3Q8DA

E. coli reco complex with ssb c-terminus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
231
Chain Sequence
EGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein recO
publication title Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 67
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3q8dA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3q8dA01
4B3TL 5GAHC 3OTOL 1L2FA 5JEAJ 4GOPC 1IBMQ 1XNQL 2R92H 4X62Q 1E3PA 2IX0A 4JOIA 2HHHL 2HIXA 3U4ZA 3DM3A 4OONA 1YNXA 4UP9A 5C4JH 1KHIA 2I5MX 4YWMA 1B7YB 5GAEC 4HIMA 4HJ8A 3AEVA 3ICEA 2R7FA 3S2DH 2F52A 1PYSB 2KHIA 1SROA 4TVAB 3PV0A 4A3EH 3G4SA 4JYAL 1XNRL 1UEBA 4JI8L 3W1BA 3L0OA 4AQYQ 4QGUA 1PH1A 4JI1L 1N34L 1L1OC 2UXDL 3PO3G 2N3SA 1XTDA 2HT1A 5IT9c 3UDGA 1QVCA 3K80C 1Z47A 3HOZG 4UPAA 3T1HQ 3DLLA 4A3CG 4DV1L 4DV0L 1JJCB 1NJIC 1HNXL 4WJ3M 4NPSA 2F4VQ 4DAMA 2AWOA 3LGJA 4R4IA 3T1YL 3GTKH 4IPGA 2JA6G 2JA5G 3PF5A 2LSSA 2R7ZG 2V1CC 1I3QH 4DR6Q 3ERSX 1OTCA 4BA2I 3JAMc 5ELOA 5C3EG 4X66L 2JEAI 4GLVB 2I5LX 4O0AA 1M1KC 4DUYL 1I5FA 1X3EA 2OQKA 3AFPA 1HZCA 4JI0Q 1U0LA 5H1SE 1Y1VG 3FKIH 3PIPA 4IJHA 3E0EA 1VCIA 2UXBQ 4DV3Q 1K73C 2NN6I 4LNQA 3GTMH 4J15A 3CC7A 4HIDA 2E5LL 4BBRG 4JI4L 1G291 3S14H 4DR2Q 4JOIC 4BBSH 1VQGA 1GVPA 1X3FA 2CFMA 2D0OA 4B3SQ 2VUMH 1JT8A 2JQOA 4QQBX 2KHJA 3CW2C 1HZ9A 3H0GG 3SGIA 3GTOH 4DUZQ 4DV2Q 4LF8Q 1Q82C 1GM5A 2D62A 4C3IH 2XGTA 1VQOA 3GTLH 4A3DG 3D31A 1VQ6A 4OO1G 1PFSA 1M90C 4DV4L 1GKHA 2ZM6L 3CXCA 1YHQA 4B3RL 2MFIA 1AE2A 3RN2A 4R4QA 4X64Q 3CCQA 1X6OA 2I5HA 2R6GA 1W2BA 5IYBH 2PQAB 3TRZA 1VQ9A 4GNXA 3HKZG 4K0KL 4XIGS 4OXPA 3CF5A 1IBML 2QGQA 2JEBI 4YCVA 1Y1WG 4GS3A 2MQHA 4BA1I 4QIWE 1LTLA 1PVOA 1QVGA 4A3BG 2F3IA 4JI1Q 5IY0A 2VQEQ 3I4NG 2E2HH 4NXNQ 1J6QA 1KD1C 3TEHB 3CCMA 2CCZA 3S24A 1RL2A 4DAYB 2ASBA 4H02A 4P75A 4GOPB 5J3BA 4JCVE 2YTXA 3KJOA 5C0XI 2D0PA 1IZ6A 4DV0Q 4DV5L 4JG2A 2Q2TA 4A3IH 4QY7A 2UXCQ 4R4CA 1Q8KA 4IJLA 3F1ZA 1E7ZA 1MKHA 4JI3Q 4X6AH 5M5XH 3GTJH 4A3MH 4JBKA 3PCOB 3KYHC 5IWAQ 3GTGH 4JC0A 4KLKA 3HOXG 1T9HA 1YJWA 2F4VL 3I4MG 5M3FG 4IO9A 2L15A 2K52A 2E2IH 3PF4A 5AJ3Q 1CKMA 5IP9H 4DR6L 5HY6A 1X56A 4JBMA 3AFQA 4DKAC 2NVTH 2AWNA 2E5LQ 4DR1L 1ASYA 3PO2G 4APVA 1VQDA 4GN3B 3CCSA 1WOCA 2B63H 2UXBL 3S1NH 4DV3L 1WYDA 2CKZB 2BH2A 4LF5Q 3J81c 1N33L 2LXJA 1QUQA 2NZOA 1KXLA 4WJ4A 1PHJA 1KAWA 1LM0A 3PUWA 1BBWA 2FXQA 1OXXK 4BY1H 3KF8B 3AYHB 3HKSA 3HOYG 1EWIA 2GVAA 3TQYA 5K36G 1X9NA 4DV2L 2ZJQA 4B3RQ 3JC66 3TS0A 1C0AA 3K0XA 4LF8L 1WFQA 2YU9H 1CKOA 2ID0A 1U5KA 2K4KA 4HJ7A 1WCMG 3GO5A 4LF9Q 4R4TA 1BVSA 2JA7G 3H3VI 2Q2UA 5C4XG 1HR0L 4A3FH 1I50H 1K83H 2Y0SE 4X64L 4A3JG 1FJGQ 2UUAL 2XTIA 1B8AA 4QL5A 3A5ZB 2UUCQ 4JI5L 4LW1A 2JE6I 3E9HA 4LFAL 4GLAC 4DR4Q 1V9PA 3PUVA 1E1TA 2WFWA 5ELNA 2VQEL 4DUZL 4DV6Q 4JV5Q 5JJKA 4NXNL 3RLNA 3JAMi 1UE1A 3H15A 4DV5Q 3CPFA 4HJ5A 4LF4Q 3M9BA 1FGUA 4TQUS 2JA9A 3A0JA 2EIFA 3S2HH 3GTPH 4LUOA 1YEZA 2H5XA 3K8AA 1V43A 3NBHB 5IP7H 1D8LA 4DV7Q 4L5SA 4OX9Q 3H3VH 4K0KQ 1HNWL 2UXCL 2EQSA 4HJ9A 1L0WA 2VQFQ 4JI3L 4HIKA 4GKKL 2ALYB 5C44H 1YJ9A 5IWAL 3CD6A 1LUZA 1I94L 4LUVA 4DR1Q 5M3MG 3HOWH 2HQLA 3CCEA 3U58A 5AJ3L 1VQLA 3W1GA 1VQ7A 1G51A 2GVBA 4GN5A 2RHQB 2K50A 4X65Q 3S17H 1HJPA 3BZKA 4LUZA 1N33Q 1X55A 5FJ8G 2KENA 1P16A 1PYBA 2C35B 4RMFA 4JI7Q 4AYBG 2B29A 2KBNA 2N8NA 1VQNA 2AMCB 2I0QA 4P73A 5GADC 3CCRA 1B70B 4LF5L 2RHSB 3EBEA 3I55A 2K5HA 1VQCA 4YWLA 4JBJA 3OW2A 5FLMG 3RN5A 3S1RH 4A93G 2HIVA 3ULPA 4MTNA 1S72A 1P8LA 4BY7G 3KDFB 4YY3Q 4EQ5A 1PA6A 1RIPA 3CMEA 3PO3H 3CC2A 3F2DA 4IPDA 4P74A 1SFOH 1HR0Q 1NBWA 1PH4A 1TWCH 1HNZL 3HOZH 4A3GG 4A3CH 4LFBL 1NTGA 5E7NA 4ALPA 3HOUG 1NMFA 5GROA 2EXDA 2JA8G 5IYCG 4LF9L 2UUAQ 2JA6H 2JA5H 2R93G 2R7ZH 1JJ2A 4JI5Q 1YHAA 2VS1A 3A5UA 2NVXH 4IFDG 5C3EH 4L5TA 5IYDG 1FJGL 1R9TH 4A3LG 2VNUD 4OO1I 2UUBQ 1YHBA 4LF6L 1HR0W 2Z0SA 4UP8A 2UUCL 1CKNB 1Q12A 1Y1VH 3UE0A 4A76A 2RCNA 4JI2L 1VQ8A 1OXSC 4DR4L 1AH9A 1VQMA 3STBD 4L5QA 4BBRH 4JV5L 4DV6L 3S1MH 1Q86C 1X65A 3B6YA 1K3RA 1OXTA 4NB3A 1HNWQ 1NMGA 4LF4L 1FVIA 4ME3A 4MZ9A 1VQ4A 2AHOB 2WAQE 2Z6KA 2KCMA 3CAMA 4GKKQ 1EFWA 1E22A 3H0GH 1UE5A 5GAGC 1EIFA 2YYZA 3U50C 4OX9L 3F2CA 4DV7L 2CWAA 1L1OB 1HH2P 1I94Q 2NVQH 3PIOA 4IOAA 1XMQL 2A8VA 3J81i 1WI5A 1YZ6A 2VQFL 4A3DH 3BJUA 4PZ7A 1PH5A 2NVYH 3VDYA 1JB7A 3CC4A 4LFCL 3E9IA 3NELA 4DK3C 5IE8A 3BZCA 4A3KG 1PH7A 3HOVG 4KHPQ 1Q46A 4AH6A 1VQEA 1N32Q 3KF6B 1VQKA 3AQQA 2A1AA 2YV5A 4X65L 2ZTCA 3MEFA 4O2DA 4GNXC 4GOPA 1E24A 5M5WH 1Y1WH 1PH3A 1CSPA 1GO3E 2VW9A 3D0FA 1XPRA 1SLJA 4C3HH 4JI7L 1QVFA 4P71A 1W3SA 4A3BH 1YIJA 3I4NH 1Q1BA 3S1QH 4DNIA 3PGZA 4AIMA 4KHZA 5LMUQ 3M85A 1PH2A 4PMWA 2QEXA 3RLFA 3UE1A 2OWOA 4A3EG 1HNZQ 3K7AH 1VQJA 4LFBQ 1C9OA 4YY3L 4IOCA 2JJQA 4YWKA 2NZHA 4KI0A 3RLOA 3EIVA 2E2JH 3RZOH 3K7UC 1XMOL 2Z6KC 2BA1A 4PZ8A 5M5YH 3HOXH 3I4MH 1JJGA 1IBLQ 1SN8A 5M3FH 1VQ5A 1ASZA 1I6HH 3ULJA 3J80c 1TWAH 4LF6Q 3KOJA 1H95A 4DR5L 4C3JH 1JE5A 2N78A 4JI2Q 3UDXA 2ZJPA 4PG3A 2ZTEA 4NXMQ 1C7YA 3F8TA 1IYJB 1G6PA 2UUBL 3PO2H 1YI2A 3PSIA 1KC8C 2YTYA 4HJAA 2OTLA 3FKIG 5LMNL 2E8GA 3IRBA 2IT1A 4DK6C 2QA4A 1QZGA 3G6EA 4YCUA 3M4OH 1IL2A 1XMQQ 1CUKA 4BBSG 1UE7A 1VQFA 2VUMG 1KQSA 3HOYH 1JMCA 1QZHA 1MJCA 4LFCQ 1J5EQ 4GN4B 1A63A 2R7DA 2PI2A 4B3ML 1VQPA 3RR5A 4DPGA 4GKJQ 3J7ZC 1NY4A 3HKZE 3HOVH 1EQRA 1WCMH 1EUJA 2CQOA 2PMZE 2JA7H 2Q2HA 4A75A 3BU2A 5C4XH 5JEAG 4POFA 2OTJA 3CCJA 3GDEA 1IXRA 3G71A 1A0IA 1KL9A 2YTVA 4KHPL 2IHEA 4JBWA 1E1OA 1TWGH 5BR8Q 2K14A 4A3JH 1N32L 2WB1E 3K81C 3L7ZC 1FL0A 1XJVA 3PUYA 2NN6G 2ZTDA 1PH8A 5IYBG 4OWTB 4IPCA 3RNUA 1EQQA 3KFUA 1BKBA 1MIUA 1OXUA 1SR3A 4IFDJ 4IPHA 1YVCA 3M4QA 1IBKQ 3RZDH 3MXNB 1N36Q 1K8AC 2Y0SG 4JI6L 5LMUL 2VZAA 3CQZH 3I56A 3G48A 5JJLA 4UP7A 1SE8A 4GNXB 2A19A 1XMOQ 1HZBA 4LF7L 2ATWA 4FDBA 1KRSA 1SRUA 4DR7L 2LXKA 2ZJRA 1Q7YC 1N8RC 4POGA 4EX5A 2N49A 4YHHL 1XPUA 3KLWA 4DR5Q 4PZ6A 4A3IG 1UWVA 3S16H 3HFZB 1Y14B 2OCEA 5C0XJ 4A3MG 4DR3L 4LFAQ 2PI2E 4A3KH 1Q81C 1IBLL 1XNRQ 1TWHH 5M3MH 4GLXA 1A8VA 4C2MH 1PV4A 1EOVA 1WJJA 3FP9A 2UU9Q 2IX1A 1LYLA 1PH9A 2B3GA 3TS2A 2DGYA 5IP9G 2GN5A 4NXML 5LMNQ 1K9MC 4B3TQ 3S15H 2MO1A 2VY3A 3ULLA 3PUZA 3OTOQ 3GTQH 2PNHA 4Y52H 1K8GA 1VQBA 4A4IA 5FJ8H 4P72A 3KDFA 1XNQQ 4IFDI 2HHHQ 2K5NA 3J81j 2AKWB 3UDIA 1N9WA 5DLQE 2B63G 5C0XG 3KJPA 3ER0A 1X3GA 3GD7A 3OYYA 1EYGA 1HZAA 3EN2A 4A93H 1AE3A 4LWCA 5FLMH 1YJNA 2WP8J 4X62L 4UY8C 4JYAQ 2IHFA 4B3MQ 4BY7H 4BXXG 4XTCS 4JI8Q 5JJIA 2UXDQ 5LMNW 2PQAA 1N34Q 4BY1G 2DUDA 3M4PA 2KCTA 2WB1G 2CWPA 3M3YH 1V1QA 1J5EL 3NENA 3PUXA 2ES2A 2VL6A 1XPOA 4A3GH 4MNOA 4GKJL 2MO0A 4AQYL 1VS0A 2BH8A 3HOUH 3FHWA 1QUQB 4YCWA 3CPWA 4DV1Q 2JA8H 1HNXQ 5IYCH 1KIXA 1CKNA 2IY5B 2R93H 1A62A 3T1YQ 3ZJYC 4L5RC 4RG1A 1Q1EA 1DGSA 1CSQA 3M7NA 3NEMA 3Q8DA 3T1HL 3CMAA 5GQOA 1TWFH 5BR8L 4A3FG 5IYDH 4A3LH 3CCLA 5HGQA 2K5VA 4X66Q 3CCVA 4HIOA 2R92G 1VQHA 4QJFA 4DUYQ 1PH6A 1VQAA 1O7IA 1MJEA 4JI6Q 4OWWB 3UDFA 1VQIA 3I2ZA 3J80i 2MNAA 3CCUA 1IBKL 4LF7Q 1D7QA 1L1OA 3CP0A 1KRTA 1X54A 1N36L 4DR7Q 4OWXB 4JI0L 4JI4Q 4Y7NH 4YHHQ 2K75A 1YITA 5EAYA 1S3OA 4R4OA 5FLXc 1YBYA 3KF6A 3I4OA 5IP7G 4DR3Q 4BXXH 4DR2L 1EIYB 1NE3A 3W5OA 3WWVA 4B3SL 3I7FA 2RF4A 3STBC 1S40A 5C44G 1K0RA 2WAQG 4DV4Q 1BBUA 1SMXA 3U4VA 2ZM6Q 1OXVA 1GD7A 2OQ0A 2JK8A 3TREA 4AYBE 1TXYA 2Q2IA 3F2BA 2UU9L 3HOWG 3L2PA 4R1JA 1UE6A 3A74A 1Z9FA 2BA0A 3J7A5
chains in the Genus database with same CATH superfamily
