PA 1HZBA 4IPDA 1XNQQ 3FKIG 5IYCG 1LM0A 1KAWA 4YWMA 4KHZA 4ALPA 4UY8C 1Q7YC 1Q81C 4K0KQ 2VZAA 5IWAL 4JI3L 3PO3H 4L5QA 1PYSB 1T9HA 2AMCB 3MXNB 1PH5A 2UUBQ 3CCQA 3U58A 1S3OA 5IT9c 4IPCA 3I56A 4DR2L 4LFBL 1IBLL 2EQSA 3AYHB 4UP9A 2XTIA 1A8VA 3S1RH 5ELNA 1VQLA 4L5RC 1HNWL 1CKOA 3I4NH 1I5FA 5C0XI 1OXXK 1I94L 1G6PA 3G71A 4JOIA 4A3FH 4NXNQ 3J7A5 4EX5A 3ULJA 4BXXG 4GS3A 3S2HH 4PG3A 3HOZG 4UP7A 3HOVG 1AE3A 2E8GA 2N3SA 4R4OA 3T1YQ 1VQNA 2GVAA 4OWTB 3W1BA 1JJ2A 3GDEA 4LUOA 4DV6Q 1PA6A 1Y1WG 5JJKA 5GAHC 3WWVA 4IFDI 3CCUA 4DR5Q 4GNXA 3NENA 4BY7G 4GN4B 1V43A 4X64L 2CQOA 1G51A 2ZTCA 2VQEQ 2PQAA 4DV0L 1Q82C 1N34Q 5JJLA 2D62A 3PO2H 3OYYA 3PF5A 3TEHB 4X6AH 4DR1L 3S15H 2CWAA 2WFWA 1I50H 3EN2A 4JI6L 2OTJA 3PIPA 1YNXA 1FJGQ 4KHPQ 5FLMH 4DV1Q 4A93G 1WFQA 4J15A 4QGUA 4HJ5A 5M5YH 4A3KH 2H5XA 4LF5L 1X3FA 2KHIA 3CQZH 4DV5Q 4A3LG 3CC2A 1GO3E 1IZ6A 1QZHA 1CKNB 5BR8Q 1KXLA 3TS2A 1VQCA 2NVXH 3KF6B 4X62Q 1WJJA 2L15A 1KQSA 3H3VI 4JI8Q 3E9HA 4GLXA 3RLNA 2MO1A 3MEFA 5C3EG 1NTGA 3E0EA 3E9IA 3L7ZC 1VQ9A 2LXJA 3S1MH 4AH6A 1XJVA 2HHHQ 3TQYA 1P8LA 1Q8KA 4DUYQ 3CCEA 1VQ5A 1BVSA 2CWPA 5M5WH 3A5ZB 2JJQA 4X65Q 1BKBA 1Y1VG 4R4TA 5EAYA 1U5KA 1CKNA 4JI4Q 1CUKA 4DV4Q 2Z6KC 1X65A 3RNUA 3T1YL 1A62A 2R92H 2B29A 4RG1A 1IBKQ 2GVBA 2YTYA 4POGA 1XPUA 3AFPA 4A3BH 3RN2A 4DV6L 4DUZQ 2YU9H 2KHJA 4LF5Q 3PO2G 2E5LQ 5M5XH 4BA2I 4HJ9A 1X54A 4XIGS 1X55A 2BH2A 4WJ4A 5IWAQ 2RCNA 2CFMA 4JG2A 4JI3Q 5LMUL 3AEVA 4GN3B 3IRBA 3GTPH 2ZJRA 1N34L 2K50A 2JA9A 4JYAL 1N33Q 2NN6G 3FKIH 4DR2Q 4LFBQ 2VNUD 1RL2A 3CP0A 3S14H 2IX0A 4HIKA 5M3FG 2AWOA 1XPOA 1X3GA 4OONA 1HNWQ 1OTCA 2A19A 3L2PA 1YIJA 1PH7A 1I94Q 4LWCA 1K8AC 2ZJQA 5C0XG 3PGZA 1X9NA 1K8GA 4A3JH 1UE5A 2I5LX 2F3IA 2I5MX 4P74A 2E2JH 2OQ0A 4JI8L 4QL5A 2Q2IA 1VQHA 2ZTEA 3NELA 1X6OA 2ZTDA 5FLXc 5E7NA 3OTOQ 1FGUA 3RLFA 4BBRH 4AYBG 1GD7A 2MFIA 2PI2A 1CSQA 4A3GH 5FJ8H 1YVCA 1U0LA 4LF7L 2VUMH 3HOVH 4A3BG 1L2FA 3PUWA 2WB1E 2N78A 2HIXA 4X65L 5HGQA 1N32L 1VQDA 2RF4A 4DV0Q 1MJEA 1X3EA 4BY1G 4JBJA 3RR5A 1E1OA 5AJ3L 1Y1WH 1J5EQ 4DV4L 4JI4L 4JBMA 1HNZQ 4H02A 2BA0A 1IBKL 5C4JH 1TWGH 1OXSC 4DUZL 1SE8A 4DK6C 3G4SA 1JB7A 1HR0W 1VQKA 1NMGA 2E5LL 1WOCA 2DGYA 1I3QH 4LNQA 4A3CG 4DR6L 4GKJQ 2UUAQ 1KRTA 5IP7G 1B8AA 2K5VA 3FHWA 2IHEA 1TXYA 3A74A 1YJ9A 2K5HA 1KC8C 4OO1I 5C0XJ 1Z47A 2ZJPA 1HZ9A 1N33L 4A93H 3HOYG 4OWXB 4LFCL 4L5SA 1WI5A 3K81C 2UXBQ 1KHIA 4A3LH 2PNHA 1JJCB 3CC7A 4R4IA 3RZDH 5LMNW 5C4XG 2VY3A 1X56A 1TWAH 3D0FA 3ULPA 2KENA 3J7ZC 3K80C 1QZGA 3H0GH 4BBRG 5C3EH 2N49A 4A3GG 5FJ8G 3PUZA 2VUMG 2DUDA 3W1GA 1VQAA 1EIFA 2MQHA 1TWCH 4AIMA 1V9PA 3KDFB 3PUYA 3PIOA 1M1KC 4GLAC 3GTJH 3UE0A 2ID0A 3OTOL 3CF5A 2HIVA 4HJ7A 1YJWA 1Y1VH 2KCTA 2WP8J 4JC0A 2FXQA 4DK3C 1Q86C 2R93G 1SROA 2JA5H 3I4OA 5LMUQ 3S2DH 3J81i 4RMFA 4A3MG 4JYAQ 1VQFA 2QGQA 3CCJA 3F2CA 4P72A 4JI5L 4A3IH 1J5EL 3M7NA 4DR7L 1VQOA 5K36G 1HNZL 5ELOA 1ASZA 4UPAA 4X66L 1XMQL 4P75A 2HT1A 1L1OB 3KDFA 3M9BA 1QUQB 3J81c 3I55A 5GAGC 1EFWA 1NE3A 1SFOH 4GKJL 3PUVA 4A3EG 2UUAL 4LF9Q 3ULLA 1NY4A 4DV3L 4A75A 4JI1L 4A4IA 4DV2L 1NMFA 1IXRA 2V1CC 5M3FH 1PVOA 1Q12A 2QEXA 3M3YH 2OWOA 3BZCA 3H0GG 5IY0A 4QJFA 3KLWA 3SGIA 2UXBL 1YI2A 1JJGA 3K7AH 3BU2A 1YEZA 5IYBH 1N8RC 1L1OA 3S24A 4YWKA 4LF7Q 1QUQA 4MZ9A 1N32Q 1I6HH 2IT1A 4FDBA 1UE1A 2YTVA 2Y0SE 1JMCA 1FVIA 5AJ3Q 3GTKH 4MTNA 1SLJA 1SR3A 3ICEA 2JA5G 3KF6A 3RZOH 4A3DG 3FP9A 1VQ8A 1K9MC 1M90C 3GTQH 3J80i 4Y7NH 5GQOA 2C35B 4A3IG 2VW9A 4DR6Q 4BY1H 2AHOB 4B3SQ 2K75A 3A0JA 4LFAL 1VQ6A 1BBUA 1TWHH 3ERSX 2VQFL 2A8VA 4YCWA 3J80c 4OO1G 4QY7A 2MNAA 4LFCQ 4YCUA 5GADC 3K8AA 4A3CH 1KL9A 3B6YA 4GKKL 2A1AA 3G48A 4L5TA 1N36L 4OX9Q 5IP7H 3S16H 4NB3A 4O0AA 3HOUG 2VS1A 4JI0Q 1C0AA 4GNXC 2NVYH 4C2MH 4LF9L 3DM3A 3H3VH 3HOYH 1EQRA 4LUVA 4BA1I 4NXML 5IYBG 3H15A 4IOCA 5IYDG 1QVCA 4DR4Q 4ME3A 1PH3A 4JV5Q 1UWVA 5C4XH 1IYJB 3I7FA 3PUXA 2QA4A 2JA8G 3CCRA 3I2ZA 3CCMA 1W2BA 4IFDG 5C44G 2I5HA 4HIMA 3BZKA 3S1NH 4BBSG 3KYHC 3UDGA 4Y52H
chains in the Genus database with same CATH superfamily
2J4XA 1ZYRD 4LF4L 4JI5Q 1G2SA 3PQIA 4MNOA 3S1QB 4HJ8A 2EDGA 1XMOL 1PV4A 1JC7A 1GKHA 2WB1G 3N52A 1BNZA 1CSPA 3D31A 3HGBA 3W3AA 3OPOA 5JJIA 2CHBD 2PO4A 5EJWA 1KLGD 1EYAA 4UP8A 3NE5B 1Q1BA 2K52A 5D65A 4GOPC 4JI0L 5CC4A 3CPFA 3PF4A 1BDOA 1VF5C 3GO5A 2CAZB 2EXDA 3TBIB 1QWYA 4K5XA 4DR4L 2KOLA 1O80A 5JAVA 3K0YA 1HNXL 4YZCA 4A3JG 3NWTA 3KF8B 5M3MG 4POFA 4Z9CB 1CHPD 2NN6I 2Z6KA 1QB5D 1G291 4DK0A 2SDFA 1MJCA 5IP9G 3M4OH 2VQFQ 2B63H 2QILA 2QKIC 2SEBD 3M4PA 1S5CD 1VMPA 1U9RA 4GKKQ 3S2HB 1SNMA 2K4KA 2SOBA 3NSWA 2AKWB 2IPKD 1ICFB 2B8GA 4RGNA 3G6EA 2R7ZB 3UE1A 4DV7L 4JI7L 1RTOA 4JI2Q 1Q46A 4DNIA 1PMRA 4NKLA 3GTMH 4Q9VA 3I4MB 2YTXA 3PO3G 2TMPA 4FNFA 4B3ML 3F1ZA 3F8TA 3L0IA 1QVFA 3QOLA 1R4QB 5IGEA 2K19A 1XPRA 5D3IB 1LYLA 4KI0A 4LF8Q 1HXYD 1SNOA 1J8IA 1II3A 5D14A 4BBSH 2UUBL 1JB3A 4A3FG 5CV8A 4G76A 4B3TQ 2D2CC 2F0QA 2NZ1D 5CYUA 3IAYA 4HCSA 4U6RA 1HZAA 2LS01 1A2TA 3I4LA 4WRDA 3IAS1 4DR3L 1WTVA 4C3IG 2CCZA 2JEAI 4QQBX 1SE2A 1F9SA 1Z9FA 2JA7H 2WAQB 4ID6A 4DR5L 2F0DA 3C2PA 3EBEA 2NVTB 3NBHB 1YBYA 3C1EA 3TREA 4WFN3 3CHBD 5KNCA 3CAMA 4A3KG 5IYCH 1B2TA 1A3TA 1D5XC 1YZ6A 2K05A 2PZUA 1FJGL 1IYVA 5KGUA 1XNRQ 4AYBE 3DHQA 2UUCL 1HH2P 3S1QH 1AZQA 2R7FA 3T1HQ 2HQLA 4TVAB 1R4PB 1K0RA 4IOAA 3E6ZX 4QIWE 1QVGA 3S16H 2L1BA 3VDYA 1TU2B 5IGGA 1C7YA 1GUGA 1IBMQ 4BXXH 1AH9A 4K6LA 2R92G 3ZJYC 2PMZE 3HOZH 5KIXA 1YNND 1HJPA 1O7IA 1VS0A 1ZKOA 2XTRA 1PH8A 3QR8A 3LX0A 5KNBA 2AWNA 2EYLA 4X3SA 2UU9Q 5LMNQ 5IGBA 1LM0A 1KAWA 4YWMA 4KHZA 5J22A 1A15A 4K0KQ 1Q90A 2VZAA 1XXGA 4JI3L 1CHQD 3MXNB 1PRTB 1H9SB 1S3OA 5IT9c 1NSNS 2K5DA 1IBLL 4A93B 1FD7D 3SE0A 1STAA 3AJFA 3S1RB 1I5FA 5C0XI 3V05A 1BQQT 1DOMA 4KN4C 4JOIA 4NXNQ 2B2TC 3J7A5 3BDOA 1I4XA 3S2HH 1HQRD 1SEBD 2BE5C 4KMUC 1S5FD 1SE3A 4PG3A 2E8GA 3T1YQ 1VQNA 3KF8A 4ZKBB 3HZXA 1CM9A 4OWTB 3W1BA 4LUOA 4DV6Q 1TWCB 5JJKA 3WWVA 2K33A 4BY7G 1JORA 1V43A 1LV9A 2ZTCA 4DNTB 3PF5A 1SNPA 4DR1L 2CWAA 2WFWA 1Z6HA 2R61A 1EY9A 2H5XA 4A3LG 4DV5Q 2KHIA 2XWBB 3J81L 5CV5A 1KXLA 1VQCA 3KF6B 1WJJA 2L15A 3E9HA 3FPPA 1IHZA 1X3PA 4H7BA 1NTGA 1VF7A 2K5QA 1SNQA 3TN2A 1TKWB 2LXJA 2PZTA 3FDTA 3NWSA 1WTWA 2A68C 3TQYA 3CCEA 1VQ5A 1BVSA 3DA3A 3J7YW 1BKBA 4Q5VA 3IKJA 3TMEA 1CKNA 1A3VA 2F4IA 2Z6KC 1A62A 4RG1A 4A3BH 3AFPA 1NCVA 3RZOB 4CJ0B 2KHJA 4LF5Q 3SDJA 2E5LQ 2WIIB 2EYOA 1X54A 3DUZA 1X55A 2BH2A 5IWAQ 4BY1B 3A56A 5LMUL 2A6EC 3GTPH 4JYAL 5ELBA 4DR2Q 4BS9A 2VNUD 3CP0A 3S14H 3F2UA 1X3GA 4JVZA 4XYOA 1OTCA 2FEFA 2ICEC 1HA5A 5C0XG 2A69D 1K8GA 2NVYB 4DXGA 2I5LX 2F3IA 2I5MX 1FYCA 2F1MA 3D6CA 2Q2IA 1VQHA 2ZTEA 2ZTDA 3KLSA 5E7NA 4L63B 1FGUA 3A8IE 1O7ZA 2PI2A 4LF7L 5CV7A 5KYLA 4X65L 1N32L 2EXZA 1CZWA 4NW2A 3S1NB 1Q3LA 1E1OA 5AJ3L 4KD3A 1HNZQ 1IBKL 5FKAC 2F0UA 1BCPC 2R93B 4DUZL 4DK6C 3G4SA 3H94A 5C4JB 2DGYA 4GKJQ 1I3QH 4DR6L 2FMCA 2M2LA 4DU9A 5IP7G 1B8AA 2K5VA 3E3XA 2B2VA 5I6WA 2ZW3A 4R8NA 5C0XJ 2XWJB 2BL8A 4A93H 1G8ZD 4OWXB 4ZK9B 4LFCL 1WI5A 2UXBQ 1JJCB 5LMNW 3A8KE 5C4XG 3D0FA 3ULPA 2F0VA 2KENA 3J7ZC 1AFPA 1QZGA 1HFNA 2KKMA 2VUMG 4EQNA 1TWCH 4ZUIA 1V9PA 1H9SA 1PFMA 3UE0A 1DD2A 3UITA 4HJ7A 1G2TA 1YJWA 1ESFA 1GXDC 2WP8J 1LTGD 1IW7D 2ZXRA 1EY6A 2YFBA 5KEEA 3J81i 4OEMB 3E5SA 2IW3A 2PCFB 4A3MG 2DNCA 1J5EL 4A3IH 1L0YB 3Q24A 4CHTB 3M7NA 1V1PB 4X66L 2E75C 3BG3A 1STEA 2HT1A 3KDFA 3NQTA 4G57A 5ELFA 3J81c 3I55A 4G7ZC 2LMCB 2RVLA 3NK9A 1I4GA 4A3EG 2UUAL 1C48A 4WORA 1NY4A 4RH6A 3EVQA 2VB3X 3DXJC 1NMFA 4A4IA 1IXRA 1DOLA 4C3IB 3BZCA 3H0GG 3HOUB 4DWLA 1YI2A 2QEJC 5EBCA 5C3WA 4XQJA 3VR6A 3SK5A 3K7AB 1N8RC 1B44D 4YWKA 4HMIA 4QMGA 4MZ9A 3RMHA 4QCLA 2IT1A 3KBGA 1JWUD 4I1TA 5EPLA 5KRUA 2JA5G 5HURA 3KF6A 3SK8A 3RZOH 3GTKB 1VQ8A 1RF2D 2O4XA 4K5WA 4QF4A 2H4OA 1L0XB 5GQOA 2KVMA 4BY1H 2AHOB 2K75A 1VQ6A 4TSSA 3TP5A 1TWHB 2X69A 4FP5D 4G7HC 4FO2A 1KL9A 3B6YA 4L5TA 3M7GA 5A2QL 4JI0Q 1C0AA 4ZRZA 2NVYH 2LFNA 4IURA 5I2XA 4LF9L 4LUVA 2RIOA 4C2MB 4NXML 5IYBG 3H15A 1EYDA 4IOCA 4DR4Q 1ILPA 3L9AX 1PH3A 1SMYD 5COYA 2Q8RE 4IUUA 1IYJB 3I7FA 2JA8G 2EY1A 3K57A 1EY5A 3CCRA 3A8JE 4IFDG 5C44G 2A5HA 2A73B 3MFGA 2MUYA 4RKLA 2PW7A 3S1NH 2K7VA 1ICWA 4A3JH 3C1FA 2CW0D 2K14A 3STBD 1OXTA 1SN8A 2K03A 2Q2UA 3HOXG 4DR7Q 2WAQE 4RCNA 2R93H 5IP9H 4C3HB 3JC66 2MGSA 4RGOS 2Q8IB 1XX8A 1PHJA 3ITPA 2CVRA 3K7UC 4JI1Q 3M4QA 4IUPA 3OW2A 4DV7Q 3U4VA 4JI7Q 2HDLA 3UDFA 2ES2A 3CD6A 2PI2E 3KFUA 1EWIA 4R1JA 4YY3L 4QUCA 4V190 3K5NA 4OX9L 3A55A 4LW1A 2D0PA 5G3LD 3VR4A 1DONA 3OHXC 4B3MQ 5JJZA 4UDUC 4HFVA 1RIPA 2L5TA 4IFDJ 1VQMA 2AUKA 4PL3A 3KOJA 4HJAA 3D4WA 1WCMG 1KLUD 4C3JG 3EROA 2QW7A 1YO7A 1AW7A 2JB2A 1TS4A 4UHVA 3CMEA 1K73C 1DZ1A 3X3NA 1SE4A 2KECA 4CJ2C 2E2DC 4LFAQ 2ASBA 4TQUS 4JBKA 5E3FA 3AU7A 5ELCA 4DR3Q 2PQAB 4IPGA 3GTOH 3I4NB 1ET6A 5L37A 3URYA 1N36Q 2Z0SA 2KUMA 1HR0L 2YYZA 3K59A 1D6EC 4CKBA 5CV9A 1EFID 1D5MC 2BH8A 1B53A 4C3IH 2KQ3A 4YCVA 1QJOA 4YHHL 2RA4A 1Z7TA 5H1SE 1KIXA 2HCCA 2JA6G 3HOUH 1C8CA 2K28A 5FO7B 4OXPA 4B3RL 4C1NK 2EJMA 5IE8A 3LGJA 1H9KA 3L0OA 3Q8DA 2F4VL 1XNQL 1JQOA 3S15B 5FK9C 4IPHA 3H09A 1CTMA 2UUCQ 2RHQB 4YWLA 3UDIA 1RD9D 3LWEA 1EYGA 3U50C 1I4QA 3TRZA 3PCOB 4DPGA 4C56C 4APVA 2OEOA 3CW2C 2KBNA 1AZPA 2KCMA 1O7LA 4KY5A 5DEHA 2Y0SG 3F4MA 1GUNA 1KNEA 4DKAC 2ZM6L 2L55A 1S5ED 3NBIA 3AMUA 4PZ7A 4LF6L 1PZKD 3OMCA 3MTSA 1EYCA 3OSOA 3PV0A 3QO2A 4OIJA 4RFBA 1PRTC 5J3BA 5JVH3 3U9SA 4J6HA 4IO9A 3HOWG 4H0LC 2XIWA 4MHEA 1NUCA 1D8LA 2L1LB 1LUZA 1YHAA 5F2DA 3RUZA 1WTQA 3EFXD 4DN4M 1ASYA 4PZ8A 5M5XB 3HKZB 5EPKA 1JWSD 1MIUA 2ATWA 2EYPA 2F3VA 1YNJC 1W3SA 1LTSD 2A2DA 2G5DA 4JBWA 3KJPA 1S5DD 1IBLQ 1RKNA 3FKIB 1BOSA 4ULLA 1D1KA 1EUJA 1SJHD 1SMXA 4KHPL 4DV1L 2B3GA 5C6AA 1OXVA 3K0XA 2F52A 2UXDL 5T1GA 4C3HH 1CQFA 5BR8L 2EYMA 2OCEA 2YV5A 1ZYRC 3AEVA 3RN5A 3NPPA 4PMWA 2UXCL 3S16B 1D5ZC 1PXUA 5ELEA 2B8FA 3AQQA 3U9OA 4C1NI 5FLXL 4U673 5DLQE 5K5PA 2E2IH 4DUYL 3HOZB 3HOVB 4JPBW 1MGSA 4WJ3M 4AS3A 5D3DA 2HD3A 4X3KA 3BJUA 1E24A 3F2BA 2VB2X 3VA9A 3N6RA 1Y1WB 3I9V1 5DAUA 3W2DA 2F0TA 4DR1Q 4BY7H 2F0PA 4PV1C 2BL7A 3Q23A 1CA5A 1EIGA 1UAPA 1Q7YC 5IGDA 1ESRA 1PYWD 3MXGA 1RHPA 1BO0A 5JEAH 1CI3M 3NUCA 2M00A 4LFBL 4KN7C 1H9JA 2QZGA 4MN3A 2XVSA 1TT2A 2F0HA 3I4NH 3MFYA 4FXGC 1I94L 3ULJA 4GS3A 3BDLA 1U4RA 3H0GB 1GUSA 2DN8A 2MJFB 3TP6A 1SDFA 2RLDA 1SBBB 3X3MA 2F3WA 4NMZA 5AFWA 2EOTA 2G9DA 3T56B 4CGYB 2WACA 2WINB 3PIP3 4GN4B 2VQEQ 2PQAA 4DV0L 2D62A 2IP6A 3TEHB 3S15H 2F0FA 3VR5A 3OWEB 5FLMH 1Y69U 4NV5A 3NTKA 3CC2A 1GO3E 3LJ1A 1CKNB 3SVMA 2FHTA 3T4AC 3TS2A 1LTAD 3A7AB 4X62Q 3R3OA 4XDXA 4GLXA 3RLNA 2MO1A 4ZYSA 5C3EG 3Q6SA 1SNDA 4UAIA 3E9IA 3L7ZC 1VQ9A 2MJ8A 4YZ9A 3LNNA 3SDZA 1X32A 2CH4A 4KV6A 2HHHQ 2L11A 2PNRC 4BWGB 1P8LA 3TP7A 4R9WA 4X65Q 1Y1VG 3RNUA 1X65A 4POGA 1IBKQ 1XPUA 3LJ2A 4DUZQ 3IL8A 4A3BB 5M5XH 4ZAIA 3GTQB 4HJ9A 2AUJD 4Y7NB 1GUWA 2X6LA 4GN3B 3IRBA 1DYQA 1EZ6A 1N34L 4EGVA 4IUNA 2NN6G 2EPBA 3FKIH 3GTPB 1K28A 1U4PA 2IX0A 4NV2A 5M3FG 3K58A 2AWOA 3S14B 3J80L 4OONA 2OT2A 3ZYYX 1HNWQ 3RD4A 2A19A 1YIJA 2PPBC 2RDHA 3PGZA 2F0SA 1QE6A 3NELA 4KJNA 5FLXc 4AYBG 4I7ZC 4XQQA 4N8FA 3HOVH 2VUMH 5CMDA 3PUWA 1DOKA 2N78A 3NTHA 4KHVA 5HGQA 4G7OC 4CDEC 3KLRA 1VQDA 4AS2A 5FO8B 3RR5A 3WOEA 1Y1WH 1YNNC 4EQOA 1J5EQ 4DV4L 2EYFA 4LMQD 1TS2A 2OF1A 4H02A 3J7AV 4JW0A 2B2YA 2KCNA 4TRDA 2UUAQ 1KRTA 1I3QB 3FHWA 3A74A 2K5HA 1KC8C 1Z47A 4DAPA 2ZJPA 3HOYG 4HEDA 5BN5A 5DM63 2E2HB 3HS0C 4P2CB 1CA6A 1DXMA 1LT3D 4KY7A 4Z7HA 3CC7A 3RZDH 3PIO3 5T1IA 1TWAH 3JAML 3OIQA 3H0GH 4BBRG 2N49A 4A3GG 5FJ8G 3W1GA 1VQAA 1WTHA 3FBVA 4AIMA 3KDFB 2AQ2B 1WD1A 2HGKA 4G75A 1ENAA 3OW7A 3CF5A 4ZQ3A 4CDDC 2NVQB 1Q86C 3AB9A 2JA5H 4RMFA 4RCOA 1VQFA 4PMBA 4A3DB 3CCJA 4P72A 4JI5L 3QG1A 5ELOA 5FO9B 4UPAA 4A3IB 4P75A 5GAGC 3KLSX 1EFWA 5IT9E 2IL8A 4LF9Q 4HCEA 5IGCA 1MSGA 2NB0A 2XRQD 3A54A 1Q12A 2FMMA 2KEEA 2EY6A 1I4RA 3HOWB 3BU2A 1YEZA 5IYBH 1MD2D 1L1OA 1TY0A 1EOTA 3S24A 5G3LF 1I6HH 4FDBA 2WV6D 5I6YA 3GP7A 5EPJA 2WKDA 2NBFA 1SR3A 5LL6X 2K5WA 2AQ3B 2A6HD 3GTQH 4HAEA 3SR1A 4KKSA 2C5CA 3J80i 3WDNA 2Q8TA 4Y7NH 1K8OA 2G9HD 2VW9A 3QB3A 3GQBA 4V0BA 1BBUA 1IKMA 2VQFL 3EQLC 4YCWA 2EYJA 3J80c 5GADC 4A3CH 1BF4A 1XWEA 4GKKL 4OX9Q 2WB1B 1PTOD 4XT1B 2O5JC 1S5BD 1WTPA 1HCZA 2JN4A 3DM3A 3H3VH 5EQ0A 1TVXA 1F77A 2PYKA 2XRSD 3CKIB 3M4YA 1EY0A 3DWAA 2ENBA 2V4DA 2A69C 1UWVA 3CCMA 2PW5A 4F7XA 3BYTB 4Y52H 5KNDA 4FF3A 4BBSG 1KABA 3FVQA 3V2TA 2IWHA 1ZXTA 1FNWA 1KD1C 4A3JB 4LF8L 1V8QA 1TIID 3G7LA 1J6QA 5M3MB 1CKMA 3OOCA 3FEWX 2BDNA 1XMQQ 1H95A 3K5MA 1J9OA 5C4ZA 4B3SL 1EZ8A 4DV3Q 2D0OA 3ER0A 3JAMi 4DV2Q 4LK1C 4YHHQ 4K8IA 2E2HH 2JA7G 5CBEE 2LSSA 1A0IA 2I46A 3JAMc 1BR9A 4B3RQ 1CQVA 3HG9A 5IGFA 1Y8PB 4DFAA 2F4VQ 1SXTA 2FUG1 2JA6H 2NWGA 3EIVA 5BN3A 2F0WA 1UEAB 2PQEA 2IHFA 1DM0B 2RKSA 4JV5L 1MBYA 1YITA 2F0OA 3CRKC 2NVQH 3PO3B 1OXUA 1JT8A 4Z7GA 1AEXA 4GNXB 2N88A 2EIFA 1XTDA 2ZM6Q 3CC4A 4A3DH 1PYBA 1XNRL 1VQEA 4LF6Q 1IW7C 5EGTA 3T1HL 1EOVA 4A3FB 2KHSA 3GTOB 3A5UA 1S72A 3M85A 2Z6BA 3S9WA 1B4OA 1UE7A 4OO1H 4CJ1B 1IBML 1EL0A 4ME5A 1WTOA 4HEA1 3BVMA 1D7QA 1E0BA 3HOWH 3I91A 4RKBA 4AQYL 2FU2A 1LT6D 1VQBA 3LJ0A 4KK7A 5HGTA 5IYDH 5J1ZA 1EIYB 2EE1A 2UU9L 5LMNL 4P71A 1I50B 1DGSA 2ALYB 2JQOA 4LF4Q 1K8MA 3I8ZA 2UXDQ 4K0KL 1UEBA 4A3KB 5LNK1 1XMOQ 4HIOA 4M8AA 1YHQA 1E1TA 1LTLA 1FL0A 2NVXB 3GD7A 1YJNA 3A7LA 4DAYA 2UXCQ 5CV6A 1KRSA 1V1QA 2GSCA 2JB1A 1PZJD 1I4HA 2NZOA 2RADA 1KNAA 4JOIC 3J81E 2R7ZG 1GJXA 3TZDA 1TY2A 2Z8LA 4NXNL 1LT4D 4LJZC 1PFSA 3CCVA 4IZ8A 1PH1A 4IJHA 1VQPA 2EY5A 3DLLA 3NXWA 3P23A 1QOHA 1X3QA 2DY8A 2FFKB 1RTNA 2R92B 1E7ZA 1SRUA 3I4MG 1A63A 2JEBI 1B7YB 1N9WA 4GOPA 2F0NA 2YU9B 5C5MA 2O5IC 3GTLH 1HNXQ 1QILA 1TS3A 4IJLA 3CMAA 1GM5A 2JK8A 1Q8IA 2P22B 4DAVA 3HRZC 3B55A 3SHLA 2F0IA 2DJGC 1SMYC 1Y8NB 4DAMA 2HQEA 5M3MH 3NEMA 5LHY1 1U4LA 4DV5L 2M9VA 4S3SA 1PH9A 2RBMA 3RLOA 4F8MA 2IX1A 2CW0C 2RHSB 3STBC 1TWFH 1HUNA 1EQQA 1L1OC 5KYIA 1VQJA 1W6KA 3PSIA 2WAQG 2XGTA 4DXFA 4E6IA 3R93A 4IN3A 2E2IB 1SAPA 2F0EA 1Y14B 4K2KA 4KD4A 1H9RA 2EJFC 3HKSA 3CCLA 4O2DA 1YHBA 4NDXA 1HZBA 1JOOA 4IPDA 4RGMA 4PL4A 3DMUA 4BY7B 2BOSA 2HUGA 1HTPA 2B2UA 1Q81C 4GXTA 1UNSA 5IWAL 4J8QA 3PO3H 1PYSB 3ERQA 2UUBQ 1PH5A 3FNBA 3CCQA 3U58A 4DR2L 1M4VA 4IPCA 4UP9A 1A8VA 2BCOA 4L5RC 4OELB 2NYZD 3OMGA 2DNEA 1PTOB 3E0JA 1G6PA 5I2YA 3G71A 4A3FH 3DWQA 3I90A 4O42A 4HTHA 4UP7A 1MSHA 1AE3A 2N3SA 3LWUA 2MPMA 1G91A 1JJ2A 4OL7A 3GDEA 5GAHC 4DR5Q 2ZXOA 4GNXA 2RDFA 3NENA 1H9MA 1JQYD 2QSBA 3H3VC 4X64L 2CQOA 1G51A 2E76C 5ELDA 4PMCA 1JE4A 3VYUA 1N34Q 3S2DB 2X6GA 1QG7A 3SK6A 1XTCD 1I50H 4X3TA 4JI6L 2OTJA 1SJED 3MC0B 5LL6S 1QNUA 1YNXA 1FJGQ 4RA8A 4A93G 2B2VC 4QGUA 5M5YH 4A3KH 1X3FA 2NN6H 1QZHA 4G4KA 1B9NA 2NVXH 3IFDA 3IAM1 1SJ8A 4YIJA 3E0EA 4XT3B 3DM1A 3VYTA 1EY7A 1XJVA 4EVOA 1LO5D 2CWPA 1STGA 3A5ZB 3NP8A 5I9OA 4R4TA 2JSOA 2EJGC 5EAYA 1U5KA 5JPMC 2MP1A 1CUKA 4DV4Q 4CKEA 2R92H 2B29A 3BYYB 2GVBA 2YTYA 1PFBA 2YU9H 3H91A 2LY7A 3PO2G 3DEOA 4R8IA 4RGTA 4XIGS 2RCNA 2CFMA 4JG2A 4JI3Q 1GHJA 4OGQC 1IYUA 2JA9A 1RL2A 1XPOA 1HTLD 2RCFA 3NTIA 3QOJA 4DF7A 3L2PA 4IUTA 1UE5A 3MA2B 2B2TA 1V1OA 4JI8L 4QL5A 4KKTA 1E2VA 4L8JA 3P20A 5A2QE 1X6OA 4PL5A 5C4XB 4BBRH 2I07B 4A3GH 5FJ8H 1YVCA 3R2IA 1L2FA 3V96A 2WB1E 4TKOB 3I3CA 2VUMB 1FNVA 3J7AF 2RF4A 3WOFA 5ISRA 2B39A 4RHSA 4BY1G 3JSBA 4JI4L 4JBMA 3VYSA 3VR3A 1TWGH 2F6MB 1OXSC 1K83B 1JB7A 1NMGA 1WOCA 1S4ZA 5EKLA 4IUVA 1LLRD 4A3MB 2IHEA 2V6EA 2XMXA 1N33L 2JYOA 4L5SA 3K81C 1HFGA 1KHIA 4A3LH 4FXDA 2PNHA 2IX3A 3VR2A 4M1UB 4A3EB 1PTOH 1F9PA 1PTOF 2QGMA 3RZDB 3K80C 1TWAB 2HDMA 3R8BA 3PUZA 4RWSC 2DUDA 2K1BA 1GHKA 4DK1A 1EIFA 2MQHA 2CH4W 4GLAC 3OTOL 2F0MA 2KCTA 4ABNA 2XN9C 2R93G 1C4QA 2FXQA 1LTID 1SROA 1LACA 4N8X1 3I4OA 5LMUQ 4OAUC 3SXHA 2JXMB 5IT9L 3S2DH 2JA5B 3MEHA 4JYAQ 2QGQA 3F2CA 4DR7L 5K36G 2F0LA 1ASZA 2DJFC 1L1OB 3M9BA 1SSOA 1GUTA 2K6AA 3PUVA 3ULLA 3FPUB 4JI1L 2V1CC 3KUPA 3CU7A 1PVOA 2QEXA 2OWOA 1JOQA 5IY0A 4QJFA 3KLWA 2D5DA 4OAVB 5C0XH 3BDCA 2A74C 1JJGA 1BCPF 1EY8A 2K04A 3S17B 1K3BC 4LF7Q 1QUQA 1B50A 1N32Q 2B2UC 2J7ZA 1D1IA 5CORA 1JMCA 1I6HB 1FVIA 2HCIA 3I70A 4PQXA 4MTNA 5AJ3Q 2JA8B 3ICEA 3FP9A 1F2ZA 2ICIA 1PZID 1K9MC 1HUMA 5C44B 1F2LA 2C35B 4DR6Q 3T53B 4B3SQ 3A0JA 3T13A 3HOXB 4LFAL 3ERSX 4FVMA 3P7JA 4CKCA 2MNAA 5E4WC 4LFCQ 5C3XA 2QCPX 2A1AA 1GUOA 1N36L 5IP7H 1A6XA 3HOUG 4GNXC 2JP1A 1GOZA 3ONAB 1EQRA 2WKCA 4DA2A 2JBWA 2OXPA 1TR5A 4QB4A 3GTGB 1VMCA 4JV5Q 1JWMD 5C4XH 3EA6A 3DWPA 1I6VC 3I2ZA 1W2BA 3D4DA 2I5HA 1IKLA 1NNXA 1CFMA 1EWCA 3KYHC 5CBAE 5I4DA 1WCMB 4C3JB 1U4MA 4QUFA 4K2LA 1EQTA 4P73A 1K83H 4FF4A 4HN7A 4X66Q 2CKZB 2YFAA 3MVVA 1AE2A 5IIFA 5EKIA 5GROA 4A3MH 1STBA 3P1HA 1IL2A 4JK1C 4J1MA 1TQOA 4XTCS 2VL6A 1ET9A 1B9MA 4AQYQ 4A3EH 4MIUA 4XQNA 3BVGA 5GAEC 3SK4A 2QDLA 1JOKA 2N8NA 1BUVT 5FLXE 1PH4A 2I0QA 1R9TB 3W5OA 4IALA 2JA6B 4GN5A 2NZHA 3Q0AA 2R3ZA 5M9OA 1SNCA 1SYBA 2C9OA 3U4ZA 1D2BA 2MO0A 1T5EA 3CCSA 2N55A 3KJOA 1RDPD 4C3HG 1HPCA 3F2DA 4A76A 4OWWB 1RJTA 2F03A 2BE5D 1VQ4A 1B70B 1TDPA 2JB3A 4NPSA 3QJYA 3AFQA 3IFTA 2B2WA 1NJIC 2NUCA 3VA5A 2EZVA 4B9XA 2F0KA 4YZDA 1B1ZA 1K0SA 3TDQA 3HFZB 1Y8OB 2R7ZH 2Y0SB 4O1PA 2O2LD 1HRJA 3EJIA 2JE6I 3CXCA 4NXMQ 1JE5A 1W6JA 2L12A 1AN8A 1HZCA 1P16A 1SYEA 4DAYB 3I4MH 2Q2TA 3S17H 1LABA 4KLKA 1OO9B 1LTBD 2JAEA 1S40A 1QCBD 3PO2B 3D6WA 3TS0A 2R6GA 5JEAG 2Q2HA 4H44C 5EBDA 5HY6A 1BBWA 3C46A 2JA8H 3BVZA 3Q22A 1G6ZA 1F2YA 4MTKA 5TSSA 1JR0D 1VQIA 3QWNA 4IFDH 3CQZB 5C44H 3I4NG 3J81j 2B63G 4R4CA 2A68D 4O1NA 2OQKA 4GOPB 3HOXH 1CZGA 2K5NA 2A6HC 3NHHA 2KEDA 4XYQA 3S1MB 4FXKC 1PH2A 4HIDA 2EY2A 4YY3Q 2GN5A 1Q1EA 1NAPA 4GLVB 1L0WA 3SEBA 3BZDB 3TZUA 3VA7A 5M5WB 2SNMA 1PH6A 1WYDA 1UE6A 4PNYA 1SYDA 2FINB 1A3UA 2K01A 2KA7A 4IUQA 5C4HA 2RSOA 1B3QA 2A6ED 2Z4IA 1VCIA 1VQGA 4B9WA 1PTOC 2NVTH 3GTGH 1GVPA 2L0CA 5JEAJ 4JI2L 2IY5B 2DY7A 1E22A 3GTLB 1PFNA 1LTTD 1C9OA 5FLMG 2VQEL 4IQZA 4HSVA 2NTTA 2LKVA 3O13A 2OTLA 4LUZA 1WCMH 2RQXA 4C3JH 3PMFA 4L6TB 2BA1A 4ZKCB 3OIPA 1NBWA 1MKHA 2NTSA 2LXKA 2Z9HA 1B3AA 3NBHA 4X62L 2R7DA 4LAAA 3HKZE 3J80E 1K3RA 4KTAA 4B3TL 1HR0Q 4H13C 4R4QA 2E2JB 1TWFB 3K5LA 1VQ7A 3MZ5A 4KY6A 1KAAA 4EQ5A 4CBVA 2Z1CA 4JCVE 2HHHL 3R2TA 4F88A 4I7AA 3G6JB 4X64Q 3UDXA 1BCPD 3HKZG 3CPWA 4KKUA 5HGIA 2TSSA 1I4PA 3K5OA 4PZ6A 3MHBA 3FMCA 1R9TH 1SYCA 4JI6Q 1XNQQ 1E3PA 3FKIG 5IYCG 1JCKB 2H1EA 3C3LA 4ALPA 4UY8C 1EEID 4CDFC 4L5QA 2BDOA 2KJXA 1T9HA 4Q0FA 2AMCB 1WTRA 1LTRD 1PRTF 3I56A 4XXEA 1STNA 2EQSA 3AYHB 2XTIA 3S1RH 5ELNA 1VQLA 1ML0D 2QDBA 1HNWL 1CKOA 3BS1A 1OXXK 1SYFA 2EVBA 4EX5A 4BXXG 1ENFA 1NR2A 3HOZG 2D9UA 1ZEQX 5C3EB 3HOVG 4R4OA 4DGZA 2GVAA 3MXNA 2A2CA 1IL8A 1FGBD 1PA6A 1KDAA 1Y1WG 3JAME 2K32A 4IFDI 3CCUA 3GTJB 1PLFA 1Y1VB 5I9PA 2Z4HA 2P5ZX 3GV6A 1Q82C 5JJLA 3PO2H 3OYYA 1M8AA 2B2YC 4X6AH 4OIKA 3EN2A 4O1OA 3PIPA 4ILWA 4KHPQ 