3KBGA 4DXFA 4ULLA 1L2FA 3LWEA 1SNPA 4I7ZC 1U9RA 2IX0A 3NBIA 4CBVA 3NK9A 3LJ0A 1KHIA 3K58A 4YWMA 4WJWA 2R7FA 3L0IA 1FNUA 2JXMB 2RDFA 2HQEA 4TVAB 3J81E 3PV0A 4JYAL 1QWYA 3G4SA 1JWSD 1ESRA 4AQYQ 1N34L 2KQ3A 2F0WA 2C9OA 2HT1A 5COYA 1QVCA 1O80A 1JJCB 1NJIC 1HNXL 4WJ3M 1J9OA 1PRTF 2KCCA 2F0JA 4OHJA 1SJHD 1W6KA 2PW5A 5ELOA 2EYHA 2EY2A 2JEAI 4GLVB 2I5LX 1HZCA 1U0LA 1Y1VG 3CKIB 1PTOH 1VCIA 4DV3Q 5E3FA 4LNQA 3CC7A 3E3XA 5E1FA 4JI4L 1G291 2QDBA 5J1ZA 5C5LA 4EQNA 4JOIC 1LTBD 1VQGA 1X3FA 1SFOB 3OW7A 2KEEA 2KHJA 1KLUD 2Q8IB 4LF8Q 2JA6B 1VQOA 3K59A 2JA5B 1GUGA 1WTWA 1SYGA 3MXGA 3MVVA 2X69A 1R9TB 3RN2A 5EBCA 5I9OA 5G3LF 3CCQA 3GP7A 3DHQA 2NN6H 5KYLA 1VQ9A 1IL8A 4RHRA 2WV6D 1K0SA 4YCVA 2I46A 4BA1I 4WORA 2DNCA 3MFYA 3S1MB 1ONLA 1X3QA 3TP8A 1PVOA 4C3HG 1QVGA 4A3BG 1YNJD 4L8JA 2F3IA 2VQEQ 3I4NG 4CKBA 1WVLA 2E2HH 2F66B 1KD1C 3BVZA 2HDLA 4NP5A 2ASBA 5J3BA 4JCVE 3KJOA 2D0PA 1IZ6A 3Q6SA 4OEMB 5FOBB 1HQRD 4A3DB 4DV5L 2NVYB 3NSWA 3OHXC 3SHLA 3GTJH 4A3MH 2YFAA 3KYHC 5IWAQ 3GTGH 5EBDA 1JOKA 5M3FG 1CQFA 4QF4A 5E4XA 4S3SA 3HP3A 4K6DA 2RBMA 4JBMA 2F0KA 3IFDA 2E5LQ 1DM0B 2M00A 4GN3B 4Z9CB 4DV3L 5JPMC 1NR4A 2CKZB 1IHZA 2QKIC 1D1IA 3J81c 2LXJA 2NZOA 1KAWA 1BBWA 2FXQA 2DNEA 1OXXK 4BY1H 3KF8B 3AYHB 3HKSA 3PQIA 2EYLA 2B2UA 5K36G 5M5YB 1X9NA 3I4MB 4B3RQ 2XWBB 4LF8L 1WFQA 3NWTA 3T4AC 1TWAB 2YU9H 2CW0D 1HUMA 3I9V1 4C3JB 4HJ7A 4OGQC 3GO5A 2L11A 1ZEQX 4LF9Q 3H3VI 2Q2UA 5C4XG 4H7BA 1BUVT 1TDPA 3PO2B 1K83H 1FJGQ 1U4LA 5JAVA 4QL5A 4KD4A 4XXEA 4LW1A 3B55A 3FVVA 1JQYD 4JVZA 2F3WA 2QDLA 2WFWA 3MWYW 2VQEL 3JAMi 3C2PA 2RA4A 4I65A 3TZUA 2F0MA 4HJ5A 2K04A 1FGUA 3M9BA 4LF4Q 3A7LA 3A8JE 1W6JA 1PFNA 3P23A 1YEZA 1LTID 3NBHB 4DV7Q 2RSOA 2VB3X 1BCPD 2JA7B 3HS0C 4FXGC 2KUMA 1YJ9A 5IWAL 3CD6A 2NBFA 1GUWA 4LUVA 1HA6A 2VB2X 3J80E 3CCEA 1A2TA 2IP6A 2GVBA 1CA6A 3BZDB 3UI2A 3BZKA 4HR7B 3RZDB 1F9PA 1X55A 4JI7Q 1FNVA 2B29A 2N8NA 4RGNA 3NTIA 2I0QA 2EZVA 4P73A 3EBEA 2K5HA 5FLMG 3RN5A 1S72A 3NXWA 2NYZD 1CQVA 4RFBA 1SFOH 4A3CH 1TWHB 2CAZB 1K8OA 1NTGA 5E7NA 4ALPA 3D6CA 5IIFA 5FO8B 4LF9L 2JA6H 1JICA 1RKNA 2JA5H 2LFNA 4UAIA 1F9QA 4ID6A 2LMCB 1BCPF 4JI5Q 3A5UA 5C3EH 1FJGL 1R9TH 3IAM1 4A3LG 2K33A 1CKNB 2X6GA 4JI2L 5ELDA 2RCNA 3NTKA 3ONAB 3NTHA 3CU7A 3JAME 3STBD 4FF1A 1TU2B 2MGSA 4L5QA 3S1MH 3H3VC 1Q86C 4CJ2C 2EYMA 2K1BA 4LF4L 1XWEA 1GUNA 4GKKQ 2PQEA 1UE5A 1SYBA 1EIFA 3F2CA 4DV7L 2CWAA 2JA8B 3FNBA 1XMQL 4A3DH 1SYCA 3BJUA 1PH5A 2EJGC 2NVYH 3NQIA 1HPCA 4LFCL 3NELA 3M7GA 1Q46A 4AH6A 3SR1A 1N32Q 4QUFA 3KF6B 1YO7A 1VQKA 2TMPA 1EYDA 2YV5A 2ZTCA 4BWGB 1B4OA 4R9WA 2O2LD 1EZ8A 3A8KE 1GO3E 2XIWA 4I7AA 1QVFA 4JI7L 1EWHA 1DCZA 1A6XA 4YZ9A 1JC7A 2ZXOA 4PMWA 1LO5D 3RLFA 3UE1A 2OWOA 1DXMA 1IKMA 1VQJA 5LNK1 1C9OA 1SDFA 5CV9A 4IOCA 4EVOA 1CK1A 1XTCD 4H0LC 3VA5A 4A3KB 1YNJC 5M5YH 3I4MH 1JJGA 2IPKD 2OT2A 3J80c 1TWAH 3BVGA 3FPUB 4C3JH 1SEBD 3QB3A 2ENBA 2ZTEA 4DGZA 1BOSA 3PO2H 3FEWX 1RF2D 5C4JB 3KF8A 1VF7A 4K5XA 1B3QA 4IUQA 1F2LA 4QIWB 2QA4A 3G6EA 1CTMA 4BBSG 4PQXA 3SK4A 1VQFA 1JOQA 2VUMG 2DY8A 1PLFA 2FMCA 3LJ1A 2F3VA 2K03A 3J7ZC 4C3IG 1EUJA 2B39A 1F9RA 2JA7H 2Q2HA 4U6RA 2RSNA 3EROA 1KL9A 2Z1CA 5I9PA 1N32L 2WB1E 2JP1A 1FL0A 2MPMA 4DK1A 3C1FA 2ZTDA 3FKIB 2B2VA 3GTMB 3KFUA 1C8CA 3VR2A 1MIUA 2CW0C 3NBHA 3R2TA 3TP7A 1YVCA 2XN9C 3RZDH 1PFMA 4JI6L 2F4IA 2EE1A 4PMBA 4UP7A 4IUTA 1HZBA 3OWFA 1KRSA 4DR7L 2K01A 2LXKA 2ZJRA 1N8RC 2N49A 4HSPA 3FDTA 4PZ6A 1MBYA 4B08A 1Y14B 2OCEA 3A8IE 4XT1B 4X3TA 3OSOA 1Q81C 1TWHH 4C56C 1BBXC 5CV4A 2PZUA 1WJJA 2K32A 1PH9A 1EQVA 3TS2A 3DEPA 4B3TQ 1GXDC 2VY3A 1BCPC 3ULLA 5M9OA 4Y52H 5FJ8H 1XNQQ 4BS9A 3J81j 2QEJC 1E2ZA 2B63G 3F2UA 1PMRA 1WD0A 2L12A 1HZAA 3AMUA 1STNA 3BDCA 1MD2D 1A2UA 3K0YA 4UY8C 4B3MQ 4XTCS 4JI8Q 1Y8NB 1DOMA 2N88A 4A3IB 2RVLA 2KCTA 2WB1G 2CWPA 1OO9B 1WTPA 1VS0A 3D6WA 3QO2A 4YCWA 1CT1D 3AJFA 2JA8H 2EVBA 5KRUA 1KIXA 1CKNA 2QILA 2FU2A 1PTOF 3DWQA 3R3OA 3ZJYC 4L5RC 4DAYA 2J7ZA 1Q1EA 3NEMA 2NVTB 3Q8DA 5IYDH 4A3FG 2R92G 4HIOA 3CCVA 1VQAA 1O7IA 2LS01 1EFID 4FF4A 3IKJA 1KNAA 4MHEA 2Q8RE 3I2ZA 2MNAA 3CCUA 1D7QA 3L3OC 4RCNA 4QCLA 4YHHQ 1ICFB 2K75A 4FVMA 2L5TA 3JSBA 2Q8TA 2ZXRA 3V05A 1WTVA 2HDMA 1R4PB 4DR3Q 3KF6A 2EPBA 4BXXH 4DR2L 1NE3A 5EPKA 3K5NA 3STBC 4HN7A 1S40A 1GUTA 5KGUA 5C44G 1F2MA 2WAQG 4A3KH 1SMXA 3U4VA 3TREA 3F2BA 4NKLA 3HOWG 1UE6A 2F0QA 2BA0A 4B3TL 5LL6X 2JB1A 4R8IA 1XNQL 1UUPA 2C5CA 2HIXA 3U4ZA 5I6WA 3DM3A 5C4JH 2HCCA 4QUCA 2I5MX 2PZWA 4HIMA 4HJ8A 1TVXA 3GTPB 1SROA 1UEBA 4JI8L 3W1BA 2E74C 4QGUA 4JI1L 1L1OC 4KJNA 4F87A 4CDEC 4GXTA 1TKWB 4XYQA 3K80C 3KK7A 2EOTA 4UPAA 3DLLA 4DV0L 2AQ1B 2AWOA 2SNMA 3LGJA 3BYYB 2X6LA 2R7ZG 2V1CC 3FBVA 4DR6Q 1OTCA 5FK9C 4HEA1 4V0BA 4O0AA 4IZ8A 1M1KC 1I5FA 1X3EA 3AFPA 2A68D 5FLXL 5H1SE 3FKIH 1EL0A 1LT3D 2NN6I 3GTMH 4J15A 2HCIA 4BBRG 1RODA 2EYFA 3PO3B 1GVPA 4B3SQ 4CKEA 2GA4B 3CW2C 4L6TB 3SGIA 4DV2Q 2A5HA 2B8FA 4B9XA 3D31A 5A35A 1VQ6A 2KA7A 1GKHA 1AE2A 3P7JA 4X64Q 5JVG3 3C3LA 3F4MA 4KHVA 5IYBH 1O7ZA 4XIGS 3GV3A 2QGQA 4GS3A 5IT9L 4G75A 1E0BA 1EY0A 1HA5A 4QIWE 2CQAA 4KJOA 1TIID 5IY0A 4J1MA 2CCZA 3EVQA 4FXKC 3H0GB 1RL2A 5HURA 1HTLD 4KV6A 4Q5VA 2YTXA 2NVQB 3X3MA 4A3IH 4QY7A 4R4CA 4X6AH 1E7ZA 1HFGA 1MKHA 5ELFA 1LLRD 3OPOA 5CGKA 4JBKA 3HOXG 1IKLA 1T9HA 1YJWA 4IO9A 2L15A 2XTRA 4RKBA 2K52A 3PF4A 1EU3A 1J8IA 3WOFA 5IP9H 1Y1WB 1NNXA 5M5WB 4DR6L 2NVTH 4DR1L 1ASYA 4DU9A 1CHPD 3CHBD 4CHTB 2PO4A 1PRTD 5EJWA 4LF5Q 1Q90A 1N33L 4K2LA 4C1NK 1LM0A 1EY4A 1CFMA 2HGKA 3HOYG 3TQYA 3A55A 3IAYA 4DV2L 2ZRRA 1GHJA 5KNDA 3NUCA 1WCMG 1HCZA 1BVSA 1S5CD 3HEJA 5IGEA 1HR0L 4CDFC 1B1ZA 4EQOA 4X64L 1B8AA 1HHVA 4DAVA 1BO0A 5CV8A 5IGFA 3E9HA 4GLAC 4DR4Q 1JWMD 1V9PA 3OMCA 1E1TA 3M4OB 4DV6Q 1JOOA 1UE1A 2RDHA 3H15A 4DV5Q 4TQUS 2JA9A 5G3LD 4WFN3 1E2WA 3R93A 2JB3A 2AQ3B 1HTPA 3GTLB 3GTPH 4HAEA 2H5XA 3K8AA 4LUOA 4XQNA 4OX9Q 4C1NI 1STEA 5KYIA 2B2YA 4HJ9A 1WTQA 1SNQA 2ALYB 3LWUA 5K36H 2B2UC 2WKDA 4A3JB 1EY9A 1LUZA 1B53A 1DOLA 3OIQA 5M3MG 2HQLA 1O7LA 5ISRA 1RDPD 4HEDA 1JORA 2RHQB 1K3BC 2K50A 1EYCA 3MZ5A 4X65Q 3EJIA 1SXTA 1PYBA 4AYBG 3CQZB 4ZUJA 2OXPA 5J22A 2F0VA 4LF5L 3I91A 3K6OA 2RHSB 3I55A 2NB0A 2QCPX 1XX8A 3ULPA 2FFKB 4YIJA 1BF4A 1FNWA 3KDFB 3PO3H 2KVMA 1RIPA 2B8GA 1RJTA 4HSVA 3F2DA 4IPDA 4DF7A 3AB9A 1HNZL 3HOZH 4A3GG 4LFBL 5L37A 1NMFA 5IYCG 2R93G 4HCEA 2VS1A 4OIKA 3TMEA 2VNUD 2UUBQ 4FO2A 1YHBA 4RH6A 4LF6L 5CMDA 1IYUA 4A76A 4DR4L 4A93B 5EKLA 1AH9A 1FGBD 1VQMA 4BY7B 4DV6L 1TQOA 1X65A 1OXTA 1CM9A 4G57A 2EY6A 2AHOB 3CAMA 2Z6KA 5ELEA 1E22A 3H0GH 3HOUB 2A68C 2OEOA 4OX9L 1HH2P 2NVQH 4IOAA 2E75C 2QF7A 3LJ2A 1H9SB 4XT3B 1JB7A 4OO1H 1NCVA 3G7LA 1KDAA 4DK3C 5IE8A 3BZCA 1SNOA 4R8NA 3FVQA 1PH7A 3E0JA 1LTSD 1WD1A 1VQEA 2P22B 4X65L 1Q8IA 3WDNA 3MEFA 4O2DA 4GNXC 1Y1WH 5M5WH 1PH3A 2F0NA 3D0FA 1DJRD 4DNIA 2A74C 3QOJA 1VMCA 3M85A 4KN4C 4ZRZA 3QWNA 3RUZA 2A6ED 5D3DA 1V8QA 2RCFA 2JJQA 1PDQA 2NZHA 1XMOL 2M2LA 2WINB 4ABNA 3HOVB 3UITA 1DYQA 4P2CB 1VQ5A 1SN8A 1ASZA 3SEBA 3KOJA 1EZ6A 1CZGA 4JI2Q 4OELB 3UDXA 4PG3A 2BDOA 3SVMA 2R92B 2UUBL 3PSIA 5IODA 1KC8C 4X3UA 4O1NA 3S2DB 4PL4A 5LMNL 4A3EB 2FJ2A 2IT1A 1MHWC 4IN3A 1B3AA 1TY2A 4G7HC 1QZGA 3M4OH 3QJYA 1XMQQ 1CUKA 2Z9HA 1ML0D 4LFCQ 1CZWA 4GN4B 4KKUA 5CYUA 2R7DA 4KY7A 4DPGA 1II3A 3HKZE 4N8X1 1EQRA 1FYCA 1PRTC 1NSNS 1I3QB 2MHVA 3PIO3 2O5IC 4JBWA 4A3JH 2PYKA 4ZYSA 3D4RA 1XJVA 3PUYA 2NN6G 2J4XA 1PH8A 4OWTB 2NZ1D 4K2KA 2MJFB 4XYOA 1SR3A 3M4QA 4NDXA 3QOLA 1G8ZD 3CQZH 3I56A 3VA7A 2PW7A 4LF7L 2AQ2B 2ATWA 4OAVB 4FDBA 5KNBA 4KTAA 3SXHA 4POGA 3SK5A 5A2QL 3I4LA 3VA9A 2EYJA 2G9HD 1EY8A 4CDDC 2B2WA 1PXUA 5C0XJ 4A3MG 4LFAQ 1SNDA 4GLXA 1A8VA 1PV4A 1EOVA 2B2TA 2IJ0A 1G91A 2EDGA 4Q0FA 4J6HA 1X3PA 1K8GA 2Y0SB 3KDFA 2KHSA 4KK7A 4TRDA 5DEHA 1N9WA 3KJPA 4G7OC 1X3GA 2FHTA 2KOLA 3EN2A 2B2VC 1EYGA 4A93H 4X62L 3MA2B 5ELBA 4BY7H 5JJIA 3W3AA 2UXDQ 4BY1G 4G76A 4FP5D 4CGYB 3HOUH 1QUQB 4E6IA 3VYRA 2E2IB 1D1KA 3T1YQ 4PL5A 1LACA 2BDNA 4IFDH 2HUGA 1JE4A 3TP5A 5I6YA 3T1HL 4CKCA 5EKIA 5HGQA 4X66Q 1DZ1A 2EYOA 2O5JC 4QJFA 1PH6A 3DM1A 4JI6Q 1A15A 4EGVA 3UDFA 4XDXA 3D4WA 1ET6A 1RCVD 4DR7Q 1UNSA 4OWXB 4JI0L 1H9SA 1QNKA 1YITA 1AP0A 4PL3A 1C4QA 1B50A 4FF3A 3W5OA 3GQBA 1YNND 2RF4A 1ESFA 2QW7A 2DY7A 4LFAL 3HOVH 2JSOA 4DUZL 1OXVA 3BS1A 1D5ZC 3L9AX 3A74A 5ELCA 1Z9FA 4V190 4EX5A 4PMCA 4YZDA 4GOPC 2R92H 1E3PA 1F2ZA 3R8BA 4OONA 1YNXA 1MGSA 5GAEC 1QJOA 3AEVA 3ICEA 3S2DH 1SMYD 3S2HB 1GUOA 2KHIA 4A3EH 1SJED 3BVMA 3J7YW 3L0OA 2UXDL 3H94A 1ENFA 3NE5B 4KKTA 4JK1C 1XTDA 4PV1C 3UDGA 1QB5D 1Z47A 4A3CG 1BQQT 4NPSA 2F4VQ 4DAMA 2CVRA 4R4IA 3T1YL 4IPGA 2JA6G 2JA5G 3PF5A 1I3QH 2F0DA 2BL7A 2A6EC 3ERSX 2VXWA 5NUCA 3JAMc 5C3EG 2K28A 4X66L 1EY7A 1LTAD 1Y69U 2XVSA 2F6MB 3O13A 5FO9B 5BN5A 4IJHA 3KLRA 3DA3A 2A73B 2EXZA 4RGTA 1K73C 1PTOD 2F0FA 2F0PA 4DR2Q 2I07B 4RHSA 1SYFA 2D0OA 1JT8A 5KIXA 2K5WA 1TWCB 2RQXA 1HZ9A 1DONA 1Q82C 3OMGA 4A3DG 5JEAH 2F0OA 1YHQA 1JB3A 1AEXA 2MFIA 2RKSA 4OAUC 4R4QA 1TT2A 4CJ1B 4RGOS 1X6OA 1Y1VB 2IL8A 2R6GA 1W2BA 2PQAB 3TRZA 1H9JA 1CI3M 4YZCA 2JEBI 1TY0A 4IUNA 1LTLA 1A3UA 1D5XC 1D6EC 4JI1Q 4HMIA 2G9DA 1J6QA 4KD3A 3CCMA 1AN8A 3S24A 4NV2A 3DEOA 4H02A 4P75A 4J8QA 4DV0Q 2OF1A 1QOHA 4JG2A 5D65A 2Q2TA 2QZGA 4JI3Q 1CA5A 1VDZA 3PCOB 1QG7A 4JC0A 4KLKA 5T1IA 2F4VL 3I4MG 3OWEB 3BDLA 2E2IH 1T5XD 5HGTA 4K8JA 4C3JG 5HY6A 1X56A 3TN2A 1SBBB 4DKAC 1U4MA 