4DV1Q 1WFQA 4J15A 3D4RA 4HJ5A 5IOCA 3CQZH 1SFOB 1IZ6A 5M5YB 5BR8Q 1KQSA 3H3VI 2MHVA 4JI8Q 5M3FB 2F66B 3MEFA 4N9PA 3M3YB 3MAQA 4DNRB 4ODGA 2ZRRA 5CV4A 3S1MH 1O7YA 1QNKA 4AH6A 4F87A 2ZXPA 1T5XD 1Q8KA 1EEFD 4DUYQ 5M5WH 1CT1D 2JJQA 3KK7A 1AP0A 4JI4Q 3T1YL 2PZWA 3MWYW 2XNAC 4FYDA 4AYBB 3RN2A 4I65A 1PDQA 4DV6L 4BA2I 2AQ1B 4QIWB 4WJ4A 2B2WC 3MXPA 1FR3A 4WJWA 5E4XA 2ZJRA 2K50A 5IODA 3UI2A 1N33Q 3DO9A 4LFBQ 2PMZB 4ZUJA 1MHWC 4HIKA 1TS5A 4HR7B 3TSSA 1WD0A 5E1FA 1PH7A 2ZT9C 1I94Q 2ZJQA 4LWCA 1K8AC 1X9NA 2KCCA 4GZYC 3FVVA 1ENCA 5DNFA 3HOYB 4P74A 2E2JH 3HP3A 2OQ0A 3I73A 2F0GA 4ZCKA 5J39A 3OTOQ 2EYHA 2XSCA 3RLFA 1GD7A 2MFIA 1CSQA 1U0LA 4A3BG 3OWFA 3HEJA 4BBRB 4RHRA 4A3GB 2HIXA 1EU4A 4K5VA 4DV0Q 1MJEA 1X3EA 4JBJA 4U68A 1UUPA 2BA0A 5C4JH 4X3UA 3NQIA 1HR0W 1SE8A 1VQKA 5JPNC 4LF5L 1TWGB 4LNQA 2E5LL 3FRPB 4A3CG 1NR4A 4FF1A 5BN4A 1F9QA 5CGKA 5CR3A 2VXWA 5K36H 4K8JA 3L3OC 3D8GA 1TXYA 1YJ9A 4OO1I 5FOBB 3ND8A 1HZ9A 3QIAA 5JVG3 1SYGA 2E74C 4CDCC 1A2UA 4R4IA 1BXTA 1O78A 1X56A 2VY3A 5C3EH 1E2ZA 2IJ0A 3PIOA 3PUYA 1M1KC 3GTJH 2ID0A 2HIVA 5DM73 1Y1VH 1ILQA 4JC0A 4DK3C 5A35A 1EU3A 3GV3A 1VDZA 3M4OB 1HQMC 2FJ2A 1KTKA 2B63B 4ZLTF 1VQOA 3K6OA 1HNZL 2XTQA 1FNUA 3D3RA 1XMQL 4NP5A 1QUQB 1CK1A 1NE3A 1SFOH 4GKJL 1ONLA 3T16A 4A75A 2GA4B 4DV3L 4DV2L 1EIHA 5M3FH 4EQPA 4K14A 3MXUA 1HHVA 3M3YH 2CQAA 2QF7A 3SGIA 2UXBL 1V1PA 3K7AH 1STHA 1BCPB 3GTMB 1BBXC 2L9HA 3CRLC 5C5LA 4K6DA 4N9TA 2F0JA 4B08A 4RAUC 1F2MA 1UE1A 2YTVA 2Y0SE 3H6MA 3GTKH 1SLJA 2J0TD 3TP8A 1E2WA 4A3DG 1EWHA 1STYA 1JICA 1M90C 5NUCA 4A3IG 1KDBA 4BBSB 1MI2A 1WVLA 1WTXA 3I72A 3T51B 3P75A 1PRTD 1TWHH 2RDGA 5JOBA 2A8VA 1EQVA 4OO1G 1DJRD 4QY7A 4YCUA 3K8AA 2L4NA 2SNSA 3G48A 1F9RA 1EY4A 4FF2A 4NB3A 4O0AA 2VS1A 2RSNA 4KJOA 4C2MH 1HA6A 3HOYH 3DA4A 1RODA 4BA1I 2JA7B 4HMJA 1DCZA 5IYDG 1QVCA 1YNJD 4HSPA 4ME3A 1XYIA 4OHJA 2ETDA 3KP9A 3PUXA 3KBXA 2QA4A 1KDCA 1LT5D 1RCVD 3ND9A 3VYRA 4HIMA 3BZKA 3UDGA 5EKKA 3DEPA
chains in the Genus database with same CATH topology
2K14A 1KD1C 3STBD 1OXTA 1SN8A 2Q2UA 4LF4L 4LF8L 3HOXG 4DR7Q 1J6QA 2WAQE 1CKMA 4JI5Q 4P73A 1K83H 4MNOA 2R93H 4X66Q 4HJ8A 1XMOL 1XMQQ 5IP9H 1PV4A 2CKZB 1GKHA 3JC66 2YFAA 1AE2A 1H95A 2WB1G 5GROA 4A3MH 1CSPA 3D31A 3K7UC 1PHJA 1IL2A 4B3SL 4DV3Q 2D0OA 3ER0A 4JI1Q 3JAMi 3M4QA 4DV2Q 3OW2A 5JJIA 4DV7Q 4XTCS 3U4VA 4YHHQ 4JI7Q 3UDFA 2ES2A 2VL6A 2E2HH 2PI2E 2JA7G 1EWIA 3CD6A 4R1JA 3KFUA 4YY3L 2LSSA 1A0IA 4AQYQ 4A3EH 4OX9L 4UP8A 3JAMc 4B3RQ 4LW1A 5GAEC 1Q1BA 2D0PA 2K52A 4GOPC 4JI0L 4B3MQ 2F4VQ 2N8NA 3CPFA 1PH4A 3PF4A 2FUG1 2I0QA 3EIVA 2JA6H 4HFVA 3GO5A 1RIPA 2CAZB 3W5OA 2EXDA 4IFDJ 4GN5A 2NZHA 1VQMA 2IHFA 4PL3A 3KOJA 4HJAA 4DR4L 1WCMG 1HNXL 4JV5L 4YZCA 4A3JG 1YITA 3KF8B 3U4ZA 4POFA 5M3MG 1YO7A 2NN6I 2Z6KA 2NVQH 2JB2A 3CMEA 1K73C 2MO0A 1OXUA 3CCSA 3KJOA 3F2DA 1G291 4A76A 4Z7GA 1JT8A 4OWWB 1MJCA 4GNXB 5IP9G 2EIFA 3M4OH 1XTDA 4LFAQ 2ZM6Q 3CC4A 2ASBA 4TQUS 1VQ4A 1B70B 2VQFQ 4A3DH 4JBKA 2JB3A 4NPSA 1PYBA 3AFQA 1XNRL 1VQEA 4LF6Q 4DR3Q 1NJIC 2B63H 2PQAB 4IPGA 3GTOH 3M4PA 4YZDA 3T1HL 1EOVA 4GKKQ 1N36Q 2Z0SA 3A5UA 3HFZB 2K4KA 2AKWB 2R7ZH 1S72A 3M85A 1HR0L 4O1PA 2YYZA 1UE7A 3UE1A 3G6EA 1IBML 4NXMQ 2BH8A 2JE6I 3CXCA 4C3IH 4DV7L 4YCVA 4YHHL 1JE5A 5H1SE 4JI7L 1KIXA 4HEA1 1Q46A 4JI2Q 2JA6G 3HOUH 1D7QA 4DNIA 1HZCA 3HOWH 1P16A 4AQYL 4DAYB 3I4MH 4OXPA 1VQBA 2Q2TA 3LJ0A 4Q9VA 3GTMH 5IE8A 4KLKA 3LGJA 1S40A 3S17H 2JAEA 3L0OA 2YTXA 3PO3G 5IYDH 3Q8DA 4B3ML 3TS0A 2F4VL 2R6GA 1EIYB 2UU9L 5LMNL 3F1ZA 2Q2HA 3L0IA 3F8TA 5HY6A 4P71A 5JEAG 1BBWA 1QVFA 4IPHA 2K19A 1DGSA 1XPRA 2JA8H 2ALYB 2JQOA 4LF4Q 1LYLA 4KI0A 4LF8Q 2UUCQ 2RHQB 4YWLA 3UDIA 1VQIA 2UXDQ 4K0KL 1EYGA 1UEBA 3U50C 3TRZA 5C44H 5LNK1 3PCOB 4DPGA 4HIOA 1XMOQ 3J81j 3I4NG 2B63G 4BBSH 1YHQA 1E1TA 1LTLA 4R4CA 2UUBL 1FL0A 4A3FG 3GD7A 4APVA 4G76A 1YJNA 4B3TQ 3CW2C 2KBNA 2UXCQ 2OQKA 4GOPB 1KRSA 3HOXH 2KCMA 1V1QA 2Y0SG 2JB1A 3F4MA 2K5NA 2NZOA 4JOIC 4DKAC 1XNQL 4U6RA 2ZM6L 1HZAA 2R7ZG 4PZ7A 1PH2A 4LF6L 4DR3L 3IAS1 4NXNL 4HIDA 4YY3Q 2GN5A 1Q1EA 3PV0A 1PFSA 4GLVB 1L0WA 3CCVA 2CCZA 1PH6A 1PH1A 2JEAI 4IJHA 5J3BA 1WYDA 1VQPA 3DLLA 4QQBX 1UE6A 1Z9FA 4IO9A 3P23A 3HOWG 2JA7H 1E7ZA 1SRUA 3I4MG 1A63A 2JEBI 1B7YB 1YHAA 1D8LA 2L1LB 1LUZA 1N9WA 1VQGA 1VCIA 4DR5L 4GOPA 2NVTH 3GTGH 3EBEA 1GVPA 1ASYA 4PZ8A 3GTLH 5JEAJ 4JI2L 1HNXQ 2IY5B 1E22A 1YBYA 1MIUA 3NBHB 4IJLA 3TREA 1C9OA 2ATWA 5FLMG 2VQEL 3CMAA 1GM5A 2JK8A 3CAMA 2P22B 4A3KG 5IYCH 1W3SA 2A2DA 4JBWA 3KJPA 1IBLQ 2OTLA 4LUZA 1YZ6A 1WCMH 4C3JH 1EUJA 1SMXA 1FJGL 4KHPL 4DAMA 4DV1L 5M3MH 2BA1A 2B3GA 3NEMA 1OXVA 3K0XA 1NBWA 1MKHA 4AYBE 4DV5L 1HH2P 2UUCL 1XNRQ 2F52A 2LXKA 3S1QH 2UXDL 1PH9A 4C3HH 2R7FA 3T1HQ 5BR8L 2HQLA 4TVAB 2OCEA 3RLOA 1K0RA 4X62L 4IOAA 2R7DA 2IX1A 2YV5A 2RHSB 3HKZE 4QIWE 3STBC 1QVGA 3RN5A 1K3RA 1TWFH 4PMWA 1EQQA 1HR0Q 4R4QA 3VDYA 4B3TL 2UXCL 1L1OC 1C7YA 1VQJA 1IBMQ 4BXXH 1AH9A 1VQ7A 2R92G 3ZJYC 2PMZE 3PSIA 3HOZH 2WAQG 2XGTA 3AQQA 4EQ5A 4JCVE 1HJPA 2E2IH 2HHHL 5DLQE 1O7IA 1VS0A 4DUYL 4X64Q 3UDXA 1Y14B 3HKZG 2XTRA 3CPWA 4WJ3M 1PH8A 4AS3A 3F2BA 5HGIA 2AWNA 1E24A 3BJUA 4PZ6A 3HKSA 3VA9A 3I9V1 4DR1Q 1R9TH 4O2DA 1YHBA 3CCLA 4JI6Q 2UU9Q 4BY7H 5LMNQ 1E3PA 1HZBA 4IPDA 1XNQQ 4PL4A 3FKIG 5IYCG 1LM0A 1KAWA 4YWMA 4KHZA 4ALPA 4UY8C 1Q7YC 1Q81C 4K0KQ 4GXTA 2VZAA 5IWAL 4JI3L 3PO3H 4L5QA 1PYSB 1T9HA 2AMCB 3MXNB 1PH5A 2UUBQ 3CCQA 3U58A 1S3OA 5IT9c 4IPCA 3I56A 4DR2L 4B3RL 4LFBL 1IBLL 2EQSA 3AYHB 4UP9A 2XTIA 1A8VA 3S1RH 5ELNA 1VQLA 4L5RC 3AJFA 1HNWL 1CKOA 3I4NH 1I5FA 5C0XI 1OXXK 1I94L 1G6PA 3G71A 4JOIA 4A3FH 4NXNQ 3J7A5 4EX5A 3ULJA 4BXXG 4GS3A 3S2HH 4PG3A 3HOZG 4UP7A 3HOVG 2E8GA 1AE3A 2N3SA 4R4OA 3T1YQ 1VQNA 2GVAA 2MJFB 4OWTB 3W1BA 2A2CA 1JJ2A 3GDEA 4LUOA 4DV6Q 1PA6A 1Y1WG 5JJKA 5GAHC 3WWVA 4IFDI 3CCUA 4DR5Q 4GNXA 3NENA 4BY7G 4GN4B 1V43A 4X64L 2CQOA 1G51A 2ZTCA 2VQEQ 2PQAA 4DV0L 1Q82C 1N34Q 5JJLA 2D62A 2IP6A 3PO2H 3OYYA 3PF5A 3TEHB 4X6AH 4DR1L 3S15H 2CWAA 2WFWA 1I50H 3EN2A 4JI6L 2OTJA 4O1OA 3PIPA 1YNXA 1FJGQ 4KHPQ 5FLMH 4DV1Q 4A93G 1WFQA 4J15A 4QGUA 4HJ5A 5M5YH 4A3KH 2H5XA 4NV5A 1X3FA 2KHIA 3CQZH 4DV5Q 4LF5L 3CC2A 1GO3E 4A3LG 1IZ6A 3LJ1A 1QZHA 1CKNB 5BR8Q 1KXLA 3TS2A 1VQCA 2NVXH 3KF6B 4X62Q 1WJJA 2L15A 3IAM1 1KQSA 4JI8Q 3E9HA 3H3VI 4GLXA 3RLNA 1SJ8A 2F66B 2MO1A 3MEFA 5C3EG 1NTGA 3E0EA 3E9IA 3L7ZC 2ZRRA 2LXJA 1VQ9A 3S1MH 4YZ9A 4AH6A 1XJVA 2HHHQ 3TQYA 1P8LA 1Q8KA 4DUYQ 3CCEA 1VQ5A 1BVSA 2CWPA 5M5WH 3A5ZB 3DA3A 2JJQA 4X65Q 1BKBA 1Y1VG 4R4TA 5EAYA 1U5KA 1CKNA 4JI4Q 1CUKA 4DV4Q 2Z6KC 1X65A 3RNUA 3T1YL 1A62A 2R92H 2B29A 4RG1A 1IBKQ 2GVBA 2YTYA 4POGA 1XPUA 3AFPA 4A3BH 3RN2A 3LJ2A 4DUZQ 4DV6L 2KHJA 2YU9H 4LF5Q 3PO2G 3SDJA 5M5XH 2E5LQ 4BA2I 4HJ9A 1X54A 4XIGS 1X55A 2BH2A 4WJ4A 5IWAQ 2RCNA 2CFMA 4JG2A 4JI3Q 5LMUL 3AEVA 4GN3B 3IRBA 3GTPH 2ZJRA 1N34L 2K50A 2JA9A 4JYAL 1N33Q 2NN6G 3FKIH 3DO9A 4DR2Q 4LFBQ 2VNUD 1RL2A 3CP0A 3S14H 2IX0A 4NV2A 5M3FG 4HIKA 2AWOA 1XPOA 1X3GA 4OONA 1HNWQ 1OTCA 2A19A 3L2PA 1YIJA 1PH7A 1I94Q 4LWCA 1K8AC 2ZJQA 5C0XG 3PGZA 1X9NA 1K8GA 4A3JH 1UE5A 2I5LX 2F3IA 2I5MX 4P74A 2E2JH 2OQ0A 4JI8L 4QL5A 2Q2IA 1VQHA 2ZTEA 3NELA 1X6OA 2ZTDA 5FLXc 4PL5A 5E7NA 3OTOQ 1FGUA 3RLFA 4BBRH 4AYBG 1GD7A 2MFIA 2PI2A 1CSQA 4A3GH 5FJ8H 1YVCA 1U0LA 4LF7L 2VUMH 3HOVH 4A3BG 1L2FA 3PUWA 2WB1E 2N78A 2HIXA 4X65L 5HGQA 1N32L 1VQDA 2RF4A 4AS2A 4DV0Q 1MJEA 1X3EA 4BY1G 4JBJA 3JSBA 1E1OA 3RR5A 5AJ3L 1Y1WH 4DV4L 1J5EQ 4JI4L 4JBMA 1HNZQ 4H02A 2BA0A 1IBKL 5C4JH 1TWGH 2F6MB 1OXSC 4DUZL 1SE8A 4DK6C 3G4SA 1JB7A 1HR0W 1VQKA 1NMGA 2E5LL 1WOCA 2DGYA 1I3QH 4LNQA 4A3CG 4DR6L 4GKJQ 2UUAQ 1KRTA 5IP7G 1B8AA 2K5VA 3FHWA 2IHEA 2V6EA 1TXYA 2XMXA 3A74A 2K5HA 1YJ9A 1KC8C 4OO1I 5C0XJ 1Z47A 2ZJPA 1HZ9A 1N33L 4A93H 3HOYG 4OWXB 4LFCL 4L5SA 1WI5A 3K81C 2UXBQ 1KHIA 4A3LH 2PNHA 1JJCB 4Z7HA 3CC7A 4R4IA 3RZDH 5LMNW 5C4XG 2VY3A 1X56A 1TWAH 3D0FA 3ULPA 2KENA 3J7ZC 3K80C 1QZGA 3H0GH 4BBRG 5C3EH 2N49A 4A3GG 2KKMA 5FJ8G 3PUZA 2VUMG 2DUDA 3W1GA 1VQAA 1EIFA 2MQHA 3FBVA 1TWCH 4AIMA 1V9PA 3KDFB 3PUYA 3PIOA 1M1KC 4GLAC 3GTJH 3UE0A 2ID0A 3OTOL 4G75A 3CF5A 3UITA 2HIVA 4HJ7A 1YJWA 1Y1VH 2KCTA 2WP8J 4JC0A 2FXQA 4DK3C 1Q86C 2R93G 1SROA 2JA5H 3I4OA 2YFBA 5LMUQ 4OAUC 3S2DH 3J81i 4RMFA 4A3MG 4JYAQ 1VQFA 2QGQA 3CCJA 3F2CA 4P72A 4JI5L 4A3IH 1J5EL 3M7NA 4DR7L 1VQOA 5K36G 1HNZL 5ELOA 1ASZA 2XTQA 4UPAA 4X66L 1XMQL 4P75A 2HT1A 1L1OB 3KDFA 3M9BA 1QUQB 3J81c 3I55A 5GAGC 1EFWA 1NE3A 1SFOH 4GKJL 3PUVA 4A3EG 2UUAL 4LF9Q 3ULLA 1NY4A 4DV3L 4A75A 4JI1L 4A4IA 4DV2L 1NMFA 1IXRA 2V1CC 5M3FH 1PVOA 1Q12A 2QEXA 3M3YH 2OWOA 3BZCA 3H0GG 5IY0A 4QJFA 4DWLA 3KLWA 3SGIA 2UXBL 1YI2A 4OAVB 1JJGA 3K7AH 3BU2A 1YEZA 5IYBH 1N8RC 1L1OA 3S24A 4YWKA 4LF7Q 1QUQA 4MZ9A 1N32Q 1I6HH 2IT1A 4FDBA 4I1TA 1UE1A 2YTVA 2Y0SE 1JMCA 1FVIA 5AJ3Q 3GTKH 4MTNA 1SLJA 1SR3A 3ICEA 2JA5G 3KF6A 3RZOH 4A3DG 3FP9A 1VQ8A 1K9MC 1M90C 3GTQH 3J80i 4Y7NH 5GQOA 2C35B 4A3IG 2VW9A 4DR6Q 4BY1H 2AHOB 4B3SQ 2K75A 3A0JA 4LFAL 1VQ6A 1BBUA 1TWHH 3ERSX 2VQFL 2A8VA 4YCWA 3J80c 4OO1G 4QY7A 2MNAA 4LFCQ 4YCUA 5GADC 3K8AA 4A3CH 1KL9A 3B6YA 4GKKL 2A1AA 3G48A 4L5TA 1N36L 4OX9Q 5IP7H 3S16H 4NB3A 4O0AA 3HOUG 2VS1A 4JI0Q 1C0AA 4GNXC 2NVYH 4C2MH 4LF9L 3DM3A 3H3VH 3HOYH 1EQRA 3DA4A 4LUVA 2RIOA 4BA1I 4NXML 5IYBG 3H15A 4IOCA 5IYDG 1QVCA 4DR4Q 4ME3A 1PH3A 4JV5Q 1UWVA 5C4XH 3KP9A 1IYJB 3I7FA 3PUXA 2QA4A 2JA8G 3CCRA 3I2ZA 3CCMA 