1SJ8A 4C3HB 3S1QB 3I4NB 3PO2G 4A3BB 5BN4A 4APVA 5CV5A 3CCSA 2F0SA 5C0XH 3K7AB 3MTSA 1QUQA 2MJ8A 3N52A 3LNNA 1PHJA 3PUWA 3PIP3 3TSSA 3ND9A 1B9NA 5C3WA 2KCNA 4ZLTF 4N8FA 2GVAA 3T51B 3T13A 2V4DA 3TS0A 3K0XA 5M3FB 4ZUIA 2XMXA 1I6HB 1CKOA 2K4KA 4KMUC 4R4TA 2JA7G 1IYVA 3G6JB 2E2DC 3M4YA 2BE5D 2Y0SE 2UUAL 3A5ZB 4IQZA 5IGCA 2JE6I 1PZJD 2L4NA 3PUVA 3I8ZA 5ELNA 4JV5Q 1STBA 4F8MA 4ODGA 2NTTA 1EY6A 3IFTA 3HGBA 3A0JA 2EIFA 3S2HH 3K5LA 2G5DA 4LJZC 5TSSA 1WTOA 5IP7H 4K0KQ 1D8LA 1HNWL 3C1EA 1L0WA 2VQFQ 5C4XB 4JI3L 3BYTB 1T5EA 5F2DA 1I94L 3J81L 4DR1Q 3J7AF 3W1GA 5C4HA 1G51A 4GN5A 1A3TA 1KABA 1F2YA 1N33Q 1MSHA 5FJ8G 1IW7D 2KENA 2BL8A 1P16A 2C35B 5JPNC 5GADC 1B70B 1EU4A 3OW2A 5IGDA 4JBJA 3Q24A 1P8LA 1I4GA 5AFWA 4ZCKA 4JW0A 3CMEA 1PA6A 3S16B 4ZQ3A 1HR0Q 1NBWA 2A69D 1TWCH 4DXGA 1PH4A 4NW2A 2R3ZA 2O4XA 5EGTA 2JA8G 2EXDA 3I3CA 3W2DA 1SMYC 3SK8A 3S15B 2B2YC 1JJ2A 1ENCA 1YHAA 3GTQB 5IYDG 3TBIB 2A6HD 4OO1I 4M1UB 3BG3A 1GJXA 1HR0W 2Z0SA 4UP8A 1Q12A 3UE0A 1Y1VH 3P75A 2F0GA 2YFBA 1DOKA 5BN3A 1NR2A 2MP1A 2JYOA 4JV5L 4KKSA 2F0EA 3X3NA 2JAEA 1BXTA 4TSSA 4DAPA 1BDOA 4G4KA 4NB3A 1STAA 3MAQA 1FVIA 3EFXD 1R4QB 4ME3A 1M8AA 5KEEA 2PCFB 4M8AA 1H9KA 5EPJA 2YYZA 3U50C 4K0KL 3WOEA 3PIOA 2A8VA 3J81i 1WI5A 1YZ6A 2VQFL 4PZ7A 3VDYA 1PTOC 3CC4A 3E9IA 1TWFB 4A3KG 4KHPQ 1I4HA 3AQQA 2A1AA 2RDGA 1E24A 1S5BD 3NHHA 5T1GA 2VW9A 1SLJA 4C3HH 4A3BH 3S1QH 1YIJA 3I4NH 1Q1BA 1EIGA 4KHZA 5LMUQ 1SNMA 2QEXA 5I2YA 1HNZQ 3K7AH 1V1OA 4EQPA 4LFBQ 1WTXA 2L9HA 3RLOA 3VR4A 3M3YB 2Z6KC 2BA1A 5M3FH 4Z7HA 3BDOA 1I6HH 4LF6Q 4DR5L 1JE5A 2F0IA 4DA2A 3R2IA 2ZJPA 5LL6S 1IYJB 1G6PA 3CRLC 1H9MA 2V6EA 2DN8A 3QG1A 2YTYA 2Z6BA 4HJAA 4K14A 2F0LA 3FKIG 4GZYC 3IRBA 5CV6A 5EPLA 3MFGA 3I72A 4YCUA 3ND8A 1KDCA 3VYTA 1KTKA 1UE7A 2GSCA 3ZYYX 1KQSA 1QZHA 1MJCA 1J5EQ 1A63A 5FLXE 1VQPA 1JWUD 4GKJQ 5J39A 3GTKB 2TSSA 1QNUA 4A75A 5C4XH 1LABA 3CCJA 3GDEA 1IXRA 1V1PB 4KHPL 1CHQD 1E1OA 5BR8Q 3L7ZC 4H13C 3EA6A 5IYBG 2A2DA 4IPCA 1BKBA 1OXUA 2XNAC 4IFDJ 4IPHA 2SOBA 3ERQA 3S14B 3MXNB 1N36Q 4BBSB 5LMUL 2VUMB 1SE4A 5FKAC 3J80L 5JJLA 2RLDA 1L0XB 2BE5C 4GNXB 1XMOQ 3GTOB 1PFBA 3MXUA 1SRUA 5KNCA 3V2TA 4C3IB 1XPUA 3KLWA 4A3IG 4X3SA 3S16H 4RAUC 5IT9E 3HFZB 2JN4A 3KBXA 3VYSA 2DJFC 4HTHA 1I4PA 2UU9Q 1SNCA 2ZJQA 2IX1A 1C0AA 3EQLC 1LYLA 3K57A 2B3GA 2DGYA 5IP9G 5C3EB 5LMNQ 1K9MC 3S15H 4XQQA 1BR9A 1HRJA 3OTOQ 2ICEC 3GTQH 3PUZA 3VYUA 1VQBA 4A4IA 4P72A 4IFDI 2EY5A 3P1HA 2HHHQ 2K5NA 2AKWB 1Y8PB 5DLQE 5C5MA 1BNZA 3ER0A 3GD7A 3T53B 3OYYA 4FYDA 5FLMH 4LWCA 1YJNA 2IHFA 5LMNW 2DUDA 3M4PA 5C4ZA 3DO9A 1UAPA 5M5XB 3NENA 3NPPA 1J5EL 1IW7C 3PUXA 2ES2A 1EQTA 4MNOA 5CORA 5CC4A 4GKJL 2MO0A 4AQYL 3JAML 4DV1Q 4QMGA 4RG1A 1S5ED 4K5WA 3CMAA 5BR8L 1TWFH 2B2WC 2F0HA 3CCLA 4A3LH 1VQHA 4RA8A 4KY6A 5C6AA 4DUYQ 1PRTB 1MJEA 2B63B 4OWWB 2B2TC 3S1NB 2A69C 1G2TA 4O1OA 2XRSD 1VQIA 5EQ0A 3J80i 4LF7Q 5JJZA 3CP0A 1N36L 3RMHA 2WB1B 5JVH3 1AW7A 1ILQA 2A6HC 3MHBA 4MIUA 1MSGA 1S3OA 4R4OA 5FLXc 1YBYA 1KXLA 3I4OA 4UDUC 3I7FA 4A3FB 1I50B 3M3YH 4DV4Q 2ZM6Q 2UU9L 1GD7A 2OQ0A 3Q0AA 2Q2IA 4MTKA 1GUSA 4FF2A 2HD3A 3J7A5 3LX0A 5GAHC 1K28A 1D5MC 3OTOL 4G7ZC 1IBMQ 5JEAJ 1KDBA 1Q3LA 4K5VA 4RGMA 4X62Q 2HHHL 1ICWA 4JOIA 4UP9A 4UHVA 4H44C 3V96A 1EY5A 1B7YB 3HZXA 2L0CA 3P20A 4OIJA 1I6VC 1PZKD 1PYSB 2F52A 3GTLH 1PH1A 2K05A 4IURA 2JBWA 3PO3G 1HFNA 2N3SA 5C44B 5IT9c 4X3KA 2WAQB 4IUUA 3NWSA 1ZYRD 3HOZG 3T1HQ 3HOWB 1HUNA 4DV1L 2L1LB 1H95A 1G6ZA 4ZK9B 5I2XA 3GTKH 2LSSA 3S17B 1H9RA 4KN7C 3KP9A 4BA2I 4Z7GA 2EYPA 4DNRB 3DWPA 5LHY1 1Z7TA 4DUYL 2OQKA 4JI0Q 2F0UA 1G2SA 2EY1A 3PIPA 3E0EA 2UXBQ 2CHBD 3U9SA 3RD4A 3S1RB 4HIDA 2E5LL 2WKCA 2PZTA 3S14H 3HRZC 4BBSH 1M4VA 2CFMA 3OIPA 2VUMH 1JQOA 4DFAA 2JQOA 1V1PA 2N55A 3AU7A 4ZAIA 5CBEE 4QQBX 3H0GG 4AS2A 1JR0D 3GTOH 4DUZQ 1UEAB 2FUG1 1GM5A 2D62A 4C3IH 2XGTA 2R7ZB 2K5DA 1PFSA 4N9PA 1M90C 4OO1G 4DV4L 2NVXB 2ZM6L 3CXCA 4B3RL 3MXNA 1LT6D 1KLGD 2I5HA 4O1PA 3E5SA 3HKZG 4GNXA 4OXPA 3CF5A 1IBML 1Y1WG 5D3IB 4BBRB 2MQHA 1X32A 1TS5A 3S9WA 1AZPA 1QE6A 5HGIA 1HQMC 3K5MA 3TEHB 4NXNQ 3SK6A 4DAYB 4Q9VA 4GOPB 4I1TA 2K6AA 5C0XI 3T16A 2UXCQ 1Q8KA 4IJLA 3F1ZA 5M5XH 2K5QA 4HMJA 1JCKB 4IUPA 1MI2A 3I90A 2A2CA 2D9UA 1KAAA 3H6MA 1S5FD 1XXGA 1CKMA 2PMZB 4JPBW 5DAUA 5AJ3Q 3AFQA 2F1MA 2AWNA 1VQDA 3TP6A 1WOCA 1O7YA 2B63H 2UXBL 3S1NH 3I70A 4LMQD 1WYDA 2BH2A 1AFPA 4TKOB 3TZDA 4AS3A 4WJ4A 3VR5A 1XYIA 4XQJA 1TS4A 2E2JB 3RZOB 3KUPA 1EIHA 4DWLA 1EWIA 3HOXB 3JC66 2QSBA 2EJMA 2ID0A 1U5KA 2MUYA 2ZT9C 1RTNA 4RKLA 3NP8A 2P5ZX 1B44D 3SDJA 1SE3A 3H09A 4A3FH 1I50H 4A3JG 4DN4M 2XTIA 2DJGC 2F03A 2UUCQ 4JI5L 1BCPB 1GHKA 2BCOA 5JJKA 3Q22A 3QR8A 4NXNL 3RLNA 3HOYB 3CPFA 3ITPA 2KKMA 2WACA 3QIAA 3Q23A 3GV6A 3H3VH 1V43A 4L5SA 3T56B 1WCMB 3DA4A 1LV9A 2EQSA 2UXCL 4N9TA 1Y8OB 4GKKL 4HIKA 5C44H 1TWGB 2FMMA 2L55A 2AUJD 3HOWH 2IW3A 2CH4W 3U58A 3K5OA 5AJ3L 1VQLA 3FPPA 1VQ7A 2M9VA 1SE2A 1ILPA 2IX3A 3D4DA 3S17H 1HJPA 4ZKCB 4LUZA 3IAS1 5A2QE 4DK0A 1TS3A 4RMFA 1LTTD 2XTQA 2KBNA 2K7VA 2L1BA 1VQNA 2AMCB 1LTRD 1NUCA 5D14A 3CCRA 1VQCA 4YWLA 4A93G 1ET9A 3S1RH 2HIVA 4MTNA 4BY7G 4NMZA 4YY3Q 4EQ5A 2ETDA 3CC2A 1ENAA 1S4ZA 4P74A 3OOCA 1QCBD 5IGBA 5M3MB 4C2MB 3HOUG 5GROA 4CDCC 2UUAQ 1VF5C 5DNFA 2D2CC 2R7ZH 4IFDG 1SSOA 3A54A 2NVXH 4L5TA 3FRPB 4ME5A 4AYBB 1I4RA 1QILA 4F7XA 3H91A 5EKKA 2UUCL 1ZYRC 1VQ8A 4O42A 1OXSC 1L0YB 4BBRH 3B6YA 2D5DA 1K3RA 1HNWQ 1NMGA 4RCOA 1VQ4A 4MZ9A 2K19A 2WAQE 2KCMA 1FD7D 1B2TA 1EFWA 4A3GB 2NTSA 5GAGC 2SNSA 1AZQA 1L1OB 1I94Q 2R93B 1WTHA 5CR3A 2XSCA 3HOVG 1EEID 2WIIB 5CBAE 4F88A 1SYDA 2EJFC 4MN3A 4LK1C 4GOPA 1CSPA 1XPRA 3KLSX 4P71A 1W3SA 4Y7NB 3SDZA 1RTOA 2KECA 3PGZA 4AIMA 2PPBC 2Z4IA 1PH2A 3I73A 1HXYD 2JB2A 4A3EG 4YY3L 1ZXTA 4YWKA 4KI0A 1SAPA 3EIVA 2E2JH 3RZOH 3K7UC 2E76C 1LTGD 3MXPA 4PZ8A 3HOXH 2IWHA 1IBLQ 3ULJA 1ZKOA 2N78A 4K6LA 1EOTA 2KEDA 4NXMQ 1C7YA 2NUCA 3F8TA 4B9WA 2KJXA 1YI2A 4OL7A 2FEFA 2OTLA 3HG9A 4U68A 1EYAA 2Z8LA 2E8GA 4HFVA 1F9SA 5FO7B 3E6ZX 4DK6C 5E4WC 2J0TD 1IL2A 4WRDA 2SDFA 3HOYH 1LT4D 1JMCA 1PYWD 1SYEA 2R61A 2PI2A 4B3ML 3RR5A 3MC0B 1NY4A 1WCMH 2F0TA 2CQOA 2PMZE 1STGA 2OTJA 3BU2A 5JEAG 4POFA 1NAPA 3KLSA 3G71A 1A0IA 2YTVA 2XWJB 3DMUA 1B9MA 2IHEA 1TWGH 1YNNC 2K14A 3CRKC 1TR5A 1STYA 3K81C 5CV7A 2LKVA 2CH4A 3TDQA 4ILWA 1E2VA 1PTOB 3RNUA 1EQQA 3D3RA 2ZXPA 1IBKQ 4NV5A 1RHPA 1K8AC 2Y0SG 2VZAA 3A56A 3G48A 1SE8A 1I4XA 2QGMA 1U4PA 2A19A 2BOSA 3MEHA 3SE0A 4U673 2H1EA 2NWGA 1FR3A 3FMCA 1F77A 1Q7YC 5C3XA 4IUVA 3J7AV 4YHHL 1GOZA 4DR5Q 1UWVA 4LAAA 1I4QA 3HOZB 2AUKA 4DR3L 1IBLL 2PI2E 3URYA 1XNRQ 5M3MH 4C2MH 3FP9A 2H4OA 2GN5A 4NXML 5JOBA 1S5DD 2MO1A 1A3VA 2PNHA 2E2HB 2FINB 3UDIA 2RIOA 1KNEA 5C0XG 2ICIA 4CJ0B 3VR6A 1AE3A 1LT5D 2WP8J 4QB4A 4JYAQ 4BXXG 2PNRC 1RD9D 2PQAA 1N34Q 5DM73 4KY5A 3D8GA 1DD2A 1V1QA 3GTJB 4A3MB 1U4RA 3N6RA 2VL6A 1XPOA 3GTGB 4A3GH 3IL8A 4K8IA 2BH8A 3FHWA 1O78A 3CPWA 1HNXQ 5IYCH 1C48A 1EEFD 3C46A 2IY5B 3DXJC 1A62A 2R93H 4PNYA 1EWCA 3M7NA 1DGSA 1CSQA 3A7AB 1TS2A 3DWAA 5IOCA 4IALA 1Z6HA 5GQOA 2K5VA 4FXDA 2RADA 5K5PA 4RWSC 3HKZB 3VR3A 2Z4HA 2ZW3A 2XRQD 1IBKL 1L1OA 1KRTA 1X54A 3U9OA 4BY1B 4DNTB 4JI4Q 4Y7NH 1WTRA 3NQTA 5I4DA 2SEBD 3PMFA 5EAYA 4FNFA 1K8MA 4ZKBB 5DM63 4HCSA 5IP7G 1PZID 5IGGA 2YU9B 1EIYB 2LY7A 4L63B 3WWVA 4B3SL 1K0RA 1XNRL 1K83B 1BBUA 3DUZA 1D2BA 2JK8A 4AYBE 1TXYA 1VMPA 3L2PA 4R1JA 1STHA
chains in the Genus database with same CATH topology
4B3TL 5GAHC 4YZDA 2JB1A 3OTOL 1L2FA 5JEAJ 4GOPC 1IBMQ 1XNQL 2R92H 4X62Q 1E3PA 2IX0A 4JOIA 2HHHL 2HIXA 3U4ZA 3DM3A 4OONA 1YNXA 4UP9A 3LJ0A 5C4JH 1KHIA 2I5MX 4YWMA 1B7YB 5GAEC 4HIMA 4HJ8A 3AEVA 3ICEA 2R7FA 3L0IA 2F52A 3S2DH 1PYSB 2KHIA 1SROA 4TVAB 3PV0A 4A3EH 3G4SA 4JYAL 1XNRL 1UEBA 4JI8L 3W1BA 3L0OA 4AQYQ 4QGUA 1PH1A 4JI1L 1N34L 1L1OC 2UXDL 3PO3G 4GXTA 2N3SA 1XTDA 2HT1A 5IT9c 3UDGA 1QVCA 3K80C 1Z47A 3HOZG 4UPAA 3T1HQ 3DLLA 4A3CG 4DV1L 2L1LB 4DV0L 1JJCB 1NJIC 1HNXL 4WJ3M 4NPSA 2F4VQ 4DAMA 2AWOA 3LGJA 4R4IA 3T1YL 3GTKH 4IPGA 2JA6G 2JA5G 3PF5A 2LSSA 2R7ZG 2V1CC 3FBVA 1I3QH 4DR6Q 3ERSX 3KP9A 1OTCA 4BA2I 4Z7GA 5ELOA 3JAMc 5C3EG 4HEA1 4X66L 4GLVB 2JEAI 2I5LX 4O0AA 1M1KC 4DUYL 1I5FA 1X3EA 2OQKA 3AFPA 1HZCA 4JI0Q 2F6MB 1U0LA 5H1SE 1Y1VG 3FKIH 3PIPA 4IJHA 3E0EA 3DA3A 1VCIA 4DV3Q 2UXBQ 1K73C 2NN6I 4LNQA 3GTMH 4J15A 3CC7A 4HIDA 2E5LL 4BBRG 4JI4L 1G291 3S14H 4DR2Q 4JOIC 4BBSH 1VQGA 1GVPA 1X3FA 2CFMA 2D0OA 4B3SQ 2VUMH 1JT8A 2JQOA 4QQBX 2KHJA 4AS2A 1HZ9A 3CW2C 3H0GG 3SGIA 3GTOH 4DUZQ 4DV2Q 2FUG1 4LF8Q 1Q82C 1GM5A 2D62A 4C3IH 2XGTA 1VQOA 3GTLH 4A3DG 3D31A 1VQ6A 4OO1G 1PFSA 1M90C 4DV4L 1GKHA 2ZM6L 3CXCA 1YHQA 4B3RL 2MFIA 1AE2A 3RN2A 4OAUC 4R4QA 4X64Q 3F4MA 3CCQA 1X6OA 2I5HA 2R6GA 1W2BA 4O1PA 2PQAB 5IYBH 1VQ9A 4GNXA 3HKZG 3TRZA 4XIGS 4K0KL 4OXPA 3CF5A 4YZCA 1IBML 2QGQA 2JEBI 4YCVA 1Y1WG 4GS3A 4G75A 2MQHA 4BA1I 4QIWE 1LTLA 1PVOA 1QVGA 4A3BG 2F3IA 4JI1Q 5IY0A 2VQEQ 3I4NG 2E2HH 2F66B 5HGIA 1J6QA 3TEHB 3CCMA 1KD1C 3S24A 2CCZA 4NXNQ 4NV2A 1RL2A 4DAYB 2ASBA 4H02A 4P75A 4Q9VA 4GOPB 5J3BA 4I1TA 4JCVE 2YTXA 3KJOA 5C0XI 2D0PA 1IZ6A 4DV0Q 4DV5L 4JG2A 2Q2TA 4A3IH 4QY7A 2UXCQ 4R4CA 1Q8KA 4IJLA 3F1ZA 1E7ZA 1MKHA 4JI3Q 4X6AH 5M5XH 3GTJH 4A3MH 4JBKA 2YFAA 3KYHC 3PCOB 5IWAQ 3GTGH 4JC0A 4KLKA 3HOXG 1T9HA 1YJWA 2F4VL 3I4MG 5M3FG 4IO9A 2L15A 2A2CA 2XTRA 2K52A 2E2IH 3PF4A 5AJ3Q 1CKMA 5IP9H 4DR6L 5HY6A 1X56A 4JBMA 3AFQA 4DKAC 2NVTH 2AWNA 1SJ8A 2E5LQ 4DR1L 1ASYA 3PO2G 4APVA 1VQDA 4GN3B 3CCSA 1WOCA 2B63H 2UXBL 3S1NH 4DV3L 1WYDA 2CKZB 2BH2A 4LF5Q 3J81c 1N33L 2LXJA 4AS3A 1QUQA 2NZOA 1KXLA 4WJ4A 1PHJA 1KAWA 1LM0A 3PUWA 1BBWA 2FXQA 1OXXK 4BY1H 3KF8B 3AYHB 3HKSA 4DWLA 3HOYG 1EWIA 2GVAA 3TQYA 5K36G 1X9NA 4DV2L 2ZJQA 4B3RQ 3JC66 3TS0A 1C0AA 3K0XA 2ZRRA 1WFQA 4LF8L 2XMXA 2YU9H 1CKOA 2ID0A 1U5KA 3I9V1 2K4KA 4HJ7A 1WCMG 3GO5A 4LF9Q 4R4TA 1BVSA 2JA7G 3H3VI 2Q2UA 5C4XG 1HR0L 3SDJA 4A3FH 1I50H 1K83H 2Y0SE 4X64L 4A3JG 1FJGQ 2UUAL 2XTIA 1B8AA 4QL5A 3A5ZB 2UUCQ 4JI5L 4LW1A 2JE6I 3E9HA 4LFAL 4GLAC 4DR4Q 1V9PA 3PUVA 1E1TA 2WFWA 5ELNA 2VQEL 4DUZL 4DV6Q 4JV5Q 5JJKA 4NXNL 3RLNA 3JAMi 1UE1A 3H15A 4DV5Q 3CPFA 2KKMA 4HJ5A 4LF4Q 3M9BA 1FGUA 4TQUS 2JA9A 2JB3A 3A0JA 2EIFA 3S2HH 3GTPH 3P23A 4LUOA 1YEZA 2H5XA 3K8AA 1V43A 3NBHB 5IP7H 1D8LA 4DV7Q 4L5SA 4OX9Q 3H3VH 4K0KQ 1HNWL 3DA4A 2UXCL 2EQSA 4HJ9A 1L0WA 2VQFQ 4JI3L 4HIKA 4GKKL 2ALYB 5C44H 1YJ9A 5IWAL 3CD6A 1LUZA 1I94L 4LUVA 4DR1Q 5M3MG 3HOWH 2HQLA 3CCEA 3U58A 5AJ3L 1VQLA 3W1GA 2IP6A 1G51A 2GVBA 4GN5A 1VQ7A 2RHQB 2K50A 4X65Q 3S17H 1HJPA 3BZKA 4LUZA 1N33Q 3IAS1 1X55A 5FJ8G 2KENA 1P16A 1PYBA 2C35B 4RMFA 4JI7Q 4AYBG 2XTQA 2B29A 2KBNA 2N8NA 1VQNA 2AMCB 2I0QA 4P73A 5GADC 3CCRA 1B70B 4LF5L 2RHSB 3EBEA 3I55A 2K5HA 1VQCA 4YWLA 4JBJA 3OW2A 5FLMG 3RN5A 3S1RH 4A93G 2HIVA 3ULPA 4MTNA 1S72A 1P8LA 4BY7G 3KDFB 4YY3Q 4EQ5A 1PA6A 1RIPA 3CMEA 3PO3H 3CC2A 3F2DA 4IPDA 4P74A 1SFOH 1HR0Q 1NBWA 1PH4A 1TWCH 1HNZL 3HOZH 4A3GG 4A3CH 4LFBL 2CAZB 1NTGA 5E7NA 4ALPA 3HOUG 1NMFA 5GROA 2EXDA 2JA8G 5IYCG 4LF9L 2UUAQ 2JA6H 2JA5H 2R93G 2R7ZH 1JJ2A 4JI5Q 1YHAA 2VS1A 3A5UA 2NVXH 4IFDG 5C3EH 4L5TA 5IYDG 1FJGL 1R9TH 3IAM1 4A3LG 4OO1I 2VNUD 2UUBQ 1YHBA 4LF6L 1HR0W 2Z0SA 4UP8A 2UUCL 1CKNB 1Q12A 1Y1VH 3UE0A 4A76A 2RCNA 4JI2L 1VQ8A 2YFBA 1OXSC 4DR4L 1AH9A 1VQMA 3STBD 4L5QA 4BBRH 4JV5L 4DV6L 3S1MH 1Q86C 1X65A 3B6YA 2JAEA 1K3RA 1OXTA 4NB3A 1HNWQ 1NMGA 4LF4L 1FVIA 4ME3A 4MZ9A 1VQ4A 2K19A 2AHOB 2WAQE 2KCMA 2Z6KA 3CAMA 1EFWA 1E22A 4GKKQ 3H0GH 1UE5A 5GAGC 1EIFA 2YYZA 3U50C 4OX9L 3F2CA 4DV7L 2CWAA 1L1OB 1HH2P 1I94Q 2NVQH 3PIOA 4IOAA 1XMQL 2A8VA 3J81i 3LJ2A 1WI5A 1YZ6A 2VQFL 4A3DH 3BJUA 4PZ7A 1PH5A 2NVYH 3VDYA 1JB7A 3CC4A 4LFCL 3E9IA 3NELA 4DK3C 5IE8A 3BZCA 4A3KG 1PH7A 3HOVG 4KHPQ 1Q46A 4AH6A 1VQEA 1N32Q 2P22B 1YO7A 3KF6B 1VQKA 3AQQA 2A1AA 2YV5A 4X65L 2ZTCA 3MEFA 4O2DA 4GNXC 4GOPA 1E24A 5M5WH 1Y1WH 1PH3A 1CSPA 1GO3E 2VW9A 3D0FA 1XPRA 1SLJA 4C3HH 4JI7L 1QVFA 4P71A 1W3SA 4A3BH 1YIJA 3I4NH 1Q1BA 3S1QH 4DNIA 3PGZA 4AIMA 4KHZA 5LMUQ 3M85A 4YZ9A 1PH2A 4PMWA 2QEXA 3RLFA 3UE1A 2OWOA 2JB2A 4A3EG 1HNZQ 3K7AH 1VQJA 5LNK1 1C9OA 4YY3L 4IOCA 4LFBQ 2JJQA 4YWKA 2NZHA 4KI0A 3RLOA 3EIVA 2E2JH 3RZOH 3K7UC 1XMOL 2Z6KC 3UITA 2BA1A 4PZ8A 5M5YH 3HOXH 3I4MH 1JJGA 1IBLQ 1SN8A 5M3FH 1VQ5A 4Z7HA 1ASZA 1I6HH 3ULJA 3J80c 1TWAH 4LF6Q 3KOJA 1H95A 4DR5L 4C3JH 1JE5A 2N78A 4JI2Q 3UDXA 2ZJPA 4PG3A 2ZTEA 4NXMQ 1C7YA 3F8TA 1IYJB 1G6PA 2UUBL 3PO2H 2V6EA 3PSIA 1YI2A 1KC8C 2YTYA 4HJAA 2OTLA 3FKIG 4PL4A 5LMNL 2E8GA 4HFVA 3IRBA 2IT1A 4DK6C 2QA4A 1QZGA 3G6EA 4YCUA 3M4OH 1IL2A 1XMQQ 1CUKA 4BBSG 1UE7A 1VQFA 2VUMG 1KQSA 3HOYH 1JMCA 1QZHA 1MJCA 4LFCQ 1J5EQ 4GN4B 1A63A 2R7DA 3LJ1A 2PI2A 4B3ML 1VQPA 3RR5A 4DPGA 4GKJQ 3J7ZC 1NY4A 3HKZE 3HOVH 1EQRA 1WCMH 1EUJA 2CQOA 2PMZE 2JA7H 2Q2HA 4A75A 3BU2A 4U6RA 5C4XH 4POFA 5JEAG 2OTJA 3CCJA 3GDEA 1IXRA 3G71A 1A0IA 1KL9A 2YTVA 4KHPL 2IHEA 4JBWA 1E1OA 1TWGH 5BR8Q 2K14A 4A3JH 1N32L 2WB1E 3K81C 3L7ZC 1FL0A 1XJVA 3PUYA 2NN6G 2ZTDA 1PH8A 5IYBG 4OWTB 2A2DA 4IPCA 3RNUA 1EQQA 2MJFB 3KFUA 1BKBA 1MIUA 1OXUA 1SR3A 4IFDJ 4IPHA 1YVCA 4NV5A 3M4QA 1IBKQ 3RZDH 3MXNB 1N36Q 1K8AC 2Y0SG 4JI6L 5LMUL 2VZAA 3CQZH 3I56A 3G48A 5JJLA 4UP7A 1SE8A 4GNXB 2A19A 1XMOQ 1HZBA 4LF7L 2ATWA 4OAVB 4FDBA 1KRSA 1SRUA 4DR7L 2LXKA 2ZJRA 1Q7YC 1N8RC 4POGA 4EX5A 2N49A 4YHHL 1XPUA 3KLWA 4DR5Q 4PZ6A 4A3IG 3VA9A 1UWVA 3S16H 3HFZB 1Y14B 2OCEA 5C0XJ 4A3MG 4DR3L 4LFAQ 2PI2E 4A3KH 1Q81C 1IBLL 1XNRQ 1TWHH 5M3MH 4GLXA 1A8VA 4C2MH 1PV4A 1EOVA 1WJJA 3FP9A 2UU9Q 2IX1A 1LYLA 1PH9A 2B3GA 3TS2A 2DGYA 5IP9G 2GN5A 4NXML 5LMNQ 1K9MC 4B3TQ 3S15H 2MO1A 2VY3A 3ULLA 3PUZA 3OTOQ 3GTQH 2PNHA 4Y52H 1K8GA 1VQBA 4A4IA 5FJ8H 4P72A 3KDFA 1XNQQ 4IFDI 2HHHQ 2K5NA 3J81j 2AKWB 3UDIA 2RIOA 1N9WA 5DLQE 2B63G 5C0XG 3KJPA 3ER0A 1X3GA 3GD7A 3OYYA 1EYGA 1HZAA 3EN2A 4A93H 1AE3A 4LWCA 5FLMH 1YJNA 2WP8J 4X62L 4UY8C 4JYAQ 2IHFA 4B3MQ 4BY7H 4BXXG 4XTCS 4JI8Q 5JJIA 2UXDQ 5LMNW 2PQAA 1N34Q 4BY1G 2DUDA 3M4PA 2KCTA 2WB1G 3DO9A 2CWPA 3M3YH 4G76A 1V1QA 1J5EL 3NENA 3PUXA 2ES2A 2VL6A 1XPOA 4A3GH 4MNOA 4GKJL 2MO0A 4AQYL 1VS0A 2BH8A 3HOUH 3FHWA 1QUQB 4YCWA 3CPWA 4DV1Q 3AJFA 2JA8H 1HNXQ 5IYCH 1KIXA 1CKNA 2IY5B 2R93H 1A62A 3T1YQ 3ZJYC 4PL5A 4L5RC 4RG1A 1Q1EA 1DGSA 1CSQA 3M7NA 3NEMA 3Q8DA 3T1HL 3CMAA 5GQOA 1TWFH 5BR8L 4A3FG 5IYDH 4A3LH 3CCLA 5HGQA 2K5VA 4X66Q 3CCVA 4HIOA 2R92G 1VQHA 4QJFA 4DUYQ 1PH6A 1VQAA 1O7IA 1MJEA 4JI6Q 4OWWB 3UDFA 4O1OA 1VQIA 3I2ZA 3J80i 2MNAA 3CCUA 1IBKL 4LF7Q 1D7QA 1L1OA 3CP0A 1KRTA 1X54A 1N36L 4DR7Q 4OWXB 4JI0L 4JI4Q 4Y7NH 4YHHQ 2K75A 3JSBA 1YITA 5EAYA 4PL3A 1S3OA 4R4OA 5FLXc 1YBYA 3KF6A 3I4OA 5IP7G 4DR3Q 4BXXH 4DR2L 1EIYB 1NE3A 3W5OA 3WWVA 4B3SL 3I7FA 2RF4A 3STBC 1S40A 5C44G 1K0RA 2WAQG 4DV4Q 1BBUA 1SMXA 3U4VA 2ZM6Q 1OXVA 1GD7A 2OQ0A 2JK8A 3TREA 4AYBE 1TXYA 2Q2IA 3F2BA 2UU9L 3HOWG 3L2PA 4R1JA 1UE6A 3A74A 1Z9FA 2BA0A 3J7A5
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T L;  5GAH C;  3OTO L;  1L2F A;  5JEA J;  4GOP C;  1IBM Q;  1XNQ L;  2R92 H;  4X62 Q;  1E3P A;  2IX0 A;  4JOI A;  2HHH L;  2HIX A;  3U4Z A;  3DM3 A;  4OON A;  1YNX A;  4UP9 A;  5C4J H;  1KHI A;  2I5M X;  4YWM A;  1B7Y B;  5GAE C;  4HIM A;  4HJ8 A;  3AEV A;  3ICE A;  2R7F A;  3S2D H;  2F52 A;  1PYS B;  2KHI A;  1SRO A;  4TVA B;  3PV0 A;  4A3E H;  3G4S A;  4JYA L;  1XNR L;  1UEB A;  4JI8 L;  3W1B A;  3L0O A;  4AQY Q;  4QGU A;  1PH1 A;  4JI1 L;  1N34 L;  1L1O C;  2UXD L;  3PO3 G;  2N3S A;  1XTD A;  2HT1 A;  5IT9 c;  3UDG A;  1QVC A;  3K80 C;  1Z47 A;  3HOZ G;  4UPA A;  3T1H Q;  3DLL A;  4A3C G;  4DV1 L;  4DV0 L;  1JJC B;  1NJI C;  1HNX L;  4WJ3 M;  4NPS A;  2F4V Q;  4DAM A;  2AWO A;  3LGJ A;  4R4I A;  3T1Y L;  3GTK H;  4IPG A;  2JA6 G;  2JA5 G;  3PF5 A;  2LSS A;  2R7Z G;  2V1C C;  1I3Q H;  4DR6 Q;  3ERS X;  1OTC A;  4BA2 I;  3JAM c;  5ELO A;  5C3E G;  4X66 L;  2JEA I;  4GLV B;  2I5L X;  4O0A A;  1M1K C;  4DUY L;  1I5F A;  1X3E A;  2OQK A;  3AFP A;  1HZC A;  4JI0 Q;  1U0L A;  5H1S E;  1Y1V G;  3FKI H;  3PIP A;  4IJH A;  3E0E A;  1VCI A;  2UXB Q;  4DV3 Q;  1K73 C;  2NN6 I;  4LNQ A;  3GTM H;  4J15 A;  3CC7 A;  4HID A;  2E5L L;  4BBR G;  4JI4 L;  1G29 1;  3S14 H;  4DR2 Q;  4JOI C;  4BBS H;  1VQG A;  1GVP A;  1X3F A;  2CFM A;  2D0O A;  4B3S Q;  2VUM H;  1JT8 A;  2JQO A;  4QQB X;  2KHJ A;  3CW2 C;  1HZ9 A;  3H0G G;  3SGI A;  3GTO H;  4DUZ Q;  4DV2 Q;  4LF8 Q;  1Q82 C;  1GM5 A;  2D62 A;  4C3I H;  2XGT A;  1VQO A;  3GTL H;  4A3D G;  3D31 A;  1VQ6 A;  4OO1 G;  1PFS A;  1M90 C;  4DV4 L;  1GKH A;  2ZM6 L;  3CXC A;  1YHQ A;  4B3R L;  2MFI A;  1AE2 A;  3RN2 A;  4R4Q A;  4X64 Q;  3CCQ A;  1X6O A;  2I5H A;  2R6G A;  1W2B A;  5IYB H;  2PQA B;  3TRZ A;  1VQ9 A;  4GNX A;  3HKZ G;  4K0K L;  4XIG S;  4OXP A;  3CF5 A;  1IBM L;  2QGQ A;  2JEB