1W2BA 4IFDG 5C44G 2I5HA 4HIMA 3BZKA 3S1NH 4BBSG 3KYHC 3UDGA 4Y52H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K14 A;  1KD1 C;  3STB D;  1OXT A;  1SN8 A;  2Q2U A;  4LF4 L;  4LF8 L;  3HOX G;  4DR7 Q;  1J6Q A;  2WAQ E;  1CKM A;  4JI5 Q;  4P73 A;  1K83 H;  4MNO A;  2R93 H;  4X66 Q;  4HJ8 A;  1XMO L;  1XMQ Q;  5IP9 H;  1PV4 A;  2CKZ B;  1GKH A;  3JC6 6;  1AE2 A;  1H95 A;  2WB1 G;  5GRO A;  4A3M H;  1CSP A;  3D31 A;  3K7U C;  1PHJ A;  1IL2 A;  4B3S L;  4DV3 Q;  2D0O A;  3ER0 A;  4JI1 Q;  3JAM i;  3M4Q A;  4DV2 Q;  3OW2 A;  5JJI A;  4DV7 Q;  4XTC S;  3U4V A;  4YHH Q;  4JI7 Q;  3UDF A;  2ES2 A;  2VL6 A;  2E2H H;  2PI2 E;  2JA7 G;  1EWI A;  3CD6 A;  4R1J A;  3KFU A;  4YY3 L;  2LSS A;  1A0I A;  4AQY Q;  4A3E H;  4OX9 L;  4UP8 A;  3JAM c;  4B3R Q;  4LW1 A;  5GAE C;  1Q1B A;  2D0P A;  2K52 A;  4GOP C;  4JI0 L;  4B3M Q;  2F4V Q;  2N8N A;  3CPF A;  1PH4 A;  3PF4 A;  2I0Q A;  3EIV A;  2JA6 H;  3GO5 A;  1RIP A;  3W5O A;  2EXD A;  4IFD J;  4GN5 A;  2NZH A;  1VQM A;  2IHF A;  3KOJ A;  4DR4 L;  4HJA A;  1WCM G;  1HNX L;  4JV5 L;  4A3J G;  1YIT A;  3KF8 B;  3U4Z A;  4POF A;  5M3M G;  2NN6 I;  2Z6K A;  2NVQ H;  1K73 C;  3CME A;  2MO0 A;  1OXU A;  3CCS A;  3KJO A;  3F2D A;  1G29 1;  4A76 A;  1JT8 A;  4OWW B;  1MJC A;  4GNX B;  5IP9 G;  2EIF A;  3M4O H;  1XTD A;  4LFA Q;  2ZM6 Q;  3CC4 A;  2ASB A;  4TQU S;  1VQ4 A;  1B70 B;  2VQF Q;  4A3D H;  4JBK A;  2B63 H;  4NPS A;  1PYB A;  3AFQ A;  1XNR L;  1VQE A;  4LF6 Q;  4DR3 Q;  1NJI C;  2PQA B;  4IPG A;  3GTO H;  3M4P A;  3T1H L;  1EOV A;  4GKK Q;  1N36 Q;  2Z0S A;  3A5U A;  3HFZ B;  2K4K A;  2AKW B;  2R7Z H;  1S72 A;  3M85 A;  1HR0 L;  2YYZ A;  1UE7 A;  3UE1 A;  3G6E A;  1IBM L;  4NXM Q;  2BH8 A;  2JE6 I;  3CXC A;  4C3I H;  4DV7 L;  4YCV A;  4YHH L;  1JE5 A;  5H1S E;  4JI7 L;  1KIX A;  4JI2 Q;  1Q46 A;  2JA6 G;  3HOU H;  1D7Q A;  4DNI A;  1HZC A;  3HOW H;  1P16 A;  4AQY L;  4DAY B;  3I4M H;  4OXP A;  1VQB A;  2Q2T A;  3GTM H;  3S17 H;  4B3R L;  5IE8 A;  4KLK A;  3LGJ A;  1S40 A;  3L0O A;  2YTX A;  3PO3 G;  5IYD H;  3Q8D A;  4B3M L;  3TS0 A;  2F4V L;  2R6G A;  1EIY B;  2UU9 L;  5LMN L;  3F1Z A;  2Q2H A;  3F8T A;  5JEA G;  5HY6 A;  4P71 A;  1QVF A;  1BBW A;  1XNQ L;  4IPH A;  1DGS A;  1XPR A;  2JA8 H;  2ALY B;  2JQO A;  4LF4 Q;  1LYL A;  4KI0 A;  4LF8 Q;  2UUC Q;  2RHQ B;  4YWL A;  3UDI A;  1VQI A;  2UXD Q;  4K0K L;  1EYG A;  1UEB A;  3U50 C;  3TRZ A;  5C44 H;  3PCO B;  4DPG A;  1XMO Q;  4HIO A;  3I4N G;  3J81 j;  2B63 G;  4BBS H;  1YHQ A;  1E1T A;  1LTL A;  4R4C A;  2UUB L;  1FL0 A;  4A3F G;  3GD7 A;  4APV A;  1YJN A;  4B3T Q;  3CW2 C;  2KBN A;  2UXC Q;  2OQK A;  4GOP B;  1KRS A;  3HOX H;  2KCM A;  1V1Q A;  2Y0S G;  2K5N A;  4JOI C;  2NZO A;  4DKA C;  2R7Z G;  2ZM6 L;  1HZA A;  4PZ7 A;  1PH2 A;  4LF6 L;  4DR3 L;  4NXN L;  4HID A;  4YY3 Q;  2GN5 A;  1Q1E A;  3PV0 A;  1PFS A;  4GLV B;  1L0W A;  3CCV A;  2CCZ A;  1PH6 A;  1PH1 A;  2JEA I;  4IJH A;  5J3B A;  1WYD A;  1VQP A;  3DLL A;  4QQB X;  1UE6 A;  1Z9F A;  4IO9 A;  3HOW G;  2JA7 H;  1E7Z A;  1SRU A;  3I4M G;  1A63 A;  2JEB I;  1B7Y B;  1YHA A;  1D8L A;  1LUZ A;  1N9W A;  1VCI A;  1VQG A;  4DR5 L;  4GOP A;  2NVT H;  3GTG H;  3EBE A;  1GVP A;  1ASY A;  4PZ8 A;  3GTL H;  5JEA J;  4JI2 L;  1HNX Q;  2IY5 B;  1E22 A;  1YBY A;  1MIU A;  3NBH B;  4IJL A;  3TRE A;  1C9O A;  2ATW A;  5FLM G;  2VQE L;  3CMA A;  1GM5 A;  2JK8 A;  3CAM A;  4A3K G;  5IYC H;  1W3S A;  4JBW A;  3KJP A;  1IBL Q;  2OTL A;  4LUZ A;  1YZ6 A;  1WCM H;  4C3J H;  1EUJ A;  1SMX A;  1FJG L;  4KHP L;  4DAM A;  4DV1 L;  5M3M H;  2BA1 A;  2B3G A;  3NEM A;  1OXV A;  3K0X A;  1NBW A;  1MKH A;  4AYB E;  4DV5 L;  1HH2 P;  2UUC L;  1XNR Q;  2F52 A;  2LXK A;  3S1Q H;  2UXD L;  1PH9 A;  4C3H H;  2R7F A;  3T1H Q;  5BR8 L;  2HQL A;  4TVA B;  2OCE A;  3RLO A;  1K0R A;  4X62 L;  4IOA A;  2R7D A;  2IX1 A;  2YV5 A;  2RHS B;  3HKZ E;  4QIW E;  3STB C;  1QVG A;  3RN5 A;  1K3R A;  1TWF H;  4PMW A;  1EQQ A;  1HR0 Q;  4R4Q A;  3VDY A;  4B3T L;  2UXC L;  1L1O C;  1C7Y A;  1VQJ A;  1IBM Q;  4BXX H;  1AH9 A;  1VQ7 A;  2R92 G;  3ZJY C;  2PMZ E;  3PSI A;  3HOZ H;  2WAQ G;  2XGT A;  3AQQ A;  4EQ5 A;  4JCV E;  1HJP A;  2E2I H;  2HHH L;  5DLQ E;  1O7I A;  1VS0 A;  4DUY L;  4X64 Q;  3UDX A;  1Y14 B;  3HKZ G;  3CPW A;  4WJ3 M;  1PH8 A;  3F2B A;  2AWN A;  1E24 A;  3BJU A;  4PZ6 A;  3HKS A;  4DR1 Q;  3CCL A;  1R9T H;  4O2D A;  1YHB A;  4JI6 Q;  2UU9 Q;  4BY7 H;  5LMN Q;  1E3P A;  1HZB A;  4IPD A;  1XNQ Q;  3FKI G;  5IYC G;  1LM0 A;  1KAW A;  4YWM A;  4KHZ A;  4ALP A;  4UY8 C;  1Q7Y C;  1Q81 C;  4K0K Q;  2VZA A;  5IWA L;  4JI3 L;  3PO3 H;  4L5Q A;  1PYS B;  1T9H A;  2AMC B;  3MXN B;  1PH5 A;  2UUB Q;  3CCQ A;  3U58 A;  1S3O A;  5IT9 c;  4IPC A;  3I56 A;  4DR2 L;  4LFB L;  1IBL L;  2EQS A;  3AYH B;  4UP9 A;  2XTI A;  1A8V A;  3S1R H;  5ELN A;  1VQL A;  4L5R C;  1HNW L;  1CKO A;  3I4N H;  1I5F A;  5C0X I;  1OXX K;  1I94 L;  1G6P A;  3G71 A;  4JOI A;  4A3F H;  4NXN Q;  3J7A 5;  4EX5 A;  3ULJ A;  4BXX G;  4GS3 A;  3S2H H;  4PG3 A;  3HOZ G;  4UP7 A;  3HOV G;  1AE3 A;  2E8G A;  2N3S A;  4R4O A;  3T1Y Q;  1VQN A;  2GVA A;  4OWT B;  3W1B A;  1JJ2 A;  3GDE A;  4LUO A;  4DV6 Q;  1PA6 A;  1Y1W G;  5JJK A;  5GAH C;  3WWV A;  4IFD I;  3CCU A;  4DR5 Q;  4GNX A;  3NEN A;  4BY7 G;  4GN4 B;  1V43 A;  4X64 L;  2CQO A;  1G51 A;  2ZTC A;  2VQE Q;  2PQA A;  4DV0 L;  1Q82 C;  1N34 Q;  5JJL A;  2D62 A;  3PO2 H;  3OYY A;  3PF5 A;  3TEH B;  4X6A H;  4DR1 L;  3S15 H;  2CWA A;  2WFW A;  1I50 H;  3EN2 A;  4JI6 L;  2OTJ A;  3PIP A;  1YNX A;  1FJG Q;  4KHP Q;  5FLM H;  4DV1 Q;  4A93 G;  1WFQ A;  4J15 A;  4QGU A;  4HJ5 A;  5M5Y H;  4A3K H;  2H5X A;  4LF5 L;  1X3F A;  2KHI A;  3CQZ H;  4DV5 Q;  4A3L G;  3CC2 A;  1GO3 E;  1IZ6 A;  1QZH A;  1CKN B;  5BR8 Q;  1KXL A;  3TS2 A;  1VQC A;  2NVX H;  3KF6 B;  4X62 Q;  1WJJ A;  2L15 A;  1KQS A;  3H3V I;  4JI8 Q;  3E9H A;  4GLX A;  3RLN A;  2MO1 A;  3MEF A;  5C3E G;  1NTG A;  3E0E A;  3E9I A;  3L7Z C;  1VQ9 A;  2LXJ A;  3S1M H;  4AH6 A;  1XJV A;  2HHH Q;  3TQY A;  1P8L A;  1Q8K A;  4DUY Q;  3CCE A;  1VQ5 A;  1BVS A;  2CWP A;  5M5W H;  3A5Z B;  2JJQ A;  4X65 Q;  1BKB A;  1Y1V G;  4R4T A;  5EAY A;  1U5K A;  1CKN A;  4JI4 Q;  1CUK A;  4DV4 Q;  2Z6K C;  1X65 A;  3RNU A;  3T1Y L;  1A62 A;  2R92 H;  2B29 A;  4RG1 A;  1IBK Q;  2GVB A;  2YTY A;  4POG A;  1XPU A;  3AFP A;  4A3B H;  3RN2 A;  4DV6 L;  4DUZ Q;  2YU9 H;  2KHJ A;  4LF5 Q;  3PO2 G;  2E5L Q;  5M5X H;  4BA2 I;  4HJ9 A;  1X54 A;  4XIG S;  1X55 A;  2BH2 A;  4WJ4 A;  5IWA Q;  2RCN A;  2CFM A;  4JG2 A;  4JI3 Q;  5LMU L;  3AEV A;  4GN3 B;  3IRB A;  3GTP H;  2ZJR A;  1N34 L;  2K50 A;  2JA9 A;  4JYA L;  1N33 Q;  2NN6 G;  3FKI H;  4DR2 Q;  4LFB Q;  2VNU D;  1RL2 A;  3CP0 A;  3S14 H;  2IX0 A;  4HIK A;  5M3F G;  2AWO A;  1XPO A;  1X3G A;  4OON A;  1HNW Q;  1OTC A;  2A19 A;  3L2P A;  1YIJ A;  1PH7 A;  1I94 Q;  4LWC A;  1K8A C;  2ZJQ A;  5C0X G;  3PGZ A;  1X9N A;  1K8G A;  4A3J H;  1UE5 A;  2I5L X;  2F3I A;  2I5M X;  4P74 A;  2E2J H;  2OQ0 A;  4JI8 L;  4QL5 A;  2Q2I A;  1VQH A;  2ZTE A;  3NEL A;  1X6O A;  2ZTD A;  5FLX c;  5E7N A;  3OTO Q;  1FGU A;  3RLF A;  4BBR H;  4AYB G;  1GD7 A;  2MFI A;  2PI2 A;  1CSQ A;  4A3G H;  5FJ8 H;  1YVC A;  1U0L A;  4LF7 L;  2VUM H;  3HOV H;  4A3B G;  1L2F A;  3PUW A;  2WB1 E;  2N78 A;  2HIX A;  4X65 L;  5HGQ A;  1N32 L;  1VQD A;  2RF4 A;  4DV0 Q;  1MJE A;  1X3E A;  4BY1 G;  4JBJ A;  3RR5 A;  1E1O A;  5AJ3 L;  1Y1W H;  1J5E Q;  4DV4 L;  4JI4 L;  4JBM A;  1HNZ Q;  4H02 A;  2BA0 A;  1IBK L;  5C4J H;  1TWG H;  1OXS C;  4DUZ L;  1SE8 A;  4DK6 C;  3G4S A;  1JB7 A;  1HR0 W;  1VQK A;  1NMG A;  2E5L L;  1WOC A;  2DGY A;  1I3Q H;  4LNQ A;  4A3C G;  4DR6 L;  4GKJ Q;  2UUA Q;  1KRT A;  5IP7 G;  1B8A A;  2K5V A;  3FHW A;  2IHE A;  1TXY A;  3A74 A;  1YJ9 A;  2K5H A;  1KC8 C;  4OO1 I;  5C0X J;  1Z47 A;  2ZJP A;  1HZ9 A;  1N33 L;  4A93 H;  3HOY G;  4OWX B;  4LFC L;  4L5S A;  1WI5 A;  3K81 C;  2UXB Q;  1KHI A;  4A3L H;  2PNH A;  1JJC B;  3CC7 A;  4R4I A;  3RZD H;  5LMN W;  5C4X G;  2VY3 A;  1X56 A;  1TWA H;  3D0F A;  3ULP A;  2KEN A;  3J7Z C;  3K80 C;  1QZG A;  3H0G H;  4BBR G;  5C3E H;  2N49 A;  4A3G G;  5FJ8 G;  3PUZ A;  2VUM G;  2DUD A;  3W1G A;  1VQA A;  1EIF A;  2MQH A;  1TWC H;  4AIM A;  1V9P A;  3KDF B;  3PUY A;  3PIO A;  1M1K C;  4GLA C;  3GTJ H;  3UE0 A;  2ID0 A;  3OTO L;  3CF5 A;  2HIV A;  4HJ7 A;  1YJW A;  1Y1V H;  2KCT A;  2WP8 J;  4JC0 A;  2FXQ A;  4DK3 C;  1Q86 C;  2R93 G;  1SRO A;  2JA5 H;  3I4O A;  5LMU Q;  3S2D H;  3J81 i;  4RMF A;  4A3M G;  4JYA Q;  1VQF A;  2QGQ A;  3CCJ A;  3F2C A;  4P72 A;  4JI5 L;  4A3I H;  1J5E L;  3M7N A;  4DR7 L;  1VQO A;  5K36 G;  1HNZ L;  5ELO A;  1ASZ A;  4UPA A;  4X66 L;  1XMQ L;  4P75 A;  2HT1 A;  1L1O B;  3KDF A;  3M9B A;  1QUQ B;  3J81 c;  3I55 A;  5GAG C;  1EFW A;  1NE3 A;  1SFO H;  4GKJ L;  3PUV A;  4A3E G;  2UUA L;  4LF9 Q;  3ULL A;  1NY4 A;  4DV3 L;  4A75 A;  4JI1 L;  4A4I A;  4DV2 L;  1NMF A;  1IXR A;  2V1C C;  5M3F H;  1PVO A;  1Q12 A;  2QEX A;  3M3Y H;  2OWO A;  3BZC A;  3H0G G;  5IY0 A;  4QJF A;  3KLW A;  3SGI A;  2UXB L;  1YI2 A;  1JJG A;  3K7A H;  3BU2 A;  1YEZ A;  5IYB H;  1N8R C;  1L1O A;  3S24 A;  4YWK A;  4LF7 Q;  1QUQ A;  4MZ9 A;  1N32 Q;  1I6H H;  2IT1 A;  4FDB A;  1UE1 A;  2YTV A;  2Y0S E;  1JMC A;  1FVI A;  5AJ3 Q;  3GTK H;  4MTN A;  1SLJ A;  1SR3 A;  3ICE A;  2JA5 G;  3KF6 A;  3RZO H;  4A3D G;  3FP9 A;  1VQ8 A;  1K9M C;  1M90 C;  3GTQ H;  3J80 i;  4Y7N H;  5GQO A;  2C35 B;  4A3I G;  2VW9 A;  4DR6 Q;  4BY1 H;  2AHO B;  4B3S Q;  2K75 A;  3A0J A;  4LFA L;  1VQ6 A;  1BBU A;  1TWH H;  3ERS X;  2VQF L;  2A8V A;  4YCW A;  3J80 c;  4OO1 G;  4QY7 A;  2MNA A;  4LFC Q;  4YCU A;  5GAD C;  3K8A A;  4A3C H;  1KL9 A;  3B6Y A;  4GKK L;  2A1A A;  3G48 A;  4L5T A;  1N36 L;  4OX9 Q;  5IP7 H;  3S16 H;  4NB3 A;  4O0A A;  3HOU G;  2VS1 A;  4JI0 Q;  1C0A A;  4GNX C;  2NVY H;  4C2M H;  4LF9 L;  3DM3 A;  3H3V H;  3HOY H;  1EQR A;  4LUV A;  4BA1 I;  4NXM L;  5IYB G;  3H15 A;  4IOC A;  5IYD G;  1QVC A;  4DR4 Q;  4ME3 A;  1PH3 A;  4JV5 Q;  1UWV A;  5C4X H;  1IYJ B;  3I7F A;  3PUX A;  2QA4 A;  2JA8 G;  3CCR A;  3I2Z A;  3CCM A;  1W2B A;  4IFD G;  5C44 G;  2I5H A;  4HIM A;  3BZK A;  3S1N H;  4BBS G;  3KYH C;  3UDG A;  4Y52 H; 