I;  4YCV A;  1Y1W G;  4GS3 A;  2MQH A;  4BA1 I;  4QIW E;  1LTL A;  1PVO A;  1QVG A;  4A3B G;  2F3I A;  4JI1 Q;  5IY0 A;  2VQE Q;  3I4N G;  2E2H H;  4NXN Q;  1J6Q A;  1KD1 C;  3TEH B;  3CCM A;  2CCZ A;  3S24 A;  1RL2 A;  4DAY B;  2ASB A;  4H02 A;  4P75 A;  4GOP B;  5J3B A;  4JCV E;  2YTX A;  3KJO A;  5C0X I;  2D0P A;  1IZ6 A;  4DV0 Q;  4DV5 L;  4JG2 A;  2Q2T A;  4A3I H;  4QY7 A;  2UXC Q;  4R4C A;  1Q8K A;  4IJL A;  3F1Z A;  1E7Z A;  1MKH A;  4JI3 Q;  4X6A H;  5M5X H;  3GTJ H;  4A3M H;  4JBK A;  3PCO B;  3KYH C;  5IWA Q;  3GTG H;  4JC0 A;  4KLK A;  3HOX G;  1T9H A;  1YJW A;  2F4V L;  3I4M G;  5M3F G;  4IO9 A;  2L15 A;  2K52 A;  2E2I H;  3PF4 A;  5AJ3 Q;  1CKM A;  5IP9 H;  4DR6 L;  5HY6 A;  1X56 A;  4JBM A;  3AFQ A;  4DKA C;  2NVT H;  2AWN A;  2E5L Q;  4DR1 L;  1ASY A;  3PO2 G;  4APV A;  1VQD A;  4GN3 B;  3CCS A;  1WOC A;  2B63 H;  2UXB L;  3S1N H;  4DV3 L;  1WYD A;  2CKZ B;  2BH2 A;  4LF5 Q;  3J81 c;  1N33 L;  2LXJ A;  1QUQ A;  2NZO A;  1KXL A;  4WJ4 A;  1PHJ A;  1KAW A;  1LM0 A;  3PUW A;  1BBW A;  2FXQ A;  1OXX K;  4BY1 H;  3KF8 B;  3AYH B;  3HKS A;  3HOY G;  1EWI A;  2GVA A;  3TQY A;  5K36 G;  1X9N A;  4DV2 L;  2ZJQ A;  4B3R Q;  3JC6 6;  3TS0 A;  1C0A A;  3K0X A;  4LF8 L;  1WFQ A;  2YU9 H;  1CKO A;  2ID0 A;  1U5K A;  2K4K A;  4HJ7 A;  1WCM G;  3GO5 A;  4LF9 Q;  4R4T A;  1BVS A;  2JA7 G;  3H3V I;  2Q2U A;  5C4X G;  1HR0 L;  4A3F H;  1I50 H;  1K83 H;  2Y0S E;  4X64 L;  4A3J G;  1FJG Q;  2UUA L;  2XTI A;  1B8A A;  4QL5 A;  3A5Z B;  2UUC Q;  4JI5 L;  4LW1 A;  2JE6 I;  3E9H A;  4LFA L;  4GLA C;  4DR4 Q;  1V9P A;  3PUV A;  1E1T A;  2WFW A;  5ELN A;  2VQE L;  4DUZ L;  4DV6 Q;  4JV5 Q;  5JJK A;  4NXN L;  3RLN A;  3JAM i;  1UE1 A;  3H15 A;  4DV5 Q;  3CPF A;  4HJ5 A;  4LF4 Q;  3M9B A;  1FGU A;  4TQU S;  2JA9 A;  3A0J A;  2EIF A;  3S2H H;  3GTP H;  4LUO A;  1YEZ A;  2H5X A;  3K8A A;  1V43 A;  3NBH B;  5IP7 H;  1D8L A;  4DV7 Q;  4L5S A;  4OX9 Q;  3H3V H;  4K0K Q;  1HNW L;  2UXC L;  2EQS A;  4HJ9 A;  1L0W A;  2VQF Q;  4JI3 L;  4HIK A;  4GKK L;  2ALY B;  5C44 H;  1YJ9 A;  5IWA L;  3CD6 A;  1LUZ A;  1I94 L;  4LUV A;  4DR1 Q;  5M3M G;  3HOW H;  2HQL A;  3CCE A;  3U58 A;  5AJ3 L;  1VQL A;  3W1G A;  1VQ7 A;  1G51 A;  2GVB A;  4GN5 A;  2RHQ B;  2K50 A;  4X65 Q;  3S17 H;  1HJP A;  3BZK A;  4LUZ A;  1N33 Q;  1X55 A;  5FJ8 G;  2KEN A;  1P16 A;  1PYB A;  2C35 B;  4RMF A;  4JI7 Q;  4AYB G;  2B29 A;  2KBN A;  2N8N A;  1VQN A;  2AMC B;  2I0Q A;  4P73 A;  5GAD C;  3CCR A;  1B70 B;  4LF5 L;  2RHS B;  3EBE A;  3I55 A;  2K5H A;  1VQC A;  4YWL A;  4JBJ A;  3OW2 A;  5FLM G;  3RN5 A;  3S1R H;  4A93 G;  2HIV A;  3ULP A;  4MTN A;  1S72 A;  1P8L A;  4BY7 G;  3KDF B;  4YY3 Q;  4EQ5 A;  1PA6 A;  1RIP A;  3CME A;  3PO3 H;  3CC2 A;  3F2D A;  4IPD A;  4P74 A;  1SFO H;  1HR0 Q;  1NBW A;  1PH4 A;  1TWC H;  1HNZ L;  3HOZ H;  4A3G G;  4A3C H;  4LFB L;  1NTG A;  5E7N A;  4ALP A;  3HOU G;  1NMF A;  5GRO A;  2EXD A;  2JA8 G;  5IYC G;  4LF9 L;  2UUA Q;  2JA6 H;  2JA5 H;  2R93 G;  2R7Z H;  1JJ2 A;  4JI5 Q;  1YHA A;  2VS1 A;  3A5U A;  2NVX H;  4IFD G;  5C3E H;  4L5T A;  5IYD G;  1FJG L;  1R9T H;  4A3L G;  2VNU D;  4OO1 I;  2UUB Q;  1YHB A;  4LF6 L;  1HR0 W;  2Z0S A;  4UP8 A;  2UUC L;  1CKN B;  1Q12 A;  1Y1V H;  3UE0 A;  4A76 A;  2RCN A;  4JI2 L;  1VQ8 A;  1OXS C;  4DR4 L;  1AH9 A;  1VQM A;  3STB D;  4L5Q A;  4BBR H;  4JV5 L;  4DV6 L;  3S1M H;  1Q86 C;  1X65 A;  3B6Y A;  1K3R A;  1OXT A;  4NB3 A;  1HNW Q;  1NMG A;  4LF4 L;  1FVI A;  4ME3 A;  4MZ9 A;  1VQ4 A;  2AHO B;  2WAQ E;  2Z6K A;  2KCM A;  3CAM A;  4GKK Q;  1EFW A;  1E22 A;  3H0G H;  1UE5 A;  5GAG C;  1EIF A;  2YYZ A;  3U50 C;  4OX9 L;  3F2C A;  4DV7 L;  2CWA A;  1L1O B;  1HH2 P;  1I94 Q;  2NVQ H;  3PIO A;  4IOA A;  1XMQ L;  2A8V A;  3J81 i;  1WI5 A;  1YZ6 A;  2VQF L;  4A3D H;  3BJU A;  4PZ7 A;  1PH5 A;  2NVY H;  3VDY A;  1JB7 A;  3CC4 A;  4LFC L;  3E9I A;  3NEL A;  4DK3 C;  5IE8 A;  3BZC A;  4A3K G;  1PH7 A;  3HOV G;  4KHP Q;  1Q46 A;  4AH6 A;  1VQE A;  1N32 Q;  3KF6 B;  1VQK A;  3AQQ A;  2A1A A;  2YV5 A;  4X65 L;  2ZTC A;  3MEF A;  4O2D A;  4GNX C;  4GOP A;  1E24 A;  5M5W H;  1Y1W H;  1PH3 A;  1CSP A;  1GO3 E;  2VW9 A;  3D0F A;  1XPR A;  1SLJ A;  4C3H H;  4JI7 L;  1QVF A;  4P71 A;  1W3S A;  4A3B H;  1YIJ A;  3I4N H;  1Q1B A;  3S1Q H;  4DNI A;  3PGZ A;  4AIM A;  4KHZ A;  5LMU Q;  3M85 A;  1PH2 A;  4PMW A;  2QEX A;  3RLF A;  3UE1 A;  2OWO A;  4A3E G;  1HNZ Q;  3K7A H;  1VQJ A;  4LFB Q;  1C9O A;  4YY3 L;  4IOC A;  2JJQ A;  4YWK A;  2NZH A;  4KI0 A;  3RLO A;  3EIV A;  2E2J H;  3RZO H;  3K7U C;  1XMO L;  2Z6K C;  2BA1 A;  4PZ8 A;  5M5Y H;  3HOX H;  3I4M H;  1JJG A;  1IBL Q;  1SN8 A;  5M3F H;  1VQ5 A;  1ASZ A;  1I6H H;  3ULJ A;  3J80 c;  1TWA H;  4LF6 Q;  3KOJ A;  1H95 A;  4DR5 L;  4C3J H;  1JE5 A;  2N78 A;  4JI2 Q;  3UDX A;  2ZJP A;  4PG3 A;  2ZTE A;  4NXM Q;  1C7Y A;  3F8T A;  1IYJ B;  1G6P A;  2UUB L;  3PO2 H;  1YI2 A;  3PSI A;  1KC8 C;  2YTY A;  4HJA A;  2OTL A;  3FKI G;  5LMN L;  2E8G A;  3IRB A;  2IT1 A;  4DK6 C;  2QA4 A;  1QZG A;  3G6E A;  4YCU A;  3M4O H;  1IL2 A;  1XMQ Q;  1CUK A;  4BBS G;  1UE7 A;  1VQF A;  2VUM G;  1KQS A;  3HOY H;  1JMC A;  1QZH A;  1MJC A;  4LFC Q;  1J5E Q;  4GN4 B;  1A63 A;  2R7D A;  2PI2 A;  4B3M L;  1VQP A;  3RR5 A;  4DPG A;  4GKJ Q;  3J7Z C;  1NY4 A;  3HKZ E;  3HOV H;  1EQR A;  1WCM H;  1EUJ A;  2CQO A;  2PMZ E;  2JA7 H;  2Q2H A;  4A75 A;  3BU2 A;  5C4X H;  5JEA G;  4POF A;  2OTJ A;  3CCJ A;  3GDE A;  1IXR A;  3G71 A;  1A0I A;  1KL9 A;  2YTV A;  4KHP L;  2IHE A;  4JBW A;  1E1O A;  1TWG H;  5BR8 Q;  2K14 A;  4A3J H;  1N32 L;  2WB1 E;  3K81 C;  3L7Z C;  1FL0 A;  1XJV A;  3PUY A;  2NN6 G;  2ZTD A;  1PH8 A;  5IYB G;  4OWT B;  4IPC A;  3RNU A;  1EQQ A;  3KFU A;  1BKB A;  1MIU A;  1OXU A;  1SR3 A;  4IFD J;  4IPH A;  1YVC A;  3M4Q A;  1IBK Q;  3RZD H;  3MXN B;  1N36 Q;  1K8A C;  2Y0S G;  4JI6 L;  5LMU L;  2VZA A;  3CQZ H;  3I56 A;  3G48 A;  5JJL A;  4UP7 A;  1SE8 A;  4GNX B;  2A19 A;  1XMO Q;  1HZB A;  4LF7 L;  2ATW A;  4FDB A;  1KRS A;  1SRU A;  4DR7 L;  2LXK A;  2ZJR A;  1Q7Y C;  1N8R C;  4POG A;  4EX5 A;  2N49 A;  4YHH L;  1XPU A;  3KLW A;  4DR5 Q;  4PZ6 A;  4A3I G;  1UWV A;  3S16 H;  3HFZ B;  1Y14 B;  2OCE A;  5C0X J;  4A3M G;  4DR3 L;  4LFA Q;  2PI2 E;  4A3K H;  1Q81 C;  1IBL L;  1XNR Q;  1TWH H;  5M3M H;  4GLX A;  1A8V A;  4C2M H;  1PV4 A;  1EOV A;  1WJJ A;  3FP9 A;  2UU9 Q;  2IX1 A;  1LYL A;  1PH9 A;  2B3G A;  3TS2 A;  2DGY A;  5IP9 G;  2GN5 A;  4NXM L;  5LMN Q;  1K9M C;  4B3T Q;  3S15 H;  2MO1 A;  2VY3 A;  3ULL A;  3PUZ A;  3OTO Q;  3GTQ H;  2PNH A;  4Y52 H;  1K8G A;  1VQB A;  4A4I A;  5FJ8 H;  4P72 A;  3KDF A;  1XNQ Q;  4IFD I;  2HHH Q;  2K5N A;  3J81 j;  2AKW B;  3UDI A;  1N9W A;  5DLQ E;  2B63 G;  5C0X G;  3KJP A;  3ER0 A;  1X3G A;  3GD7 A;  3OYY A;  1EYG A;  1HZA A;  3EN2 A;  4A93 H;  1AE3 A;  4LWC A;  5FLM H;  1YJN A;  2WP8 J;  4X62 L;  4UY8 C;  4JYA Q;  2IHF A;  4B3M Q;  4BY7 H;  4BXX G;  4XTC S;  4JI8 Q;  5JJI A;  2UXD Q;  5LMN W;  2PQA A;  1N34 Q;  4BY1 G;  2DUD A;  3M4P A;  2KCT A;  2WB1 G;  2CWP A;  3M3Y H;  1V1Q A;  1J5E L;  3NEN A;  3PUX A;  2ES2 A;  2VL6 A;  1XPO A;  4A3G H;  4MNO A;  4GKJ L;  2MO0 A;  4AQY L;  1VS0 A;  2BH8 A;  3HOU H;  3FHW A;  1QUQ B;  4YCW A;  3CPW A;  4DV1 Q;  2JA8 H;  1HNX Q;  5IYC H;  1KIX A;  1CKN A;  2IY5 B;  2R93 H;  1A62 A;  3T1Y Q;  3ZJY C;  4L5R C;  4RG1 A;  1Q1E A;  1DGS A;  1CSQ A;  3M7N A;  3NEM A;  3Q8D A;  3T1H L;  3CMA A;  5GQO A;  1TWF H;  5BR8 L;  4A3F G;  5IYD H;  4A3L H;  3CCL A;  5HGQ A;  2K5V A;  4X66 Q;  3CCV A;  4HIO A;  2R92 G;  1VQH A;  4QJF A;  4DUY Q;  1PH6 A;  1VQA A;  1O7I A;  1MJE A;  4JI6 Q;  4OWW B;  3UDF A;  1VQI A;  3I2Z A;  3J80 i;  2MNA A;  3CCU A;  1IBK L;  4LF7 Q;  1D7Q A;  1L1O A;  3CP0 A;  1KRT A;  1X54 A;  1N36 L;  4DR7 Q;  4OWX B;  4JI0 L;  4JI4 Q;  4Y7N H;  4YHH Q;  2K75 A;  1YIT A;  5EAY A;  1S3O A;  4R4O A;  5FLX c;  1YBY A;  3KF6 A;  3I4O A;  5IP7 G;  4DR3 Q;  4BXX H;  4DR2 L;  1EIY B;  1NE3 A;  3W5O A;  3WWV A;  4B3S L;  3I7F A;  2RF4 A;  3STB C;  1S40 A;  5C44 G;  1K0R A;  2WAQ G;  4DV4 Q;  1BBU A;  1SMX A;  3U4V A;  2ZM6 Q;  1OXV A;  1GD7 A;  2OQ0 A;  2JK8 A;  3TRE A;  4AYB E;  1TXY A;  2Q2I A;  3F2B A;  2UU9 L;  3HOW G;  3L2P A;  4R1J A;  1UE6 A;  3A74 A;  1Z9F A;  2BA0 A;  3J7A 5; 