#chains in the Genus database with same CATH topology
 2J4X A;  1ZYR D;  4LF4 L;  4JI5 Q;  1G2S A;  3PQI A;  4MNO A;  3S1Q B;  4HJ8 A;  2EDG A;  1XMO L;  1PV4 A;  1JC7 A;  1GKH A;  2WB1 G;  3N52 A;  1BNZ A;  1CSP A;  3D31 A;  3HGB A;  3W3A A;  3OPO A;  5JJI A;  2CHB D;  2PO4 A;  5EJW A;  1KLG D;  1EYA A;  4UP8 A;  3NE5 B;  1Q1B A;  2K52 A;  5D65 A;  4GOP C;  4JI0 L;  5CC4 A;  3CPF A;  3PF4 A;  1BDO A;  1VF5 C;  3GO5 A;  2CAZ B;  2EXD A;  3TBI B;  1QWY A;  4K5X A;  4DR4 L;  2KOL A;  1O80 A;  5JAV A;  3K0Y A;  1HNX L;  4YZC A;  4A3J G;  3NWT A;  3KF8 B;  5M3M G;  4POF A;  4Z9C B;  1CHP D;  2NN6 I;  2Z6K A;  1QB5 D;  1G29 1;  4DK0 A;  2SDF A;  1MJC A;  5IP9 G;  3M4O H;  2VQF Q;  2B63 H;  2QIL A;  2QKI C;  2SEB D;  3M4P A;  1S5C D;  1VMP A;  1U9R A;  4GKK Q;  3S2H B;  1SNM A;  2K4K A;  2SOB A;  3NSW A;  2AKW B;  2IPK D;  1ICF B;  2B8G A;  4RGN A;  3G6E A;  2R7Z B;  3UE1 A;  4DV7 L;  4JI7 L;  1RTO A;  4JI2 Q;  1Q46 A;  4DNI A;  1PMR A;  4NKL A;  3GTM H;  4Q9V A;  3I4M B;  2YTX A;  3PO3 G;  2TMP A;  4FNF A;  4B3M L;  3F1Z A;  3F8T A;  3L0I A;  1QVF A;  3QOL A;  1R4Q B;  5IGE A;  2K19 A;  1XPR A;  5D3I B;  1LYL A;  4KI0 A;  4LF8 Q;  1HXY D;  1SNO A;  1J8I A;  1II3 A;  5D14 A;  4BBS H;  2UUB L;  1JB3 A;  4A3F G;  5CV8 A;  4G76 A;  4B3T Q;  2D2C C;  2F0Q A;  2NZ1 D;  5CYU A;  3IAY A;  4HCS A;  4U6R A;  1HZA A;  2LS0 1;  1A2T A;  3I4L A;  4WRD A;  3IAS 1;  4DR3 L;  1WTV A;  4C3I G;  2CCZ A;  2JEA I;  4QQB X;  1SE2 A;  1F9S A;  1Z9F A;  2JA7 H;  2WAQ B;  4ID6 A;  4DR5 L;  2F0D A;  3C2P A;  3EBE A;  2NVT B;  3NBH B;  1YBY A;  3C1E A;  3TRE A;  4WFN 3;  3CHB D;  5KNC A;  3CAM A;  4A3K G;  5IYC H;  1B2T A;  1A3T A;  1D5X C;  1YZ6 A;  2K05 A;  2PZU A;  1FJG L;  1IYV A;  5KGU A;  1XNR Q;  4AYB E;  3DHQ A;  2UUC L;  1HH2 P;  3S1Q H;  1AZQ A;  2R7F A;  3T1H Q;  2HQL A;  4TVA B;  1R4P B;  1K0R A;  4IOA A;  3E6Z X;  4QIW E;  1QVG A;  3S16 H;  2L1B A;  3VDY A;  1TU2 B;  5IGG A;  1C7Y A;  1GUG A;  1IBM Q;  4BXX H;  1AH9 A;  4K6L A;  2R92 G;  3ZJY C;  2PMZ E;  3HOZ H;  5KIX A;  1YNN D;  1HJP A;  1O7I A;  1VS0 A;  1ZKO A;  2XTR A;  1PH8 A;  3QR8 A;  3LX0 A;  5KNB A;  2AWN A;  2EYL A;  4X3S A;  2UU9 Q;  5LMN Q;  5IGB A;  1LM0 A;  1KAW A;  4YWM A;  4KHZ A;  5J22 A;  1A15 A;  4K0K Q;  1Q90 A;  2VZA A;  1XXG A;  4JI3 L;  1CHQ D;  3MXN B;  1PRT B;  1H9S B;  1S3O A;  5IT9 c;  1NSN S;  2K5D A;  1IBL L;  4A93 B;  1FD7 D;  3SE0 A;  1STA A;  3AJF A;  3S1R B;  1I5F A;  5C0X I;  3V05 A;  1BQQ T;  1DOM A;  4KN4 C;  4JOI A;  4NXN Q;  2B2T C;  3J7A 5;  3BDO A;  1I4X A;  3S2H H;  1HQR D;  1SEB D;  2BE5 C;  4KMU C;  1S5F D;  1SE3 A;  4PG3 A;  2E8G A;  3T1Y Q;  1VQN A;  3KF8 A;  4ZKB B;  3HZX A;  1CM9 A;  4OWT B;  3W1B A;  4LUO A;  4DV6 Q;  1TWC B;  5JJK A;  3WWV A;  2K33 A;  4BY7 G;  1JOR A;  1V43 A;  1LV9 A;  2ZTC A;  4DNT B;  3PF5 A;  1SNP A;  4DR1 L;  2CWA A;  2WFW A;  1Z6H A;  2R61 A;  1EY9 A;  2H5X A;  4A3L G;  4DV5 Q;  2KHI A;  2XWB B;  3J81 L;  5CV5 A;  1KXL A;  1VQC A;  3KF6 B;  1WJJ A;  2L15 A;  3E9H A;  3FPP A;  1IHZ A;  1X3P A;  4H7B A;  1NTG A;  1VF7 A;  2K5Q A;  1SNQ A;  3TN2 A;  1TKW B;  2LXJ A;  2PZT A;  3FDT A;  3NWS A;  1WTW A;  2A68 C;  3TQY A;  3CCE A;  1VQ5 A;  1BVS A;  3DA3 A;  3J7Y W;  1BKB A;  4Q5V A;  3IKJ A;  3TME A;  1CKN A;  1A3V A;  2F4I A;  2Z6K C;  1A62 A;  4RG1 A;  4A3B H;  3AFP A;  1NCV A;  3RZO B;  4CJ0 B;  2KHJ A;  4LF5 Q;  3SDJ A;  2E5L Q;  2WII B;  2EYO A;  1X54 A;  3DUZ A;  1X55 A;  2BH2 A;  5IWA Q;  4BY1 B;  3A56 A;  5LMU L;  2A6E C;  3GTP H;  4JYA L;  5ELB A;  4DR2 Q;  4BS9 A;  2VNU D;  3CP0 A;  3S14 H;  3F2U A;  1X3G A;  4JVZ A;  4XYO A;  1OTC A;  2FEF A;  2ICE C;  1HA5 A;  5C0X G;  2A69 D;  1K8G A;  2NVY B;  4DXG A;  2I5L X;  2F3I A;  2I5M X;  1FYC A;  2F1M A;  3D6C A;  2Q2I A;  1VQH A;  2ZTE A;  2ZTD A;  3KLS A;  5E7N A;  4L63 B;  1FGU A;  3A8I E;  1O7Z A;  2PI2 A;  4LF7 L;  5CV7 A;  5KYL A;  4X65 L;  1N32 L;  2EXZ A;  1CZW A;  4NW2 A;  3S1N B;  1Q3L A;  1E1O A;  5AJ3 L;  4KD3 A;  1HNZ Q;  1IBK L;  5FKA C;  2F0U A;  1BCP C;  2R93 B;  4DUZ L;  4DK6 C;  3G4S A;  3H94 A;  5C4J B;  2DGY A;  4GKJ Q;  1I3Q H;  4DR6 L;  2FMC A;  2M2L A;  4DU9 A;  5IP7 G;  1B8A A;  2K5V A;  3E3X A;  2B2V A;  5I6W A;  2ZW3 A;  4R8N A;  5C0X J;  2XWJ B;  2BL8 A;  4A93 H;  1G8Z D;  4OWX B;  4ZK9 B;  4LFC L;  1WI5 A;  2UXB Q;  1JJC B;  5LMN W;  3A8K E;  5C4X G;  3D0F A;  3ULP A;  2F0V A;  2KEN A;  3J7Z C;  1AFP A;  1QZG A;  1HFN A;  2KKM A;  2VUM G;  4EQN A;  1TWC H;  4ZUI A;  1V9P A;  1H9S A;  1PFM A;  3UE0 A;  1DD2 A;  3UIT A;  4HJ7 A;  1G2T A;  1YJW A;  1ESF A;  1GXD C;  2WP8 J;  1LTG D;  1IW7 D;  2ZXR A;  1EY6 A;  2YFB A;  5KEE A;  3J81 i;  4OEM B;  3E5S A;  2IW3 A;  2PCF B;  4A3M G;  2DNC A;  1J5E L;  4A3I H;  1L0Y B;  3Q24 A;  4CHT B;  3M7N A;  1V1P B;  4X66 L;  2E75 C;  3BG3 A;  1STE A;  2HT1 A;  3KDF A;  3NQT A;  4G57 A;  5ELF A;  3J81 c;  3I55 A;  4G7Z C;  2LMC B;  2RVL A;  3NK9 A;  1I4G A;  4A3E G;  2UUA L;  1C48 A;  4WOR A;  1NY4 A;  4RH6 A;  3EVQ A;  2VB3 X;  3DXJ C;  1NMF A;  4A4I A;  1IXR A;  1DOL A;  4C3I B;  3BZC A;  3H0G G;  3HOU B;  4DWL A;  1YI2 A;  2QEJ C;  5EBC A;  5C3W A;  4XQJ A;  3VR6 A;  3SK5 A;  3K7A B;  1N8R C;  1B44 D;  4YWK A;  4HMI A;  4QMG A;  4MZ9 A;  3RMH A;  4QCL A;  2IT1 A;  3KBG A;  1JWU D;  4I1T A;  5EPL A;  5KRU A;  2JA5 G;  5HUR A;  3KF6 A;  3SK8 A;  3RZO H;  3GTK B;  1VQ8 A;  1RF2 D;  2O4X A;  4K5W A;  4QF4 A;  2H4O A;  1L0X B;  5GQO A;  2KVM A;  4BY1 H;  2AHO B;  2K75 A;  1VQ6 A;  4TSS A;  3TP5 A;  1TWH B;  2X69 A;  4FP5 D;  4G7H C;  4FO2 A;  1KL9 A;  3B6Y A;  4L5T A;  3M7G A;  5A2Q L;  4JI0 Q;  1C0A A;  4ZRZ A;  2NVY H;  2LFN A;  4IUR A;  5I2X A;  4LF9 L;  4LUV A;  2RIO A;  4C2M B;  4NXM L;  5IYB G;  3H15 A;  1EYD A;  4IOC A;  4DR4 Q;  1ILP A;  3L9A X;  1PH3 A;  1SMY D;  5COY A;  2Q8R E;  4IUU A;  1IYJ B;  3I7F A;  2JA8 G;  2EY1 A;  3K57 A;  1EY5 A;  3CCR A;  3A8J E;  4IFD G;  5C44 G;  2A5H A;  2A73 B;  3MFG A;  2MUY A;  4RKL A;  2PW7 A;  3S1N H;  2K7V A;  1ICW A;  4A3J H;  3C1F A;  2CW0 D;  2K14 A;  3STB D;  1OXT A;  1SN8 A;  2K03 A;  2Q2U A;  3HOX G;  4DR7 Q;  2WAQ E;  4RCN A;  2R93 H;  5IP9 H;  4C3H B;  3JC6 6;  2MGS A;  4RGO S;  2Q8I B;  1XX8 A;  1PHJ A;  3ITP A;  2CVR A;  3K7U C;  4JI1 Q;  3M4Q A;  4IUP A;  3OW2 A;  4DV7 Q;  3U4V A;  4JI7 Q;  2HDL A;  3UDF A;  2ES2 A;  3CD6 A;  2PI2 E;  3KFU A;  1EWI A;  4R1J A;  4YY3 L;  4QUC A;  4V19 0;  3K5N A;  4OX9 L;  3A55 A;  4LW1 A;  2D0P A;  5G3L D;  3VR4 A;  1DON A;  3OHX C;  4B3M Q;  5JJZ A;  4UDU C;  4HFV A;  1RIP A;  2L5T A;  4IFD J;  1VQM A;  2AUK A;  4PL3 A;  3KOJ A;  4HJA A;  3D4W A;  1WCM G;  1KLU D;  4C3J G;  3ERO A;  2QW7 A;  1YO7 A;  1AW7 A;  2JB2 A;  1TS4 A;  4UHV A;  3CME A;  1K73 C;  1DZ1 A;  3X3N A;  1SE4 A;  2KEC A;  4CJ2 C;  2E2D C;  4LFA Q;  2ASB A;  4TQU S;  4JBK A;  5E3F A;  3AU7 A;  5ELC A;  4DR3 Q;  2PQA B;  4IPG A;  3GTO H;  3I4N B;  1ET6 A;  5L37 A;  3URY A;  1N36 Q;  2Z0S A;  2KUM A;  1HR0 L;  2YYZ A;  3K59 A;  1D6E C;  4CKB A;  5CV9 A;  1EFI D;  1D5M C;  2BH8 A;  1B53 A;  4C3I H;  2KQ3 A;  4YCV A;  1QJO A;  4YHH L;  2RA4 A;  1Z7T A;  5H1S E;  1KIX A;  2HCC A;  2JA6 G;  3HOU H;  1C8C A;  2K28 A;  5FO7 B;  4OXP A;  4B3R L;  4C1N K;  2EJM A;  5IE8 A;  3LGJ A;  1H9K A;  3L0O A;  3Q8D A;  2F4V L;  1XNQ L;  1JQO A;  3S15 B;  5FK9 C;  4IPH A;  3H09 A;  1CTM A;  2UUC Q;  2RHQ B;  4YWL A;  3UDI A;  1RD9 D;  3LWE A;  1EYG A;  3U50 C;  1I4Q A;  3TRZ A;  3PCO B;  4DPG A;  4C56 C;  4APV A;  2OEO A;  3CW2 C;  2KBN A;  1AZP A;  2KCM A;  1O7L A;  4KY5 A;  5DEH A;  2Y0S G;  3F4M A;  1GUN A;  1KNE A;  4DKA C;  2ZM6 L;  2L55 A;  1S5E D;  3NBI A;  3AMU A;  4PZ7 A;  4LF6 L;  1PZK D;  3OMC A;  3MTS A;  1EYC A;  3OSO A;  3PV0 A;  3QO2 A;  4OIJ A;  4RFB A;  1PRT C;  5J3B A;  5JVH 3;  3U9S A;  4J6H A;  4IO9 A;  3HOW G;  4H0L C;  2XIW A;  4MHE A;  1NUC A;  1D8L A;  2L1L B;  1LUZ A;  1YHA A;  5F2D A;  3RUZ A;  1WTQ A;  3EFX D;  4DN4 M;  