#chains in the Genus database with same CATH topology
 3KBG A;  4DXF A;  4ULL A;  1L2F A;  3LWE A;  1SNP A;  4I7Z C;  1U9R A;  2IX0 A;  3NBI A;  4CBV A;  3NK9 A;  3LJ0 A;  1KHI A;  3K58 A;  4YWM A;  4WJW A;  2R7F A;  3L0I A;  1FNU A;  2JXM B;  2RDF A;  2HQE A;  4TVA B;  3J81 E;  3PV0 A;  4JYA L;  1QWY A;  3G4S A;  1JWS D;  1ESR A;  4AQY Q;  1N34 L;  2KQ3 A;  2F0W A;  2C9O A;  2HT1 A;  5COY A;  1QVC A;  1O80 A;  1JJC B;  1NJI C;  1HNX L;  4WJ3 M;  1J9O A;  1PRT F;  2KCC A;  2F0J A;  4OHJ A;  1SJH D;  1W6K A;  2PW5 A;  5ELO A;  2EYH A;  2EY2 A;  2JEA I;  4GLV B;  2I5L X;  1HZC A;  1U0L A;  1Y1V G;  3CKI B;  1PTO H;  1VCI A;  4DV3 Q;  5E3F A;  4LNQ A;  3CC7 A;  3E3X A;  5E1F A;  4JI4 L;  1G29 1;  2QDB A;  5J1Z A;  5C5L A;  4EQN A;  4JOI C;  1LTB D;  1VQG A;  1X3F A;  1SFO B;  3OW7 A;  2KEE A;  2KHJ A;  1KLU D;  2Q8I B;  4LF8 Q;  2JA6 B;  1VQO A;  3K59 A;  2JA5 B;  1GUG A;  1WTW A;  1SYG A;  3MXG A;  3MVV A;  2X69 A;  1R9T B;  3RN2 A;  5EBC A;  5I9O A;  5G3L F;  3CCQ A;  3GP7 A;  3DHQ A;  2NN6 H;  5KYL A;  1VQ9 A;  1IL8 A;  4RHR A;  2WV6 D;  1K0S A;  4YCV A;  2I46 A;  4BA1 I;  4WOR A;  2DNC A;  3MFY A;  3S1M B;  1ONL A;  1X3Q A;  3TP8 A;  1PVO A;  4C3H G;  1QVG A;  4A3B G;  1YNJ D;  4L8J A;  2F3I A;  2VQE Q;  3I4N G;  4CKB A;  1WVL A;  2E2H H;  2F66 B;  1KD1 C;  3BVZ A;  2HDL A;  4NP5 A;  2ASB A;  5J3B A;  4JCV E;  3KJO A;  2D0P A;  1IZ6 A;  3Q6S A;  4OEM B;  5FOB B;  1HQR D;  4A3D B;  4DV5 L;  2NVY B;  3NSW A;  3OHX C;  3SHL A;  3GTJ H;  4A3M H;  2YFA A;  3KYH C;  5IWA Q;  3GTG H;  5EBD A;  1JOK A;  5M3F G;  1CQF A;  4QF4 A;  5E4X A;  4S3S A;  3HP3 A;  4K6D A;  2RBM A;  4JBM A;  2F0K A;  3IFD A;  2E5L Q;  1DM0 B;  2M00 A;  4GN3 B;  4Z9C B;  4DV3 L;  5JPM C;  1NR4 A;  2CKZ B;  1IHZ A;  2QKI C;  1D1I A;  3J81 c;  2LXJ A;  2NZO A;  1KAW A;  1BBW A;  2FXQ A;  2DNE A;  1OXX K;  4BY1 H;  3KF8 B;  3AYH B;  3HKS A;  3PQI A;  2EYL A;  2B2U A;  5K36 G;  5M5Y B;  1X9N A;  3I4M B;  4B3R Q;  2XWB B;  4LF8 L;  1WFQ A;  3NWT A;  3T4A C;  1TWA B;  2YU9 H;  2CW0 D;  1HUM A;  3I9V 1;  4C3J B;  4HJ7 A;  4OGQ C;  3GO5 A;  2L11 A;  1ZEQ X;  4LF9 Q;  3H3V I;  2Q2U A;  5C4X G;  4H7B A;  1BUV T;  1TDP A;  3PO2 B;  1K83 H;  1FJG Q;  1U4L A;  5JAV A;  4QL5 A;  4KD4 A;  4XXE A;  4LW1 A;  3B55 A;  3FVV A;  1JQY D;  4JVZ A;  2F3W A;  2QDL A;  2WFW A;  3MWY W;  2VQE L;  3JAM i;  3C2P A;  2RA4 A;  4I65 A;  3TZU A;  2F0M A;  4HJ5 A;  2K04 A;  1FGU A;  3M9B A;  4LF4 Q;  3A7L A;  3A8J E;  1W6J A;  1PFN A;  3P23 A;  1YEZ A;  1LTI D;  3NBH B;  4DV7 Q;  2RSO A;  2VB3 X;  1BCP D;  2JA7 B;  3HS0 C;  4FXG C;  2KUM A;  1YJ9 A;  5IWA L;  3CD6 A;  2NBF A;  1GUW A;  4LUV A;  1HA6 A;  2VB2 X;  3J80 E;  3CCE A;  1A2T A;  2IP6 A;  2GVB A;  1CA6 A;  3BZD B;  3UI2 A;  3BZK A;  4HR7 B;  3RZD B;  1F9P A;  1X55 A;  4JI7 Q;  1FNV A;  2B29 A;  2N8N A;  4RGN A;  3NTI A;  2I0Q A;  2EZV A;  4P73 A;  3EBE A;  2K5H A;  5FLM G;  3RN5 A;  1S72 A;  3NXW A;  2NYZ D;  1CQV A;  4RFB A;  1SFO H;  4A3C H;  1TWH B;  2CAZ B;  1K8O A;  1NTG A;  5E7N A;  4ALP A;  3D6C A;  5IIF A;  5FO8 B;  4LF9 L;  2JA6 H;  1JIC A;  1RKN A;  2JA5 H;  2LFN A;  4UAI A;  1F9Q A;  4ID6 A;  2LMC B;  1BCP F;  4JI5 Q;  3A5U A;  5C3E H;  1FJG L;  1R9T H;  3IAM 1;  4A3L G;  2K33 A;  1CKN B;  2X6G A;  4JI2 L;  5ELD A;  2RCN A;  3NTK A;  3ONA B;  3NTH A;  3CU7 A;  3JAM E;  3STB D;  4FF1 A;  1TU2 B;  2MGS A;  4L5Q A;  3S1M H;  3H3V C;  1Q86 C;  4CJ2 C;  2EYM A;  2K1B A;  4LF4 L;  1XWE A;  1GUN A;  4GKK Q;  2PQE A;  1UE5 A;  1SYB A;  1EIF A;  3F2C A;  4DV7 L;  2CWA A;  2JA8 B;  3FNB A;  1XMQ L;  4A3D H;  1SYC A;  3BJU A;  1PH5 A;  2EJG C;  2NVY H;  3NQI A;  1HPC A;  4LFC L;  3NEL A;  3M7G A;  1Q46 A;  4AH6 A;  3SR1 A;  1N32 Q;  4QUF A;  3KF6 B;  1YO7 A;  1VQK A;  2TMP A;  1EYD A;  2YV5 A;  2ZTC A;  4BWG B;  1B4O A;  4R9W A;  2O2L D;  1EZ8 A;  3A8K E;  1GO3 E;  2XIW A;  4I7A A;  1QVF A;  4JI7 L;  1EWH A;  1DCZ A;  1A6X A;  4YZ9 A;  1JC7 A;  2ZXO A;  4PMW A;  1LO5 D;  3RLF A;  3UE1 A;  2OWO A;  1DXM A;  1IKM A;  1VQJ A;  5LNK 1;  1C9O A;  1SDF A;  5CV9 A;  4IOC A;  4EVO A;  1CK1 A;  1XTC D;  4H0L C;  3VA5 A;  4A3K B;  1YNJ C;  5M5Y H;  3I4M H;  1JJG A;  2IPK D;  2OT2 A;  3J80 c;  1TWA H;  3BVG A;  3FPU B;  4C3J H;  1SEB D;  3QB3 A;  2ENB A;  2ZTE A;  4DGZ A;  1BOS A;  3PO2 H;  3FEW X;  1RF2 D;  5C4J B;  3KF8 A;  1VF7 A;  4K5X A;  1B3Q A;  4IUQ A;  1F2L A;  4QIW B;  2QA4 A;  3G6E A;  1CTM A;  4BBS G;  4PQX A;  3SK4 A;  1VQF A;  1JOQ A;  2VUM G;  2DY8 A;  1PLF A;  2FMC A;  3LJ1 A;  2F3V A;  2K03 A;  3J7Z C;  4C3I G;  1EUJ A;  2B39 A;  1F9R A;  2JA7 H;  2Q2H A;  4U6R A;  2RSN A;  3ERO A;  1KL9 A;  2Z1C A;  5I9P A;  1N32 L;  2WB1 E;  2JP1 A;  1FL0 A;  2MPM A;  4DK1 A;  3C1F A;  2ZTD A;  3FKI B;  2B2V A;  3GTM B;  3KFU A;  1C8C A;  3VR2 A;  1MIU A;  2CW0 C;  3NBH A;  3R2T A;  3TP7 A;  1YVC A;  2XN9 C;  3RZD H;  1PFM A;  4JI6 L;  2F4I A;  2EE1 A;  4PMB A;  4UP7 A;  4IUT A;  1HZB A;  3OWF A;  1KRS A;  4DR7 L;  2K01 A;  2LXK A;  2ZJR A;  1N8R C;  2N49 A;  4HSP A;  3FDT A;  4PZ6 A;  1MBY A;  4B08 A;  1Y14 B;  2OCE A;  3A8I E;  4XT1 B;  4X3T A;  3OSO A;  1Q81 C;  1TWH H;  4C56 C;  1BBX C;  5CV4 A;  2PZU A;  1WJJ A;  2K32 A;  1PH9 A;  1EQV A;  3TS2 A;  3DEP A;  4B3T Q;  1GXD C;  2VY3 A;  1BCP C;  3ULL A;  5M9O A;  4Y52 H;  5FJ8 H;  1XNQ Q;  4BS9 A;  3J81 j;  2QEJ C;  1E2Z A;  2B63 G;  3F2U A;  1PMR A;  1WD0 A;  2L12 A;  1HZA A;  3AMU A;  1STN A;  3BDC A;  1MD2 D;  1A2U A;  3K0Y A;  4UY8 C;  4B3M Q;  4XTC S;  4JI8 Q;  1Y8N B;  1DOM A;  2N88 A;  4A3I B;  2RVL A;  2KCT A;  2WB1 G;  2CWP A;  1OO9 B;  1WTP A;  1VS0 A;  3D6W A;  3QO2 A;  4YCW A;  1CT1 D;  3AJF A;  2JA8 H;  2EVB A;  5KRU A;  1KIX A;  1CKN A;  2QIL A;  2FU2 A;  1PTO F;  3DWQ A;  3R3O A;  3ZJY C;  4L5R C;  4DAY A;  2J7Z A;  1Q1E A;  3NEM A;  2NVT B;  3Q8D A;  5IYD H;  4A3F G;  2R92 G;  4HIO A;  3CCV A;  1VQA A;  1O7I A;  2LS0 1;  1EFI D;  4FF4 A;  3IKJ A;  1KNA A;  4MHE A;  2Q8R E;  3I2Z A;  2MNA A;  3CCU A;  1D7Q A;  3L3O C;  4RCN A;  4QCL A;  4YHH Q;  1ICF B;  2K75 A;  4FVM A;  2L5T A;  3JSB A;  2Q8T A;  2ZXR A;  3V05 A;  1WTV A;  2HDM A;  1R4P B;  4DR3 Q;  3KF6 A;  2EPB A;  4BXX H;  4DR2 L;  1NE3 A;  5EPK A;  3K5N A;  3STB C;  4HN7 A;  1S40 A;  1GUT A;  5KGU A;  5C44 G;  1F2M A;  2WAQ G;  4A3K H;  1SMX A;  3U4V A;  3TRE A;  3F2B A;  4NKL A;  3HOW G;  1UE6 A;  2F0Q A;  2BA0 A;  4B3T L;  5LL6 X;  2JB1 A;  4R8I A;  1XNQ L;  1UUP A;  2C5C A;  2HIX A;  3U4Z A;  5I6W A;  3DM3 A;  5C4J H;  2HCC A;  4QUC A;  2I5M X;  2PZW A;  4HIM A;  4HJ8 A;  1TVX A;  3GTP B;  1SRO A;  1UEB A;  4JI8 L;  3W1B A;  2E74 C;  4QGU A;  4JI1 L;  1L1O C;  4KJN A;  4F87 A;  4CDE C;  4GXT A;  1TKW B;  4XYQ A;  3K80 C;  3KK7 A;  2EOT A;  4UPA A;  3DLL A;  4DV0 L;  2AQ1 B;  2AWO A;  2SNM A;  3LGJ A;  3BYY B;  2X6L A;  2R7Z G;  2V1C C;  3FBV A;  4DR6 Q;  1OTC A;  5FK9 C;  4HEA 1;  4V0B A;  4O0A A;  4IZ8 A;  1M1K C;  1I5F A;  1X3E A;  3AFP A;  2A68 D;  5FLX L;  5H1S E;  3FKI H;  1EL0 A;  1LT3 D;  2NN6 I;  3GTM H;  4J15 A;  2HCI A;  4BBR G;  1ROD A;  2EYF A;  3PO3 B;  1GVP A;  4B3S Q;  4CKE A;  2GA4 B;  3CW2 C;  4L6T B;  3SGI A;  4DV2 Q;  2A5H A;  2B8F A;  4B9X A;  3D31 A;  5A35 A;  1VQ6 A;  2KA7 A;  1GKH A;  1AE2 A;  3P7J A;  4X64 Q;  5JVG 3;  3C3L A;  3F4M A;  4KHV A;  5IYB H;  1O7Z A;  4XIG S;  3GV3 A;  2QGQ A;  4GS3 A;  5IT9 L;  4G75 A;  1E0B A;  1EY0 A;  1HA5 A;  4QIW E;  2CQA A;  4KJO A;  1TII D;  5IY0 A;  4J1M A;  2CCZ A;  3EVQ A;  4FXK C;  3H0G B;  1RL2 A;  5HUR A;  1HTL D;  4KV6 A;  4Q5V A;  2YTX A;  2NVQ B;  3X3M A;  4A3I H;  4QY7 A;  4R4C A;  4X6A H;  1E7Z A;  1HFG A;  1MKH A;  5ELF A;  1LLR D;  3OPO A;  5CGK A;  4JBK A;  3HOX G;  1IKL A;  1T9H A;  1YJW A;  4IO9 A;  2L15 A;  2XTR A;  4RKB A;  2K52 A;  3PF4 A;  1EU3 A;  1J8I A;  3WOF A;  5IP9 H;  1Y1W B;  1NNX A;  5M5W B;  4DR6 L;  2NVT H;  4DR1 L;  1ASY A;  4DU9 A;  1CHP D;  3CHB D;  4CHT B;  2PO4 A;  1PRT D;  5EJW A;  4LF5 Q;  1Q90 A;  