1ASY A;  4PZ8 A;  5M5X B;  3HKZ B;  5EPK A;  1JWS D;  1MIU A;  2ATW A;  2EYP A;  2F3V A;  1YNJ C;  1W3S A;  1LTS D;  2A2D A;  2G5D A;  4JBW A;  3KJP A;  1S5D D;  1IBL Q;  1RKN A;  3FKI B;  1BOS A;  4ULL A;  1D1K A;  1EUJ A;  1SJH D;  1SMX A;  4KHP L;  4DV1 L;  2B3G A;  5C6A A;  1OXV A;  3K0X A;  2F52 A;  2UXD L;  5T1G A;  4C3H H;  1CQF A;  5BR8 L;  2EYM A;  2OCE A;  2YV5 A;  1ZYR C;  3AEV A;  3RN5 A;  3NPP A;  4PMW A;  2UXC L;  3S16 B;  1D5Z C;  1PXU A;  5ELE A;  2B8F A;  3AQQ A;  3U9O A;  4C1N I;  5FLX L;  4U67 3;  5DLQ E;  5K5P A;  2E2I H;  4DUY L;  3HOZ B;  3HOV B;  4JPB W;  1MGS A;  4WJ3 M;  4AS3 A;  5D3D A;  2HD3 A;  4X3K A;  3BJU A;  1E24 A;  3F2B A;  2VB2 X;  3VA9 A;  3N6R A;  1Y1W B;  3I9V 1;  5DAU A;  3W2D A;  2F0T A;  4DR1 Q;  4BY7 H;  2F0P A;  4PV1 C;  2BL7 A;  3Q23 A;  1CA5 A;  1EIG A;  1UAP A;  1Q7Y C;  5IGD A;  1ESR A;  1PYW D;  3MXG A;  1RHP A;  1BO0 A;  5JEA H;  1CI3 M;  3NUC A;  2M00 A;  4LFB L;  4KN7 C;  1H9J A;  2QZG A;  4MN3 A;  2XVS A;  1TT2 A;  2F0H A;  3I4N H;  3MFY A;  4FXG C;  1I94 L;  3ULJ A;  4GS3 A;  3BDL A;  1U4R A;  3H0G B;  1GUS A;  2DN8 A;  2MJF B;  3TP6 A;  1SDF A;  2RLD A;  1SBB B;  3X3M A;  2F3W A;  4NMZ A;  5AFW A;  2EOT A;  2G9D A;  3T56 B;  4CGY B;  2WAC A;  2WIN B;  3PIP 3;  4GN4 B;  2VQE Q;  2PQA A;  4DV0 L;  2D62 A;  2IP6 A;  3TEH B;  3S15 H;  2F0F A;  3VR5 A;  3OWE B;  5FLM H;  1Y69 U;  4NV5 A;  3NTK A;  3CC2 A;  1GO3 E;  3LJ1 A;  1CKN B;  3SVM A;  2FHT A;  3T4A C;  3TS2 A;  1LTA D;  3A7A B;  4X62 Q;  3R3O A;  4XDX A;  4GLX A;  3RLN A;  2MO1 A;  4ZYS A;  5C3E G;  3Q6S A;  1SND A;  4UAI A;  3E9I A;  3L7Z C;  1VQ9 A;  2MJ8 A;  4YZ9 A;  3LNN A;  3SDZ A;  1X32 A;  2CH4 A;  4KV6 A;  2HHH Q;  2L11 A;  2PNR C;  4BWG B;  1P8L A;  3TP7 A;  4R9W A;  4X65 Q;  1Y1V G;  3RNU A;  1X65 A;  4POG A;  1IBK Q;  1XPU A;  3LJ2 A;  4DUZ Q;  3IL8 A;  4A3B B;  5M5X H;  4ZAI A;  3GTQ B;  4HJ9 A;  2AUJ D;  4Y7N B;  1GUW A;  2X6L A;  4GN3 B;  3IRB A;  1DYQ A;  1EZ6 A;  1N34 L;  4EGV A;  4IUN A;  2NN6 G;  2EPB A;  3FKI H;  3GTP B;  1K28 A;  1U4P A;  2IX0 A;  4NV2 A;  5M3F G;  3K58 A;  2AWO A;  3S14 B;  3J80 L;  4OON A;  2OT2 A;  3ZYY X;  1HNW Q;  3RD4 A;  2A19 A;  1YIJ A;  2PPB C;  2RDH A;  3PGZ A;  2F0S A;  1QE6 A;  3NEL A;  4KJN A;  5FLX c;  4AYB G;  4I7Z C;  4XQQ A;  4N8F A;  3HOV H;  2VUM H;  5CMD A;  3PUW A;  1DOK A;  2N78 A;  3NTH A;  4KHV A;  5HGQ A;  4G7O C;  4CDE C;  3KLR A;  1VQD A;  4AS2 A;  5FO8 B;  3RR5 A;  3WOE A;  1Y1W H;  1YNN C;  4EQO A;  1J5E Q;  4DV4 L;  2EYF A;  4LMQ D;  1TS2 A;  2OF1 A;  4H02 A;  3J7A V;  4JW0 A;  2B2Y A;  2KCN A;  4TRD A;  2UUA Q;  1KRT A;  1I3Q B;  3FHW A;  3A74 A;  2K5H A;  1KC8 C;  1Z47 A;  4DAP A;  2ZJP A;  3HOY G;  4HED A;  5BN5 A;  5DM6 3;  2E2H B;  3HS0 C;  4P2C B;  1CA6 A;  1DXM A;  1LT3 D;  4KY7 A;  4Z7H A;  3CC7 A;  3RZD H;  3PIO 3;  5T1I A;  1TWA H;  3JAM L;  3OIQ A;  3H0G H;  4BBR G;  2N49 A;  4A3G G;  5FJ8 G;  3W1G A;  1VQA A;  1WTH A;  3FBV A;  4AIM A;  3KDF B;  2AQ2 B;  1WD1 A;  2HGK A;  4G75 A;  1ENA A;  3OW7 A;  3CF5 A;  4ZQ3 A;  4CDD C;  2NVQ B;  1Q86 C;  3AB9 A;  2JA5 H;  4RMF A;  4RCO A;  1VQF A;  4PMB A;  4A3D B;  3CCJ A;  4P72 A;  4JI5 L;  3QG1 A;  5ELO A;  5FO9 B;  4UPA A;  4A3I B;  4P75 A;  5GAG C;  3KLS X;  1EFW A;  5IT9 E;  2IL8 A;  4LF9 Q;  4HCE A;  5IGC A;  1MSG A;  2NB0 A;  2XRQ D;  3A54 A;  1Q12 A;  2FMM A;  2KEE A;  2EY6 A;  1I4R A;  3HOW B;  3BU2 A;  1YEZ A;  5IYB H;  1MD2 D;  1L1O A;  1TY0 A;  1EOT A;  3S24 A;  5G3L F;  1I6H H;  4FDB A;  2WV6 D;  5I6Y A;  3GP7 A;  5EPJ A;  2WKD A;  2NBF A;  1SR3 A;  5LL6 X;  2K5W A;  2AQ3 B;  2A6H D;  3GTQ H;  4HAE A;  3SR1 A;  4KKS A;  2C5C A;  3J80 i;  3WDN A;  2Q8T A;  4Y7N H;  1K8O A;  2G9H D;  2VW9 A;  3QB3 A;  3GQB A;  4V0B A;  1BBU A;  1IKM A;  2VQF L;  3EQL C;  4YCW A;  2EYJ A;  3J80 c;  5GAD C;  4A3C H;  1BF4 A;  1XWE A;  4GKK L;  4OX9 Q;  2WB1 B;  1PTO D;  4XT1 B;  2O5J C;  1S5B D;  1WTP A;  1HCZ A;  2JN4 A;  3DM3 A;  3H3V H;  5EQ0 A;  1TVX A;  1F77 A;  2PYK A;  2XRS D;  3CKI B;  3M4Y A;  1EY0 A;  3DWA A;  2ENB A;  2V4D A;  2A69 C;  1UWV A;  3CCM A;  2PW5 A;  4F7X A;  3BYT B;  4Y52 H;  5KND A;  4FF3 A;  4BBS G;  1KAB A;  3FVQ A;  3V2T A;  2IWH A;  1ZXT A;  1FNW A;  1KD1 C;  4A3J B;  4LF8 L;  1V8Q A;  1TII D;  3G7L A;  1J6Q A;  5M3M B;  1CKM A;  3OOC A;  3FEW X;  2BDN A;  1XMQ Q;  1H95 A;  3K5M A;  1J9O A;  5C4Z A;  4B3S L;  1EZ8 A;  4DV3 Q;  2D0O A;  3ER0 A;  3JAM i;  4DV2 Q;  4LK1 C;  4YHH Q;  4K8I A;  2E2H H;  2JA7 G;  5CBE E;  2LSS A;  1A0I A;  2I46 A;  3JAM c;  1BR9 A;  4B3R Q;  1CQV A;  3HG9 A;  5IGF A;  1Y8P B;  4DFA A;  2F4V Q;  1SXT A;  2FUG 1;  2JA6 H;  2NWG A;  3EIV A;  5BN3 A;  2F0W A;  1UEA B;  2PQE A;  2IHF A;  1DM0 B;  2RKS A;  4JV5 L;  1MBY A;  1YIT A;  2F0O A;  3CRK C;  2NVQ H;  3PO3 B;  1OXU A;  1JT8 A;  4Z7G A;  1AEX A;  4GNX B;  2N88 A;  2EIF A;  1XTD A;  2ZM6 Q;  3CC4 A;  4A3D H;  1PYB A;  1XNR L;  1VQE A;  4LF6 Q;  1IW7 C;  5EGT A;  3T1H L;  1EOV A;  4A3F B;  2KHS A;  3GTO B;  3A5U A;  1S72 A;  3M85 A;  2Z6B A;  3S9W A;  1B4O A;  1UE7 A;  4OO1 H;  4CJ1 B;  1IBM L;  1EL0 A;  4ME5 A;  1WTO A;  4HEA 1;  3BVM A;  1D7Q A;  1E0B A;  3HOW H;  3I91 A;  4RKB A;  4AQY L;  2FU2 A;  1LT6 D;  1VQB A;  3LJ0 A;  4KK7 A;  5HGT A;  5IYD H;  5J1Z A;  1EIY B;  2EE1 A;  2UU9 L;  5LMN L;  4P71 A;  1I50 B;  1DGS A;  2ALY B;  2JQO A;  4LF4 Q;  1K8M A;  3I8Z A;  2UXD Q;  4K0K L;  1UEB A;  4A3K B;  5LNK 1;  1XMO Q;  4HIO A;  4M8A A;  1YHQ A;  1E1T A;  1LTL A;  1FL0 A;  2NVX B;  3GD7 A;  1YJN A;  3A7L A;  4DAY A;  2UXC Q;  5CV6 A;  1KRS A;  1V1Q A;  2GSC A;  2JB1 A;  1PZJ D;  1I4H A;  2NZO A;  2RAD A;  1KNA A;  4JOI C;  3J81 E;  2R7Z G;  1GJX A;  3TZD A;  1TY2 A;  2Z8L A;  4NXN L;  1LT4 D;  4LJZ C;  1PFS A;  3CCV A;  4IZ8 A;  1PH1 A;  4IJH A;  1VQP A;  2EY5 A;  3DLL A;  3NXW A;  3P23 A;  1QOH A;  1X3Q A;  2DY8 A;  2FFK B;  1RTN A;  2R92 B;  1E7Z A;  1SRU A;  3I4M G;  1A63 A;  2JEB I;  1B7Y B;  1N9W A;  4GOP A;  2F0N A;  2YU9 B;  5C5M A;  2O5I C;  3GTL H;  1HNX Q;  1QIL A;  1TS3 A;  4IJL A;  3CMA A;  1GM5 A;  2JK8 A;  1Q8I A;  2P22 B;  4DAV A;  3HRZ C;  3B55 A;  3SHL A;  2F0I A;  2DJG C;  1SMY C;  1Y8N B;  4DAM A;  2HQE A;  5M3M H;  3NEM A;  5LHY 1;  1U4L A;  4DV5 L;  2M9V A;  4S3S A;  1PH9 A;  2RBM A;  3RLO A;  4F8M A;  2IX1 A;  2CW0 C;  2RHS B;  3STB C;  1TWF H;  1HUN A;  1EQQ A;  1L1O C;  5KYI A;  1VQJ A;  1W6K A;  3PSI A;  2WAQ G;  2XGT A;  4DXF A;  4E6I A;  3R93 A;  4IN3 A;  2E2I B;  1SAP A;  2F0E A;  1Y14 B;  4K2K A;  4KD4 A;  1H9R A;  2EJF C;  3HKS A;  3CCL A;  4O2D A;  1YHB A;  4NDX A;  1HZB A;  1JOO A;  4IPD A;  4RGM A;  4PL4 A;  3DMU A;  4BY7 B;  2BOS A;  2HUG A;  1HTP A;  2B2U A;  1Q81 C;  4GXT A;  1UNS A;  5IWA L;  4J8Q A;  3PO3 H;  1PYS B;  3ERQ A;  2UUB Q;  1PH5 A;  3FNB A;  3CCQ A;  3U58 A;  4DR2 L;  1M4V A;  4IPC A;  4UP9 A;  1A8V A;  2BCO A;  4L5R C;  4OEL B;  2NYZ D;  3OMG A;  2DNE A;  1PTO B;  3E0J A;  1G6P A;  5I2Y A;  3G71 A;  4A3F H;  3DWQ A;  3I90 A;  4O42 A;  4HTH A;  4UP7 A;  1MSH A;  1AE3 A;  2N3S A;  3LWU A;  2MPM A;  1G91 A;  1JJ2 A;  4OL7 A;  3GDE A;  5GAH C;  4DR5 Q;  2ZXO A;  4GNX A;  2RDF A;  3NEN A;  1H9M A;  1JQY D;  2QSB A;  3H3V C;  4X64 L;  2CQO A;  1G51 A;  2E76 C;  5ELD A;  4PMC A;  1JE4 A;  3VYU A;  1N34 Q;  3S2D B;  2X6G A;  1QG7 A;  3SK6 A;  1XTC D;  1I50 H;  4X3T A;  4JI6 L;  2OTJ A;  1SJE D;  3MC0 B;  5LL6 S;  1QNU A;  1YNX A;  1FJG Q;  4RA8 A;  4A93 G;  2B2V C;  4QGU A;  5M5Y H;  4A3K H;  1X3F A;  2NN6 H;  1QZH A;  4G4K A;  1B9N A;  2NVX H;  3IFD A;  3IAM 1;  1SJ8 A;  4YIJ A;  3E0E A;  4XT3 B;  3DM1 A;  3VYT A;  1EY7 A;  1XJV A;  4EVO A;  1LO5 D;  2CWP A;  1STG A;  3A5Z B;  3NP8 A;  5I9O A;  4R4T A;  2JSO A;  2EJG C;  5EAY A;  1U5K A;  5JPM C;  2MP1 A;  1CUK A;  4DV4 Q;  4CKE A;  2R92 H;  2B29 A;  3BYY B;  2GVB A;  2YTY A;  1PFB A;  2YU9 H;  3H91 A;  2LY7 A;  3PO2 G;  3DEO A;  4R8I A;  4RGT A;  4XIG S;  2RCN A;  2CFM A;  4JG2 A;  4JI3 Q;  1GHJ A;  4OGQ C;  1IYU A;  2JA9 A;  1RL2 A;  1XPO A;  1HTL D;  2RCF A;  3NTI A;  3QOJ A;  4DF7 A;  3L2P A;  4IUT A;  1UE5 A;  3MA2 B;  2B2T A;  1V1O A;  4JI8 L;  4QL5 A;  4KKT A;  1E2V A;  4L8J A;  3P20 A;  5A2Q E;  1X6O A;  4PL5 A;  5C4X B;  4BBR H;  2I07 B;  4A3G H;  5FJ8 H;  1YVC A;  3R2I A;  1L2F A;  3V96 A;  2WB1 E;  4TKO B;  3I3C A;  2VUM B;  1FNV A;  3J7A F;  2RF4 A;  3WOF A;  5ISR A;  2B39 A;  4RHS A;  4BY1 G;  3JSB A;  4JI4 L;  4JBM A;  3VYS A;  3VR3 A;  1TWG H;  2F6M B;  1OXS C;  1K83 B;  1JB7 A;  1NMG A;  1WOC A;  1S4Z A;  5EKL A;  4IUV A;  1LLR D;  4A3M B;  2IHE A;  2V6E A;  2XMX A;  1N33 L;  2JYO A;  4L5S A;  3K81 C;  1HFG A;  1KHI A;  4A3L H;  4FXD A;  2PNH A;  2IX3 A;  3VR2 A;  4M1U B;  4A3E B;  1PTO H;  1F9P A;  1PTO F;  2QGM A;  3RZD B;  3K80 C;  1TWA B;  2HDM A;  3R8B A;  3PUZ A;  4RWS C;  2DUD A;  2K1B A;  1GHK A;  4DK1 A;  1EIF A;  2MQH A;  2CH4 W;  4GLA C;  3OTO L;  2F0M A;  2KCT A;  4ABN A;  2XN9 C;  2R93 G;  1C4Q A;  2FXQ A;  1LTI D;  1SRO A;  1LAC A;  4N8X 1;  3I4O A;  5LMU Q;  4OAU C;  3SXH A;  2JXM B;  5IT9 L;  3S2D H;  2JA5 B;  3MEH A;  4JYA Q;  2QGQ A;  3F2C A;  4DR7 L;  5K36 G;  2F0L A;  1ASZ A;  2DJF C;  1L1O B;  3M9B A;  1SSO A;  1GUT A;  2K6A A;  3PUV A;  3ULL A;  3FPU B;  4JI1 L;  2V1C C;  3KUP A;  3CU7 A;  1PVO A;  2QEX A;  2OWO A;  1JOQ A;  5IY0 A;  4QJF A;  3KLW A;  2D5D A;  4OAV B;  5C0X H;  3BDC A;  2A74 C;  1JJG A;  1BCP F;  1EY8 A;  2K04 A;  3S17 B;  1K3B C;  4LF7 Q;  1QUQ A;  1B50 A;  1N32 Q;  2B2U C;  2J7Z A;  1D1I A;  5COR A;  1JMC A;  1I6H B;  1FVI A;  2HCI A;  3I70 A;  4PQX A;  4MTN A;  5AJ3 Q;  2JA8 B;  3ICE A;  3FP9 A;  1F2Z A;  2ICI A;  1PZI D;  1K9M C;  1HUM A;  5C44 B;  1F2L A;  2C35 B;  4DR6 Q;  3T53 B;  4B3S Q;  3A0J A;  3T13 A;  3HOX B;  4LFA L;  3ERS X;  4FVM A;  3P7J A;  4CKC A;  2MNA A;  5E4W C;  4LFC Q;  5C3X A;  2QCP X;  2A1A A;  1GUO A;  1N36 L;  5IP7 H;  1A6X A;  3HOU G;  4GNX C;  2JP1 A;  1GOZ A;  3ONA B;  1EQR A;  2WKC A;  4DA2 A;  2JBW A;  2OXP A;  1TR5 A;  4QB4 A;  3GTG B;  1VMC A;  4JV5 Q;  1JWM D;  5C4X H;  3EA6 A;  3DWP A;  1I6V C;  3I2Z A;  1W2B A;  3D4D A;  2I5H A;  1IKL A;  1NNX A;  1CFM A;  1EWC A;  3KYH C;  5CBA E;  5I4D A;  1WCM B;  4C3J B;  1U4M A;  4QUF A;  4K2L A;  1EQT A;  4P73 A;  1K83 H;  4FF4 A;  4HN7 A;  4X66 Q;  2CKZ B;  2YFA A;  3MVV A;  1AE2 A;  5IIF A;  5EKI A;  5GRO A;  4A3M H;  1STB A;  3P1H A;  1IL2 A;  4JK1 C;  4J1M A;  1TQO A;  4XTC S;  2VL6 A;  1ET9 A;  1B9M A;  4AQY Q;  4A3E H;  4MIU A;  4XQN A;  3BVG A;  5GAE C;  3SK4 A;  2QDL A;  1JOK A;  2N8N A;  1BUV T;  5FLX E;  1PH4 A;  2I0Q A;  1R9T B;  3W5O A;  4IAL A;  2JA6 B;  4GN5 A;  2NZH A;  3Q0A A;  2R3Z A;  5M9O A;  1SNC A;  1SYB A;  2C9O A;  3U4Z A;  1D2B A;  2MO0 A;  1T5E A;  3CCS A;  2N55 A;  3KJO A;  1RDP D;  4C3H G;  1HPC A;  3F2D A;  4A76 A;  4OWW B;  1RJT A;  2F03 A;  2BE5 D;  1VQ4 A;  1B70 B;  1TDP A;  2JB3 A;  4NPS A;  3QJY A;  3AFQ A;  3IFT A;  2B2W A;  1NJI C;  2NUC A;  3VA5 A;  2EZV A;  4B9X A;  2F0K A;  4YZD A;  1B1Z A;  1K0S A;  3TDQ A;  3HFZ B;  1Y8O B;  2R7Z H;  2Y0S B;  4O1P A;  2O2L D;  1HRJ A;  3EJI A;  2JE6 I;  3CXC A;  4NXM Q;  1JE5 A;  1W6J A;  2L12 A;  1AN8 A;  1HZC A;  1P16 A;  1SYE A;  4DAY B;  3I4M H;  2Q2T A;  3S17 H;  1LAB A;  4KLK A;  1OO9 B;  1LTB D;  2JAE A;  1S40 A;  1QCB D;  3PO2 B;  3D6W A;  3TS0 A;  2R6G A;  5JEA G;  2Q2H A;  4H44 C;  5EBD A;  5HY6 A;  1BBW A;  3C46 A;  2JA8 H;  3BVZ A;  3Q22 A;  1G6Z A;  1F2Y A;  4MTK A;  5TSS A;  1JR0 D;  1VQI A;  3QWN A;  4IFD H;  3CQZ B;  5C44 H;  3I4N G;  3J81 j;  2B63 G;  4R4C A;  2A68 D;  4O1N A;  2OQK A;  4GOP B;  3HOX H;  1CZG A;  2K5N A;  2A6H C;  3NHH A;  2KED A;  4XYQ A;  3S1M B;  4FXK C;  1PH2 A;  4HID A;  2EY2 A;  4YY3 Q;  2GN5 A;  1Q1E A;  1NAP A;  4GLV B;  1L0W A;  3SEB A;  3BZD B;  3TZU A;  3VA7 A;  5M5W B;  2SNM A;  1PH6 A;  1WYD A;  1UE6 A;  4PNY A;  1SYD A;  2FIN B;  1A3U A;  2K01 A;  2KA7 A;  4IUQ A;  5C4H A;  2RSO A;  1B3Q A;  2A6E D;  2Z4I A;  1VCI A;  1VQG A;  4B9W A;  1PTO C;  2NVT H;  3GTG H;  1GVP A;  2L0C A;  5JEA J;  4JI2 L;  2IY5 B;  2DY7 A;  1E22 A;  3GTL B;  1PFN A;  1LTT D;  1C9O A;  5FLM G;  2VQE L;  4IQZ A;  4HSV A;  2NTT A;  2LKV A;  3O13 A;  2OTL A;  4LUZ A;  1WCM H;  2RQX A;  4C3J H;  3PMF A;  4L6T B;  2BA1 A;  4ZKC B;  3OIP A;  1NBW A;  1MKH A;  2NTS A;  2LXK A;  2Z9H A;  1B3A A;  3NBH A;  4X62 L;  2R7D A;  4LAA A;  3HKZ E;  3J80 E;  1K3R A;  4KTA A;  4B3T L;  1HR0 Q;  4H13 C;  4R4Q A;  2E2J B;  1TWF B;  3K5L A;  1VQ7 A;  3MZ5 A;  4KY6 A;  1KAA A;  4EQ5 A;  4CBV A;  2Z1C A;  4JCV E;  2HHH L;  3R2T A;  4F88 A;  4I7A A;  3G6J B;  4X64 Q;  3UDX A;  1BCP D;  3HKZ G;  3CPW A;  4KKU A;  5HGI A;  2TSS A;  1I4P A;  3K5O A;  4PZ6 A;  3MHB A;  3FMC A;  1R9T H;  1SYC A;  4JI6 Q;  1XNQ Q;  1E3P A;  3FKI G;  5IYC G;  1JCK B;  2H1E A;  3C3L A;  4ALP A;  4UY8 C;  1EEI D;  4CDF C;  4L5Q A;  2BDO A;  2KJX A;  1T9H A;  4Q0F A;  2AMC B;  1WTR A;  1LTR D;  1PRT F;  3I56 A;  4XXE A;  1STN A;  2EQS A;  3AYH B;  2XTI A;  3S1R H;  5ELN A;  1VQL A;  1ML0 D;  2QDB A;  1HNW L;  1CKO A;  3BS1 A;  1OXX K;  1SYF A;  2EVB A;  4EX5 A;  4BXX G;  1ENF A;  1NR2 A;  3HOZ G;  2D9U A;  1ZEQ X;  5C3E B;  3HOV G;  4R4O A;  4DGZ A;  2GVA A;  3MXN A;  2A2C A;  1IL8 A;  1FGB D;  1PA6 A;  1KDA A;  1Y1W G;  3JAM E;  2K32 A;  4IFD I;  3CCU A;  3GTJ B;  1PLF A;  1Y1V B;  5I9P A;  2Z4H A;  2P5Z X;  3GV6 A;  1Q82 C;  5JJL A;  3PO2 H;  3OYY A;  1M8A A;  2B2Y C;  4X6A H;  4OIK A;  3EN2 A;  4O1O A;  3PIP A;  4ILW A;  4KHP Q;  4DV1 Q;  1WFQ A;  4J15 A;  3D4R A;  4HJ5 A;  5IOC A;  3CQZ H;  1SFO B;  1IZ6 A;  5M5Y B;  5BR8 Q;  1KQS A;  3H3V I;  2MHV A;  4JI8 Q;  5M3F B;  2F66 B;  3MEF A;  4N9P A;  3M3Y B;  3MAQ A;  4DNR B;  4ODG A;  2ZRR A;  5CV4 A;  3S1M H;  1O7Y A;  1QNK A;  4AH6 A;  4F87 A;  2ZXP A;  1T5X D;  1Q8K A;  1EEF D;  4DUY Q;  5M5W H;  1CT1 D;  2JJQ A;  3KK7 A;  1AP0 A;  4JI4 Q;  3T1Y L;  2PZW A;  3MWY W;  2XNA C;  4FYD A;  4AYB B;  3RN2 A;  4I65 A;  1PDQ A;  4DV6 L;  4BA2 I;  2AQ1 B;  4QIW B;  4WJ4 A;  2B2W C;  3MXP A;  1FR3 A;  4WJW A;  5E4X A;  2ZJR A;  2K50 A;  5IOD A;  3UI2 A;  1N33 Q;  3DO9 A;  4LFB Q;  2PMZ B;  4ZUJ A;  1MHW C;  4HIK A;  1TS5 A;  4HR7 B;  3TSS A;  1WD0 A;  5E1F A;  1PH7 A;  2ZT9 C;  1I94 Q;  2ZJQ A;  4LWC A;  1K8A C;  1X9N A;  2KCC A;  4GZY C;  3FVV A;  1ENC A;  5DNF A;  3HOY B;  4P74 A;  2E2J H;  3HP3 A;  2OQ0 A;  3I73 A;  2F0G A;  4ZCK A;  5J39 A;  3OTO Q;  2EYH A;  2XSC A;  3RLF A;  1GD7 A;  2MFI A;  1CSQ A;  1U0L A;  4A3B G;  3OWF A;  3HEJ A;  4BBR B;  4RHR A;  4A3G B;  2HIX A;  1EU4 A;  4K5V A;  4DV0 Q;  1MJE A;  1X3E A;  4JBJ A;  4U68 A;  1UUP A;  2BA0 A;  5C4J H;  4X3U A;  3NQI A;  1HR0 W;  1SE8 A;  1VQK A;  5JPN C;  4LF5 L;  1TWG B;  4LNQ A;  2E5L L;  3FRP B;  4A3C G;  1NR4 A;  4FF1 A;  5BN4 A;  1F9Q A;  5CGK A;  5CR3 A;  2VXW A;  5K36 H;  4K8J A;  3L3O C;  3D8G A;  1TXY A;  1YJ9 A;  4OO1 I;  5FOB B;  3ND8 A;  1HZ9 A;  3QIA A;  5JVG 3;  1SYG A;  2E74 C;  4CDC C;  1A2U A;  4R4I A;  1BXT A;  1O78 A;  1X56 A;  2VY3 A;  5C3E H;  1E2Z A;  2IJ0 A;  3PIO A;  3PUY A;  1M1K C;  3GTJ H;  2ID0 A;  2HIV A;  5DM7 3;  1Y1V H;  1ILQ A;  4JC0 A;  4DK3 C;  5A35 A;  1EU3 A;  3GV3 A;  1VDZ A;  3M4O B;  1HQM C;  2FJ2 A;  1KTK A;  2B63 B;  4ZLT F;  1VQO A;  3K6O A;  1HNZ L;  2XTQ A;  1FNU A;  3D3R A;  1XMQ L;  4NP5 A;  1QUQ B;  1CK1 A;  1NE3 A;  1SFO H;  4GKJ L;  1ONL A;  3T16 A;  4A75 A;  2GA4 B;  4DV3 L;  4DV2 L;  1EIH A;  5M3F H;  4EQP A;  4K14 A;  3MXU A;  1HHV A;  3M3Y H;  2CQA A;  2QF7 A;  3SGI A;  2UXB L;  1V1P A;  3K7A H;  1STH A;  1BCP B;  3GTM B;  1BBX C;  2L9H A;  3CRL C;  5C5L A;  4K6D A;  4N9T A;  2F0J A;  4B08 A;  4RAU C;  1F2M A;  1UE1 A;  2YTV A;  2Y0S E;  3H6M A;  3GTK H;  1SLJ A;  2J0T D;  3TP8 A;  1E2W A;  4A3D G;  1EWH A;  1STY A;  1JIC A;  1M90 C;  5NUC A;  4A3I G;  1KDB A;  4BBS B;  1MI2 A;  1WVL A;  1WTX A;  3I72 A;  3T51 B;  3P75 A;  1PRT D;  1TWH H;  2RDG A;  5JOB A;  2A8V A;  1EQV A;  4OO1 G;  1DJR D;  4QY7 A;  4YCU A;  3K8A A;  2L4N A;  2SNS A;  3G48 A;  1F9R A;  1EY4 A;  4FF2 A;  4NB3 A;  4O0A A;  2VS1 A;  2RSN A;  4KJO A;  4C2M H;  1HA6 A;  3HOY H;  3DA4 A;  1ROD A;  4BA1 I;  2JA7 B;  4HMJ A;  1DCZ A;  5IYD G;  1QVC A;  1YNJ D;  4HSP A;  4ME3 A;  1XYI A;  4OHJ A;  2ETD A;  3KP9 A;  3PUX A;  3KBX A;  2QA4 A;  1KDC A;  1LT5 D;  1RCV D;  3ND9 A;  3VYR A;  4HIM A;  3BZK A;  3UDG A;  5EKK A;  3DEP A; 
#chains in the Genus database with same CATH homology
 2K14 A;  1KD1 C;  3STB D;  1OXT A;  1SN8 A;  2Q2U A;  4LF4 L;  4LF8 L;  3HOX G;  4DR7 Q;  1J6Q A;  2WAQ E;  1CKM A;  4JI5 Q;  4P73 A;  1K83 H;  4MNO A;  2R93 H;  4X66 Q;  4HJ8 A;  1XMO L;  1XMQ Q;  5IP9 H;  1PV4 A;  2CKZ B;  1GKH A;  3JC6 6;  2YFA A;  1AE2 A;  1H95 A;  2WB1 G;  5GRO A;  4A3M H;  1CSP A;  3D31 A;  3K7U C;  1PHJ A;  1IL2 A;  4B3S L;  4DV3 Q;  2D0O A;  3ER0 A;  4JI1 Q;  3JAM i;  3M4Q A;  4DV2 Q;  3OW2 A;  5JJI A;  4DV7 Q;  4XTC S;  3U4V A;  4YHH Q;  4JI7 Q;  3UDF A;  2ES2 A;  2VL6 A;  2E2H H;  2PI2 E;  2JA7 G;  1EWI A;  3CD6 A;  4R1J A;  3KFU A;  4YY3 L;  2LSS A;  1A0I A;  4AQY Q;  4A3E H;  4OX9 L;  4UP8 A;  3JAM c;  4B3R Q;  4LW1 A;  5GAE C;  1Q1B A;  2D0P A;  2K52 A;  4GOP C;  4JI0 L;  4B3M Q;  2F4V Q;  2N8N A;  3CPF A;  1PH4 A;  3PF4 A;  2FUG 1;  2I0Q A;  3EIV A;  2JA6 H;  4HFV A;  3GO5 A;  1RIP A;  2CAZ B;  3W5O A;  2EXD A;  4IFD J;  4GN5 A;  2NZH A;  1VQM A;  2IHF A;  4PL3 A;  3KOJ A;  4HJA A;  4DR4 L;  1WCM G;  1HNX L;  4JV5 L;  4YZC A;  4A3J G;  1YIT A;  3KF8 B;  3U4Z A;  4POF A;  5M3M G;  1YO7 A;  2NN6 I;  2Z6K A;  2NVQ H;  2JB2 A;  3CME A;  1K73 C;  2MO0 A;  1OXU A;  3CCS A;  3KJO A;  3F2D A;  1G29 1;  4A76 A;  4Z7G A;  1JT8 A;  4OWW B;  1MJC A;  4GNX B;  5IP9 G;  2EIF A;  3M4O H;  1XTD A;  4LFA Q;  2ZM6 Q;  3CC4 A;  2ASB A;  4TQU S;  1VQ4 A;  1B70 B;  2VQF Q;  4A3D H;  4JBK A;  2JB3 A;  4NPS A;  1PYB A;  3AFQ A;  1XNR L;  1VQE A;  4LF6 Q;  4DR3 Q;  1NJI C;  2B63 H;  2PQA B;  4IPG A;  3GTO H;  3M4P A;  4YZD A;  3T1H L;  1EOV A;  4GKK Q;  1N36 Q;  2Z0S A;  3A5U A;  3HFZ B;  2K4K A;  2AKW B;  2R7Z H;  1S72 A;  3M85 A;  1HR0 L;  4O1P A;  2YYZ A;  1UE7 A;  3UE1 A;  3G6E A;  1IBM L;  4NXM Q;  2BH8 A;  2JE6 I;  3CXC A;  4C3I