1N33 L;  4K2L A;  4C1N K;  1LM0 A;  1EY4 A;  1CFM A;  2HGK A;  3HOY G;  3TQY A;  3A55 A;  3IAY A;  4DV2 L;  2ZRR A;  1GHJ A;  5KND A;  3NUC A;  1WCM G;  1HCZ A;  1BVS A;  1S5C D;  3HEJ A;  5IGE A;  1HR0 L;  4CDF C;  1B1Z A;  4EQO A;  4X64 L;  1B8A A;  1HHV A;  4DAV A;  1BO0 A;  5CV8 A;  5IGF A;  3E9H A;  4GLA C;  4DR4 Q;  1JWM D;  1V9P A;  3OMC A;  1E1T A;  3M4O B;  4DV6 Q;  1JOO A;  1UE1 A;  2RDH A;  3H15 A;  4DV5 Q;  4TQU S;  2JA9 A;  5G3L D;  4WFN 3;  1E2W A;  3R93 A;  2JB3 A;  2AQ3 B;  1HTP A;  3GTL B;  3GTP H;  4HAE A;  2H5X A;  3K8A A;  4LUO A;  4XQN A;  4OX9 Q;  4C1N I;  1STE A;  5KYI A;  2B2Y A;  4HJ9 A;  1WTQ A;  1SNQ A;  2ALY B;  3LWU A;  5K36 H;  2B2U C;  2WKD A;  4A3J B;  1EY9 A;  1LUZ A;  1B53 A;  1DOL A;  3OIQ A;  5M3M G;  2HQL A;  1O7L A;  5ISR A;  1RDP D;  4HED A;  1JOR A;  2RHQ B;  1K3B C;  2K50 A;  1EYC A;  3MZ5 A;  4X65 Q;  3EJI A;  1SXT A;  1PYB A;  4AYB G;  3CQZ B;  4ZUJ A;  2OXP A;  5J22 A;  2F0V A;  4LF5 L;  3I91 A;  3K6O A;  2RHS B;  3I55 A;  2NB0 A;  2QCP X;  1XX8 A;  3ULP A;  2FFK B;  4YIJ A;  1BF4 A;  1FNW A;  3KDF B;  3PO3 H;  2KVM A;  1RIP A;  2B8G A;  1RJT A;  4HSV A;  3F2D A;  4IPD A;  4DF7 A;  3AB9 A;  1HNZ L;  3HOZ H;  4A3G G;  4LFB L;  5L37 A;  1NMF A;  5IYC G;  2R93 G;  4HCE A;  2VS1 A;  4OIK A;  3TME A;  2VNU D;  2UUB Q;  4FO2 A;  1YHB A;  4RH6 A;  4LF6 L;  5CMD A;  1IYU A;  4A76 A;  4DR4 L;  4A93 B;  5EKL A;  1AH9 A;  1FGB D;  1VQM A;  4BY7 B;  4DV6 L;  1TQO A;  1X65 A;  1OXT A;  1CM9 A;  4G57 A;  2EY6 A;  2AHO B;  3CAM A;  2Z6K A;  5ELE A;  1E22 A;  3H0G H;  3HOU B;  2A68 C;  2OEO A;  4OX9 L;  1HH2 P;  2NVQ H;  4IOA A;  2E75 C;  2QF7 A;  3LJ2 A;  1H9S B;  4XT3 B;  1JB7 A;  4OO1 H;  1NCV A;  3G7L A;  1KDA A;  4DK3 C;  5IE8 A;  3BZC A;  1SNO A;  4R8N A;  3FVQ A;  1PH7 A;  3E0J A;  1LTS D;  1WD1 A;  1VQE A;  2P22 B;  4X65 L;  1Q8I A;  3WDN A;  3MEF A;  4O2D A;  4GNX C;  1Y1W H;  5M5W H;  1PH3 A;  2F0N A;  3D0F A;  1DJR D;  4DNI A;  2A74 C;  3QOJ A;  1VMC A;  3M85 A;  4KN4 C;  4ZRZ A;  3QWN A;  3RUZ A;  2A6E D;  5D3D A;  1V8Q A;  2RCF A;  2JJQ A;  1PDQ A;  2NZH A;  1XMO L;  2M2L A;  2WIN B;  4ABN A;  3HOV B;  3UIT A;  1DYQ A;  4P2C B;  1VQ5 A;  1SN8 A;  1ASZ A;  3SEB A;  3KOJ A;  1EZ6 A;  1CZG A;  4JI2 Q;  4OEL B;  3UDX A;  4PG3 A;  2BDO A;  3SVM A;  2R92 B;  2UUB L;  3PSI A;  5IOD A;  1KC8 C;  4X3U A;  4O1N A;  3S2D B;  4PL4 A;  5LMN L;  4A3E B;  2FJ2 A;  2IT1 A;  1MHW C;  4IN3 A;  1B3A A;  1TY2 A;  4G7H C;  1QZG A;  3M4O H;  3QJY A;  1XMQ Q;  1CUK A;  2Z9H A;  1ML0 D;  4LFC Q;  1CZW A;  4GN4 B;  4KKU A;  5CYU A;  2R7D A;  4KY7 A;  4DPG A;  1II3 A;  3HKZ E;  4N8X 1;  1EQR A;  1FYC A;  1PRT C;  1NSN S;  1I3Q B;  2MHV A;  3PIO 3;  2O5I C;  4JBW A;  4A3J H;  2PYK A;  4ZYS A;  3D4R A;  1XJV A;  3PUY A;  2NN6 G;  2J4X A;  1PH8 A;  4OWT B;  2NZ1 D;  4K2K A;  2MJF B;  4XYO A;  1SR3 A;  3M4Q A;  4NDX A;  3QOL A;  1G8Z D;  3CQZ H;  3I56 A;  3VA7 A;  2PW7 A;  4LF7 L;  2AQ2 B;  2ATW A;  4OAV B;  4FDB A;  5KNB A;  4KTA A;  3SXH A;  4POG A;  3SK5 A;  5A2Q L;  3I4L A;  3VA9 A;  2EYJ A;  2G9H D;  1EY8 A;  4CDD C;  2B2W A;  1PXU A;  5C0X J;  4A3M G;  4LFA Q;  1SND A;  4GLX A;  1A8V A;  1PV4 A;  1EOV A;  2B2T A;  2IJ0 A;  1G91 A;  2EDG A;  4Q0F A;  4J6H A;  1X3P A;  1K8G A;  2Y0S B;  3KDF A;  2KHS A;  4KK7 A;  4TRD A;  5DEH A;  1N9W A;  3KJP A;  4G7O C;  1X3G A;  2FHT A;  2KOL A;  3EN2 A;  2B2V C;  1EYG A;  4A93 H;  4X62 L;  3MA2 B;  5ELB A;  4BY7 H;  5JJI A;  3W3A A;  2UXD Q;  4BY1 G;  4G76 A;  4FP5 D;  4CGY B;  3HOU H;  1QUQ B;  4E6I A;  3VYR A;  2E2I B;  1D1K A;  3T1Y Q;  4PL5 A;  1LAC A;  2BDN A;  4IFD H;  2HUG A;  1JE4 A;  3TP5 A;  5I6Y A;  3T1H L;  4CKC A;  5EKI A;  5HGQ A;  4X66 Q;  1DZ1 A;  2EYO A;  2O5J C;  4QJF A;  1PH6 A;  3DM1 A;  4JI6 Q;  1A15 A;  4EGV A;  3UDF A;  4XDX A;  3D4W A;  1ET6 A;  1RCV D;  4DR7 Q;  1UNS A;  4OWX B;  4JI0 L;  1H9S A;  1QNK A;  1YIT A;  1AP0 A;  4PL3 A;  1C4Q A;  1B50 A;  4FF3 A;  3W5O A;  3GQB A;  1YNN D;  2RF4 A;  1ESF A;  2QW7 A;  2DY7 A;  4LFA L;  3HOV H;  2JSO A;  4DUZ L;  1OXV A;  3BS1 A;  1D5Z C;  3L9A X;  3A74 A;  5ELC A;  1Z9F A;  4V19 0;  4EX5 A;  4PMC A;  4YZD A;  4GOP C;  2R92 H;  1E3P A;  1F2Z A;  3R8B A;  4OON A;  1YNX A;  1MGS A;  5GAE C;  1QJO A;  3AEV A;  3ICE A;  3S2D H;  1SMY D;  3S2H B;  1GUO A;  2KHI A;  4A3E H;  1SJE D;  3BVM A;  3J7Y W;  3L0O A;  2UXD L;  3H94 A;  1ENF A;  3NE5 B;  4KKT A;  4JK1 C;  1XTD A;  4PV1 C;  3UDG A;  1QB5 D;  1Z47 A;  4A3C G;  1BQQ T;  4NPS A;  2F4V Q;  4DAM A;  2CVR A;  4R4I A;  3T1Y L;  4IPG A;  2JA6 G;  2JA5 G;  3PF5 A;  1I3Q H;  2F0D A;  2BL7 A;  2A6E C;  3ERS X;  2VXW A;  5NUC A;  3JAM c;  5C3E G;  2K28 A;  4X66 L;  1EY7 A;  1LTA D;  1Y69 U;  2XVS A;  2F6M B;  3O13 A;  5FO9 B;  5BN5 A;  4IJH A;  3KLR A;  3DA3 A;  2A73 B;  2EXZ A;  4RGT A;  1K73 C;  1PTO D;  2F0F A;  2F0P A;  4DR2 Q;  2I07 B;  4RHS A;  1SYF A;  2D0O A;  1JT8 A;  5KIX A;  2K5W A;  1TWC B;  2RQX A;  1HZ9 A;  1DON A;  1Q82 C;  3OMG A;  4A3D G;  5JEA H;  2F0O A;  1YHQ A;  1JB3 A;  1AEX A;  2MFI A;  2RKS A;  4OAU C;  4R4Q A;  1TT2 A;  4CJ1 B;  4RGO S;  1X6O A;  1Y1V B;  2IL8 A;  2R6G A;  1W2B A;  2PQA B;  3TRZ A;  1H9J A;  1CI3 M;  4YZC A;  2JEB I;  1TY0 A;  4IUN A;  1LTL A;  1A3U A;  1D5X C;  1D6E C;  4JI1 Q;  4HMI A;  2G9D A;  1J6Q A;  4KD3 A;  3CCM A;  1AN8 A;  3S24 A;  4NV2 A;  3DEO A;  4H02 A;  4P75 A;  4J8Q A;  4DV0 Q;  2OF1 A;  1QOH A;  4JG2 A;  5D65 A;  2Q2T A;  2QZG A;  4JI3 Q;  1CA5 A;  1VDZ A;  3PCO B;  1QG7 A;  4JC0 A;  4KLK A;  5T1I A;  2F4V L;  3I4M G;  3OWE B;  3BDL A;  2E2I H;  1T5X D;  5HGT A;  4K8J A;  4C3J G;  5HY6 A;  1X56 A;  3TN2 A;  1SBB B;  4DKA C;  1U4M A;  1SJ8 A;  4C3H B;  3S1Q B;  3I4N B;  3PO2 G;  4A3B B;  5BN4 A;  4APV A;  5CV5 A;  3CCS A;  2F0S A;  5C0X H;  3K7A B;  3MTS A;  1QUQ A;  2MJ8 A;  3N52 A;  3LNN A;  1PHJ A;  3PUW A;  3PIP 3;  3TSS A;  3ND9 A;  1B9N A;  5C3W A;  2KCN A;  4ZLT F;  4N8F A;  2GVA A;  3T51 B;  3T13 A;  2V4D A;  3TS0 A;  3K0X A;  5M3F B;  4ZUI A;  2XMX A;  1I6H B;  1CKO A;  2K4K A;  4KMU C;  4R4T A;  2JA7 G;  1IYV A;  3G6J B;  2E2D C;  3M4Y A;  2BE5 D;  2Y0S E;  2UUA L;  3A5Z B;  4IQZ A;  5IGC A;  2JE6 I;  1PZJ D;  2L4N A;  3PUV A;  3I8Z A;  5ELN A;  4JV5 Q;  1STB A;  4F8M A;  4ODG A;  2NTT A;  1EY6 A;  3IFT A;  3HGB A;  3A0J A;  2EIF A;  3S2H H;  3K5L A;  2G5D A;  4LJZ C;  5TSS A;  1WTO A;  5IP7 H;  4K0K Q;  1D8L A;  1HNW L;  3C1E A;  1L0W A;  2VQF Q;  5C4X B;  4JI3 L;  3BYT B;  1T5E A;  5F2D A;  1I94 L;  3J81 L;  4DR1 Q;  3J7A F;  3W1G A;  5C4H A;  1G51 A;  4GN5 A;  1A3T A;  1KAB A;  1F2Y A;  1N33 Q;  1MSH A;  5FJ8 G;  1IW7 D;  2KEN A;  2BL8 A;  1P16 A;  2C35 B;  5JPN C;  5GAD C;  1B70 B;  1EU4 A;  3OW2 A;  5IGD A;  4JBJ A;  3Q24 A;  1P8L A;  1I4G A;  5AFW A;  4ZCK A;  4JW0 A;  3CME A;  1PA6 A;  3S16 B;  4ZQ3 A;  1HR0 Q;  1NBW A;  2A69 D;  1TWC H;  4DXG A;  1PH4 A;  4NW2 A;  2R3Z A;  2O4X A;  5EGT A;  2JA8 G;  2EXD A;  3I3C A;  3W2D A;  1SMY C;  3SK8 A;  3S15 B;  2B2Y C;  1JJ2 A;  1ENC A;  1YHA A;  3GTQ B;  5IYD G;  3TBI B;  2A6H D;  4OO1 I;  4M1U B;  3BG3 A;  1GJX A;  1HR0 W;  2Z0S A;  4UP8 A;  1Q12 A;  3UE0 A;  1Y1V H;  3P75 A;  2F0G A;  2YFB A;  1DOK A;  5BN3 A;  1NR2 A;  2MP1 A;  2JYO A;  4JV5 L;  4KKS A;  2F0E A;  3X3N A;  2JAE A;  1BXT A;  4TSS A;  4DAP A;  1BDO A;  4G4K A;  4NB3 A;  1STA A;  3MAQ A;  1FVI A;  3EFX D;  1R4Q B;  4ME3 A;  1M8A A;  5KEE A;  2PCF B;  4M8A A;  1H9K A;  5EPJ A;  2YYZ A;  3U50 C;  4K0K L;  3WOE A;  3PIO A;  2A8V A;  3J81 i;  1WI5 A;  1YZ6 A;  2VQF L;  4PZ7 A;  3VDY A;  1PTO C;  3CC4 A;  3E9I A;  1TWF B;  4A3K G;  4KHP Q;  1I4H A;  3AQQ A;  2A1A A;  2RDG A;  1E24 A;  1S5B D;  3NHH A;  5T1G A;  2VW9 A;  1SLJ A;  4C3H H;  4A3B H;  3S1Q H;  1YIJ A;  3I4N H;  1Q1B A;  1EIG A;  4KHZ A;  5LMU Q;  1SNM A;  2QEX A;  5I2Y A;  1HNZ Q;  3K7A H;  1V1O A;  4EQP A;  4LFB Q;  1WTX A;  2L9H A;  3RLO A;  3VR4 A;  3M3Y B;  2Z6K C;  2BA1 A;  5M3F H;  4Z7H A;  3BDO A;  1I6H H;  4LF6 Q;  4DR5 L;  1JE5 A;  2F0I A;  4DA2 A;  3R2I A;  2ZJP A;  5LL6 S;  1IYJ B;  1G6P A;  3CRL C;  1H9M A;  2V6E A;  2DN8 A;  3QG1 A;  2YTY A;  