H;  4DV7 L;  4YCV A;  4YHH L;  1JE5 A;  5H1S E;  4JI7 L;  1KIX A;  4HEA 1;  1Q46 A;  4JI2 Q;  2JA6 G;  3HOU H;  1D7Q A;  4DNI A;  1HZC A;  3HOW H;  1P16 A;  4AQY L;  4DAY B;  3I4M H;  4OXP A;  1VQB A;  2Q2T A;  3LJ0 A;  4Q9V A;  3GTM H;  5IE8 A;  4KLK A;  3LGJ A;  1S40 A;  3S17 H;  2JAE A;  3L0O A;  2YTX A;  3PO3 G;  5IYD H;  3Q8D A;  4B3M L;  3TS0 A;  2F4V L;  2R6G A;  1EIY B;  2UU9 L;  5LMN L;  3F1Z A;  2Q2H A;  3L0I A;  3F8T A;  5HY6 A;  4P71 A;  5JEA G;  1BBW A;  1QVF A;  4IPH A;  2K19 A;  1DGS A;  1XPR A;  2JA8 H;  2ALY B;  2JQO A;  4LF4 Q;  1LYL A;  4KI0 A;  4LF8 Q;  2UUC Q;  2RHQ B;  4YWL A;  3UDI A;  1VQI A;  2UXD Q;  4K0K L;  1EYG A;  1UEB A;  3U50 C;  3TRZ A;  5C44 H;  5LNK 1;  3PCO B;  4DPG A;  4HIO A;  1XMO Q;  3J81 j;  3I4N G;  2B63 G;  4BBS H;  1YHQ A;  1E1T A;  1LTL A;  4R4C A;  2UUB L;  1FL0 A;  4A3F G;  3GD7 A;  4APV A;  4G76 A;  1YJN A;  4B3T Q;  3CW2 C;  2KBN A;  2UXC Q;  2OQK A;  4GOP B;  1KRS A;  3HOX H;  2KCM A;  1V1Q A;  2Y0S G;  2JB1 A;  3F4M A;  2K5N A;  2NZO A;  4JOI C;  4DKA C;  1XNQ L;  4U6R A;  2ZM6 L;  1HZA A;  2R7Z G;  4PZ7 A;  1PH2 A;  4LF6 L;  4DR3 L;  3IAS 1;  4NXN L;  4HID A;  4YY3 Q;  2GN5 A;  1Q1E A;  3PV0 A;  1PFS A;  4GLV B;  1L0W A;  3CCV A;  2CCZ A;  1PH6 A;  1PH1 A;  2JEA I;  4IJH A;  5J3B A;  1WYD A;  1VQP A;  3DLL A;  4QQB X;  1UE6 A;  1Z9F A;  4IO9 A;  3P23 A;  3HOW G;  2JA7 H;  1E7Z A;  1SRU A;  3I4M G;  1A63 A;  2JEB I;  1B7Y B;  1YHA A;  1D8L A;  2L1L B;  1LUZ A;  1N9W A;  1VQG A;  1VCI A;  4DR5 L;  4GOP A;  2NVT H;  3GTG H;  3EBE A;  1GVP A;  1ASY A;  4PZ8 A;  3GTL H;  5JEA J;  4JI2 L;  1HNX Q;  2IY5 B;  1E22 A;  1YBY A;  1MIU A;  3NBH B;  4IJL A;  3TRE A;  1C9O A;  2ATW A;  5FLM G;  2VQE L;  3CMA A;  1GM5 A;  2JK8 A;  3CAM A;  2P22 B;  4A3K G;  5IYC H;  1W3S A;  2A2D A;  4JBW A;  3KJP A;  1IBL Q;  2OTL A;  4LUZ A;  1YZ6 A;  1WCM H;  4C3J H;  1EUJ A;  1SMX A;  1FJG L;  4KHP L;  4DAM A;  4DV1 L;  5M3M H;  2BA1 A;  2B3G A;  3NEM A;  1OXV A;  3K0X A;  1NBW A;  1MKH A;  4AYB E;  4DV5 L;  1HH2 P;  2UUC L;  1XNR Q;  2F52 A;  2LXK A;  3S1Q H;  2UXD L;  1PH9 A;  4C3H H;  2R7F A;  3T1H Q;  5BR8 L;  2HQL A;  4TVA B;  2OCE A;  3RLO A;  1K0R A;  4X62 L;  4IOA A;  2R7D A;  2IX1 A;  2YV5 A;  2RHS B;  3HKZ E;  4QIW E;  3STB C;  1QVG A;  3RN5 A;  1K3R A;  1TWF H;  4PMW A;  1EQQ A;  1HR0 Q;  4R4Q A;  3VDY A;  4B3T L;  2UXC L;  1L1O C;  1C7Y A;  1VQJ A;  1IBM Q;  4BXX H;  1AH9 A;  1VQ7 A;  2R92 G;  3ZJY C;  2PMZ E;  3PSI A;  3HOZ H;  2WAQ G;  2XGT A;  3AQQ A;  4EQ5 A;  4JCV E;  1HJP A;  2E2I H;  2HHH L;  5DLQ E;  1O7I A;  1VS0 A;  4DUY L;  4X64 Q;  3UDX A;  1Y14 B;  3HKZ G;  2XTR A;  3CPW A;  4WJ3 M;  1PH8 A;  4AS3 A;  3F2B A;  5HGI A;  2AWN A;  1E24 A;  3BJU A;  4PZ6 A;  3HKS A;  3VA9 A;  3I9V 1;  4DR1 Q;  1R9T H;  4O2D A;  1YHB A;  3CCL A;  4JI6 Q;  2UU9 Q;  4BY7 H;  5LMN Q;  1E3P A;  1HZB A;  4IPD A;  1XNQ Q;  4PL4 A;  3FKI G;  5IYC G;  1LM0 A;  1KAW A;  4YWM A;  4KHZ A;  4ALP A;  4UY8 C;  1Q7Y C;  1Q81 C;  4K0K Q;  4GXT A;  2VZA A;  5IWA L;  4JI3 L;  3PO3 H;  4L5Q A;  1PYS B;  1T9H A;  2AMC B;  3MXN B;  1PH5 A;  2UUB Q;  3CCQ A;  3U58 A;  1S3O A;  5IT9 c;  4IPC A;  3I56 A;  4DR2 L;  4B3R L;  4LFB L;  1IBL L;  2EQS A;  3AYH B;  4UP9 A;  2XTI A;  1A8V A;  3S1R H;  5ELN A;  1VQL A;  4L5R C;  3AJF A;  1HNW L;  1CKO A;  3I4N H;  1I5F A;  5C0X I;  1OXX K;  1I94 L;  1G6P A;  3G71 A;  4JOI A;  4A3F H;  4NXN Q;  3J7A 5;  4EX5 A;  3ULJ A;  4BXX G;  4GS3 A;  3S2H H;  4PG3 A;  3HOZ G;  4UP7 A;  3HOV G;  2E8G A;  1AE3 A;  2N3S A;  4R4O A;  3T1Y Q;  1VQN A;  2GVA A;  2MJF B;  4OWT B;  3W1B A;  2A2C A;  1JJ2 A;  3GDE A;  4LUO A;  4DV6 Q;  1PA6 A;  1Y1W G;  5JJK A;  5GAH C;  3WWV A;  4IFD I;  3CCU A;  4DR5 Q;  4GNX A;  3NEN A;  4BY7 G;  4GN4 B;  1V43 A;  4X64 L;  2CQO A;  1G51 A;  2ZTC A;  2VQE Q;  2PQA A;  4DV0 L;  1Q82 C;  1N34 Q;  5JJL A;  2D62 A;  2IP6 A;  3PO2 H;  3OYY A;  3PF5 A;  3TEH B;  4X6A H;  4DR1 L;  3S15 H;  2CWA A;  2WFW A;  1I50 H;  3EN2 A;  4JI6 L;  2OTJ A;  4O1O A;  3PIP A;  1YNX A;  1FJG Q;  4KHP Q;  5FLM H;  4DV1 Q;  4A93 G;  1WFQ A;  4J15 A;  4QGU A;  4HJ5 A;  5M5Y H;  4A3K H;  2H5X A;  4NV5 A;  1X3F A;  2KHI A;  3CQZ H;  4DV5 Q;  4LF5 L;  3CC2 A;  1GO3 E;  4A3L G;  1IZ6 A;  3LJ1 A;  1QZH A;  1CKN B;  5BR8 Q;  1KXL A;  3TS2 A;  1VQC A;  2NVX H;  3KF6 B;  4X62 Q;  1WJJ A;  2L15 A;  3IAM 1;  1KQS A;  4JI8 Q;  3E9H A;  3H3V I;  4GLX A;  3RLN A;  1SJ8 A;  2F66 B;  2MO1 A;  3MEF A;  5C3E G;  1NTG A;  3E0E A;  3E9I A;  3L7Z C;  2ZRR A;  2LXJ A;  1VQ9 A;  3S1M H;  4YZ9 A;  4AH6 A;  1XJV A;  2HHH Q;  3TQY A;  1P8L A;  1Q8K A;  4DUY Q;  3CCE A;  1VQ5 A;  1BVS A;  2CWP A;  5M5W H;  3A5Z B;  3DA3 A;  2JJQ A;  4X65 Q;  1BKB A;  1Y1V G;  4R4T A;  5EAY A;  1U5K A;  1CKN A;  4JI4 Q;  1CUK A;  4DV4 Q;  2Z6K C;  1X65 A;  3RNU A;  3T1Y L;  1A62 A;  2R92 H;  2B29 A;  4RG1 A;  1IBK Q;  2GVB A;  2YTY A;  4POG A;  1XPU A;  3AFP A;  4A3B H;  3RN2 A;  3LJ2 A;  4DUZ Q;  4DV6 L;  2KHJ A;  2YU9 H;  4LF5 Q;  3PO2 G;  3SDJ A;  5M5X H;  2E5L Q;  4BA2 I;  4HJ9 A;  1X54 A;  4XIG S;  1X55 A;  2BH2 A;  4WJ4 A;  5IWA Q;  2RCN A;  2CFM A;  4JG2 A;  4JI3 Q;  5LMU L;  3AEV A;  4GN3 B;  3IRB A;  3GTP H;  2ZJR A;  1N34 L;  2K50 A;  2JA9 A;  4JYA L;  1N33 Q;  2NN6 G;  3FKI H;  3DO9 A;  4DR2 Q;  4LFB Q;  2VNU D;  1RL2 A;  3CP0 A;  3S14 H;  2IX0 A;  4NV2 A;  5M3F G;  4HIK A;  2AWO A;  1XPO A;  1X3G A;  4OON A;  1HNW Q;  1OTC A;  2A19 A;  3L2P A;  1YIJ A;  1PH7 A;  1I94 Q;  4LWC A;  1K8A C;  2ZJQ A;  5C0X G;  3PGZ A;  1X9N A;  1K8G A;  4A3J H;  1UE5 A;  2I5L X;  2F3I A;  2I5M X;  4P74 A;  2E2J H;  2OQ0 A;  4JI8 L;  4QL5 A;  2Q2I A;  1VQH A;  2ZTE A;  3NEL A;  1X6O A;  2ZTD A;  5FLX c;  4PL5 A;  5E7N A;  3OTO Q;  1FGU A;  3RLF A;  4BBR H;  4AYB G;  1GD7 A;  2MFI A;  2PI2 A;  1CSQ A;  4A3G H;  5FJ8 H;  1YVC A;  1U0L A;  4LF7 L;  2VUM H;  3HOV H;  4A3B G;  1L2F A;  3PUW A;  2WB1 E;  2N78 A;  2HIX A;  4X65 L;  5HGQ A;  1N32 L;  1VQD A;  2RF4 A;  4AS2 A;  4DV0 Q;  1MJE A;  1X3E A;  4BY1 G;  4JBJ A;  3JSB A;  1E1O A;  3RR5 A;  5AJ3 L;  1Y1W H;  4DV4 L;  1J5E Q;  4JI4 L;  4JBM A;  1HNZ Q;  4H02 A;  2BA0 A;  1IBK L;  5C4J H;  1TWG H;  2F6M B;  1OXS C;  4DUZ L;  1SE8 A;  4DK6 C;  3G4S A;  1JB7 A;  1HR0 W;  1VQK A;  1NMG A;  2E5L L;  1WOC A;  2DGY A;  1I3Q H;  4LNQ A;  4A3C G;  4DR6 L;  4GKJ Q;  2UUA Q;  1KRT A;  5IP7 G;  1B8A A;  2K5V A;  3FHW A;  2IHE A;  2V6E A;  1TXY A;  2XMX A;  3A74 A;  2K5H A;  1YJ9 A;  1KC8 C;  4OO1 I;  5C0X J;  1Z47 A;  2ZJP A;  1HZ9 A;  1N33 L;  4A93 H;  3HOY G;  4OWX B;  4LFC L;  4L5S A;  1WI5 A;  3K81 C;  2UXB Q;  1KHI A;  4A3L H;  2PNH A;  1JJC B;  4Z7H A;  3CC7 A;  4R4I A;  3RZD H;  5LMN W;  5C4X G;  2VY3 A;  1X56 A;  1TWA H;  3D0F A;  3ULP A;  2KEN A;  3J7Z C;  3K80 C;  1QZG A;  3H0G H;  4BBR G;  5C3E H;  2N49 A;  4A3G G;  2KKM A;  5FJ8 G;  3PUZ A;  2VUM G;  2DUD A;  3W1G A;  1VQA A;  1EIF A;  2MQH A;  3FBV A;  1TWC H;  4AIM A;  1V9P A;  3KDF B;  3PUY A;  3PIO A;  1M1K C;  4GLA C;  3GTJ H;  3UE0 A;  2ID0 A;  3OTO L;  4G75 A;  3CF5 A;  3UIT A;  2HIV A;  4HJ7 A;  1YJW A;  1Y1V H;  2KCT A;  2WP8 J;  4JC0 A;  2FXQ A;  4DK3 C;  1Q86 C;  2R93 G;  1SRO A;  2JA5 H;  3I4O A;  2YFB A;  5LMU Q;  4OAU C;  3S2D H;  3J81 i;  4RMF A;  4A3M G;  4JYA Q;  1VQF A;  2QGQ A;  3CCJ A;  3F2C A;  4P72 A;  4JI5 L;  4A3I H;  1J5E L;  3M7N A;  4DR7 L;  1VQO A;  5K36 G;  1HNZ L;  5ELO A;  1ASZ A;  2XTQ A;  4UPA A;  4X66 L;  1XMQ L;  4P75 A;  2HT1 A;  1L1O B;  3KDF A;  3M9B A;  1QUQ B;  3J81 c;  3I55 A;  5GAG C;  1EFW A;  1NE3 A;  1SFO H;  4GKJ L;  3PUV A;  4A3E G;  2UUA L;  4LF9 Q;  3ULL A;  1NY4 A;  4DV3 L;  4A75 A;  4JI1 L;  4A4I A;  4DV2 L;  1NMF A;  1IXR A;  2V1C C;  5M3F H;  1PVO A;  1Q12 A;  2QEX A;  3M3Y H;  2OWO A;  3BZC A;  3H0G G;  5IY0 A;  4QJF A;  4DWL A;  3KLW A;  3SGI A;  2UXB L;  1YI2 A;  4OAV B;  1JJG A;  3K7A H;  3BU2 A;  1YEZ A;  5IYB H;  1N8R C;  1L1O A;  3S24 A;  4YWK A;  4LF7 Q;  1QUQ A;  4MZ9 A;  1N32 Q;  1I6H H;  2IT1 A;  4FDB A;  4I1T A;  1UE1 A;  2YTV A;  2Y0S E;  1JMC A;  1FVI A;  5AJ3 Q;  3GTK H;  4MTN A;  1SLJ A;  1SR3 A;  3ICE A;  2JA5 G;  3KF6 A;  3RZO H;  4A3D G;  3FP9 A;  1VQ8 A;  1K9M C;  1M90 C;  3GTQ H;  3J80 i;  4Y7N H;  5GQO A;  2C35 B;  4A3I G;  2VW9 A;  4DR6 Q;  4BY1 H;  2AHO B;  4B3S Q;  2K75 A;  3A0J A;  4LFA L;  1VQ6 A;  1BBU A;  1TWH H;  3ERS X;  2VQF L;  2A8V A;  4YCW A;  3J80 c;  4OO1 G;  4QY7 A;  2MNA A;  4LFC Q;  4YCU A;  5GAD C;  3K8A A;  4A3C H;  1KL9 A;  3B6Y A;  4GKK L;  2A1A A;  3G48 A;  4L5T A;  1N36 L;  4OX9 Q;  5IP7 H;  3S16 H;  4NB3 A;  4O0A A;  3HOU G;  2VS1 A;  4JI0 Q;  1C0A A;  4GNX C;  2NVY H;  4C2M H;  4LF9 L;  3DM3 A;  3H3V H;  3HOY H;  1EQR A;  3DA4 A;  4LUV A;  2RIO A;  4BA1 I;  4NXM L;  5IYB G;  3H15 A;  4IOC A;  5IYD G;  1QVC A;  4DR4 Q;  4ME3 A;  1PH3 A;  4JV5 Q;  1UWV A;  5C4X H;  3KP9 A;  1IYJ B;  3I7F A;  3PUX A;  2QA4 A;  2JA8 G;  3CCR A;  3I2Z A;  3CCM A;  1W2B A;  4IFD G;  5C44 G;  2I5H A;  4HIM A;  3BZK A;  3S1N H;  4BBS G;  3KYH C;  3UDG A;  4Y52 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...