2Z6B A;  4HJA A;  4K14 A;  2F0L A;  3FKI G;  4GZY C;  3IRB A;  5CV6 A;  5EPL A;  3MFG A;  3I72 A;  4YCU A;  3ND8 A;  1KDC A;  3VYT A;  1KTK A;  1UE7 A;  2GSC A;  3ZYY X;  1KQS A;  1QZH A;  1MJC A;  1J5E Q;  1A63 A;  5FLX E;  1VQP A;  1JWU D;  4GKJ Q;  5J39 A;  3GTK B;  2TSS A;  1QNU A;  4A75 A;  5C4X H;  1LAB A;  3CCJ A;  3GDE A;  1IXR A;  1V1P B;  4KHP L;  1CHQ D;  1E1O A;  5BR8 Q;  3L7Z C;  4H13 C;  3EA6 A;  5IYB G;  2A2D A;  4IPC A;  1BKB A;  1OXU A;  2XNA C;  4IFD J;  4IPH A;  2SOB A;  3ERQ A;  3S14 B;  3MXN B;  1N36 Q;  4BBS B;  5LMU L;  2VUM B;  1SE4 A;  5FKA C;  3J80 L;  5JJL A;  2RLD A;  1L0X B;  2BE5 C;  4GNX B;  1XMO Q;  3GTO B;  1PFB A;  3MXU A;  1SRU A;  5KNC A;  3V2T A;  4C3I B;  1XPU A;  3KLW A;  4A3I G;  4X3S A;  3S16 H;  4RAU C;  5IT9 E;  3HFZ B;  2JN4 A;  3KBX A;  3VYS A;  2DJF C;  4HTH A;  1I4P A;  2UU9 Q;  1SNC A;  2ZJQ A;  2IX1 A;  1C0A A;  3EQL C;  1LYL A;  3K57 A;  2B3G A;  2DGY A;  5IP9 G;  5C3E B;  5LMN Q;  1K9M C;  3S15 H;  4XQQ A;  1BR9 A;  1HRJ A;  3OTO Q;  2ICE C;  3GTQ H;  3PUZ A;  3VYU A;  1VQB A;  4A4I A;  4P72 A;  4IFD I;  2EY5 A;  3P1H A;  2HHH Q;  2K5N A;  2AKW B;  1Y8P B;  5DLQ E;  5C5M A;  1BNZ A;  3ER0 A;  3GD7 A;  3T53 B;  3OYY A;  4FYD A;  5FLM H;  4LWC A;  1YJN A;  2IHF A;  5LMN W;  2DUD A;  3M4P A;  5C4Z A;  3DO9 A;  1UAP A;  5M5X B;  3NEN A;  3NPP A;  1J5E L;  1IW7 C;  3PUX A;  2ES2 A;  1EQT A;  4MNO A;  5COR A;  5CC4 A;  4GKJ L;  2MO0 A;  4AQY L;  3JAM L;  4DV1 Q;  4QMG A;  4RG1 A;  1S5E D;  4K5W A;  3CMA A;  5BR8 L;  1TWF H;  2B2W C;  2F0H A;  3CCL A;  4A3L H;  1VQH A;  4RA8 A;  4KY6 A;  5C6A A;  4DUY Q;  1PRT B;  1MJE A;  2B63 B;  4OWW B;  2B2T C;  3S1N B;  2A69 C;  1G2T A;  4O1O A;  2XRS D;  1VQI A;  5EQ0 A;  3J80 i;  4LF7 Q;  5JJZ A;  3CP0 A;  1N36 L;  3RMH A;  2WB1 B;  5JVH 3;  1AW7 A;  1ILQ A;  2A6H C;  3MHB A;  4MIU A;  1MSG A;  1S3O A;  4R4O A;  5FLX c;  1YBY A;  1KXL A;  3I4O A;  4UDU C;  3I7F A;  4A3F B;  1I50 B;  3M3Y H;  4DV4 Q;  2ZM6 Q;  2UU9 L;  1GD7 A;  2OQ0 A;  3Q0A A;  2Q2I A;  4MTK A;  1GUS A;  4FF2 A;  2HD3 A;  3J7A 5;  3LX0 A;  5GAH C;  1K28 A;  1D5M C;  3OTO L;  4G7Z C;  1IBM Q;  5JEA J;  1KDB A;  1Q3L A;  4K5V A;  4RGM A;  4X62 Q;  2HHH L;  1ICW A;  4JOI A;  4UP9 A;  4UHV A;  4H44 C;  3V96 A;  1EY5 A;  1B7Y B;  3HZX A;  2L0C A;  3P20 A;  4OIJ A;  1I6V C;  1PZK D;  1PYS B;  2F52 A;  3GTL H;  1PH1 A;  2K05 A;  4IUR A;  2JBW A;  3PO3 G;  1HFN A;  2N3S A;  5C44 B;  5IT9 c;  4X3K A;  2WAQ B;  4IUU A;  3NWS A;  1ZYR D;  3HOZ G;  3T1H Q;  3HOW B;  1HUN A;  4DV1 L;  2L1L B;  1H95 A;  1G6Z A;  4ZK9 B;  5I2X A;  3GTK H;  2LSS A;  3S17 B;  1H9R A;  4KN7 C;  3KP9 A;  4BA2 I;  4Z7G A;  2EYP A;  4DNR B;  3DWP A;  5LHY 1;  1Z7T A;  4DUY L;  2OQK A;  4JI0 Q;  2F0U A;  1G2S A;  2EY1 A;  3PIP A;  3E0E A;  2UXB Q;  2CHB D;  3U9S A;  3RD4 A;  3S1R B;  4HID A;  2E5L L;  2WKC A;  2PZT A;  3S14 H;  3HRZ C;  4BBS H;  1M4V A;  2CFM A;  3OIP A;  2VUM H;  1JQO A;  4DFA A;  2JQO A;  1V1P A;  2N55 A;  3AU7 A;  4ZAI A;  5CBE E;  4QQB X;  3H0G G;  4AS2 A;  1JR0 D;  3GTO H;  4DUZ Q;  1UEA B;  2FUG 1;  1GM5 A;  2D62 A;  4C3I H;  2XGT A;  2R7Z B;  2K5D A;  1PFS A;  4N9P A;  1M90 C;  4OO1 G;  4DV4 L;  2NVX B;  2ZM6 L;  3CXC A;  4B3R L;  3MXN A;  1LT6 D;  1KLG D;  2I5H A;  4O1P A;  3E5S A;  3HKZ G;  4GNX A;  4OXP A;  3CF5 A;  1IBM L;  1Y1W G;  5D3I B;  4BBR B;  2MQH A;  1X32 A;  1TS5 A;  3S9W A;  1AZP A;  1QE6 A;  5HGI A;  1HQM C;  3K5M A;  3TEH B;  4NXN Q;  3SK6 A;  4DAY B;  4Q9V A;  4GOP B;  4I1T A;  2K6A A;  5C0X I;  3T16 A;  2UXC Q;  1Q8K A;  4IJL A;  3F1Z A;  5M5X H;  2K5Q A;  4HMJ A;  1JCK B;  4IUP A;  1MI2 A;  3I90 A;  2A2C A;  2D9U A;  1KAA A;  3H6M A;  1S5F D;  1XXG A;  1CKM A;  2PMZ B;  4JPB W;  5DAU A;  5AJ3 Q;  3AFQ A;  2F1M A;  2AWN A;  1VQD A;  3TP6 A;  1WOC A;  1O7Y A;  2B63 H;  2UXB L;  3S1N H;  3I70 A;  4LMQ D;  1WYD A;  2BH2 A;  1AFP A;  4TKO B;  3TZD A;  4AS3 A;  4WJ4 A;  3VR5 A;  1XYI A;  4XQJ A;  1TS4 A;  2E2J B;  3RZO B;  3KUP A;  1EIH A;  4DWL A;  1EWI A;  3HOX B;  3JC6 6;  2QSB A;  2EJM A;  2ID0 A;  1U5K A;  2MUY A;  2ZT9 C;  1RTN A;  4RKL A;  3NP8 A;  2P5Z X;  1B44 D;  3SDJ A;  1SE3 A;  3H09 A;  4A3F H;  1I50 H;  4A3J G;  4DN4 M;  2XTI A;  2DJG C;  2F03 A;  2UUC Q;  4JI5 L;  1BCP B;  1GHK A;  2BCO A;  5JJK A;  3Q22 A;  3QR8 A;  4NXN L;  3RLN A;  3HOY B;  3CPF A;  3ITP A;  2KKM A;  2WAC A;  3QIA A;  3Q23 A;  3GV6 A;  3H3V H;  1V43 A;  4L5S A;  3T56 B;  1WCM B;  3DA4 A;  1LV9 A;  2EQS A;  2UXC L;  4N9T A;  1Y8O B;  4GKK L;  4HIK A;  5C44 H;  1TWG B;  2FMM A;  2L55 A;  2AUJ D;  3HOW H;  2IW3 A;  2CH4 W;  3U58 A;  3K5O A;  5AJ3 L;  1VQL A;  3FPP A;  1VQ7 A;  2M9V A;  1SE2 A;  1ILP A;  2IX3 A;  3D4D A;  3S17 H;  1HJP A;  4ZKC B;  4LUZ A;  3IAS 1;  5A2Q E;  4DK0 A;  1TS3 A;  4RMF A;  1LTT D;  2XTQ A;  2KBN A;  2K7V A;  2L1B A;  1VQN A;  2AMC B;  1LTR D;  1NUC A;  5D14 A;  3CCR A;  1VQC A;  4YWL A;  4A93 G;  1ET9 A;  3S1R H;  2HIV A;  4MTN A;  4BY7 G;  4NMZ A;  4YY3 Q;  4EQ5 A;  2ETD A;  3CC2 A;  1ENA A;  1S4Z A;  4P74 A;  3OOC A;  1QCB D;  5IGB A;  5M3M B;  4C2M B;  3HOU G;  5GRO A;  4CDC C;  2UUA Q;  1VF5 C;  5DNF A;  2D2C C;  2R7Z H;  4IFD G;  1SSO A;  3A54 A;  2NVX H;  4L5T A;  3FRP B;  4ME5 A;  4AYB B;  1I4R A;  1QIL A;  4F7X A;  3H91 A;  5EKK A;  2UUC L;  1ZYR C;  1VQ8 A;  4O42 A;  1OXS C;  1L0Y B;  4BBR H;  3B6Y A;  2D5D A;  1K3R A;  1HNW Q;  1NMG A;  4RCO A;  1VQ4 A;  4MZ9 A;  2K19 A;  2WAQ E;  2KCM A;  1FD7 D;  1B2T A;  1EFW A;  4A3G B;  2NTS A;  5GAG C;  2SNS A;  1AZQ A;  1L1O B;  1I94 Q;  2R93 B;  1WTH A;  5CR3 A;  2XSC A;  3HOV G;  1EEI D;  2WII B;  5CBA E;  4F88 A;  1SYD A;  2EJF C;  4MN3 A;  4LK1 C;  4GOP A;  1CSP A;  1XPR A;  3KLS X;  4P71 A;  1W3S A;  4Y7N B;  3SDZ A;  1RTO A;  2KEC A;  3PGZ A;  4AIM A;  2PPB C;  2Z4I A;  1PH2 A;  3I73 A;  1HXY D;  2JB2 A;  4A3E G;  4YY3 L;  1ZXT A;  4YWK A;  4KI0 A;  1SAP A;  3EIV A;  2E2J H;  3RZO H;  3K7U C;  2E76 C;  1LTG D;  3MXP A;  4PZ8 A;  3HOX H;  2IWH A;  1IBL Q;  3ULJ A;  1ZKO A;  2N78 A;  4K6L A;  1EOT A;  2KED A;  4NXM Q;  1C7Y A;  2NUC A;  3F8T A;  4B9W A;  2KJX A;  1YI2 A;  4OL7 A;  2FEF A;  2OTL A;  3HG9 A;  4U68 A;  1EYA A;  2Z8L A;  2E8G A;  4HFV A;  1F9S A;  5FO7 B;  3E6Z X;  4DK6 C;  5E4W C;  2J0T D;  1IL2 A;  4WRD A;  2SDF A;  3HOY H;  1LT4 D;  1JMC A;  1PYW D;  1SYE A;  2R61 A;  2PI2 A;  4B3M L;  3RR5 A;  3MC0 B;  1NY4 A;  1WCM H;  2F0T A;  2CQO A;  2PMZ E;  1STG A;  2OTJ A;  3BU2 A;  5JEA G;  4POF A;  1NAP A;  3KLS A;  3G71 A;  1A0I A;  2YTV A;  2XWJ B;  3DMU A;  1B9M A;  2IHE A;  1TWG H;  1YNN C;  2K14 A;  3CRK C;  1TR5 A;  1STY A;  3K81 C;  5CV7 A;  2LKV A;  2CH4 A;  3TDQ A;  4ILW A;  1E2V A;  1PTO B;  3RNU A;  1EQQ A;  3D3R A;  2ZXP A;  1IBK Q;  4NV5 A;  1RHP A;  1K8A C;  2Y0S G;  2VZA A;  3A56 A;  3G48 A;  1SE8 A;  1I4X A;  2QGM A;  1U4P A;  2A19 A;  2BOS A;  3MEH A;  3SE0 A;  4U67 3;  2H1E A;  2NWG A;  1FR3 A;  3FMC A;  1F77 A;  1Q7Y C;  5C3X A;  4IUV A;  3J7A V;  4YHH L;  1GOZ A;  4DR5 Q;  1UWV A;  4LAA A;  1I4Q A;  3HOZ B;  2AUK A;  4DR3 L;  1IBL L;  2PI2 E;  3URY A;  1XNR Q;  5M3M H;  4C2M H;  3FP9 A;  2H4O A;  2GN5 A;  4NXM L;  5JOB A;  1S5D D;  2MO1 A;  1A3V A;  2PNH A;  2E2H B;  2FIN B;  3UDI A;  2RIO A;  1KNE A;  5C0X G;  2ICI A;  4CJ0 B;  3VR6 A;  1AE3 A;  1LT5 D;  2WP8 J;  4QB4 A;  4JYA Q;  4BXX G;  2PNR C;  1RD9 D;  2PQA A;  1N34 Q;  5DM7 3;  4KY5 A;  3D8G A;  1DD2 A;  1V1Q A;  3GTJ B;  4A3M B;  1U4R A;  3N6R A;  2VL6 A;  1XPO A;  3GTG B;  4A3G H;  3IL8 A;  4K8I A;  2BH8 A;  3FHW A;  1O78 A;  3CPW A;  1HNX Q;  5IYC H;  1C48 A;  1EEF D;  3C46 A;  2IY5 B;  3DXJ C;  1A62 A;  2R93 H;  4PNY A;  1EWC A;  3M7N A;  1DGS A;  1CSQ A;  3A7A B;  1TS2 A;  3DWA A;  5IOC A;  4IAL A;  1Z6H A;  5GQO A;  2K5V A;  4FXD A;  2RAD A;  5K5P A;  4RWS C;  3HKZ B;  3VR3 A;  2Z4H A;  2ZW3 A;  2XRQ D;  1IBK L;  1L1O A;  1KRT A;  1X54 A;  3U9O A;  4BY1 B;  4DNT B;  4JI4 Q;  4Y7N H;  1WTR A;  3NQT A;  5I4D A;  2SEB D;  3PMF A;  5EAY A;  4FNF A;  1K8M A;  4ZKB B;  5DM6 3;  4HCS A;  5IP7 G;  1PZI D;  5IGG A;  2YU9 B;  1EIY B;  2LY7 A;  4L63 B;  3WWV A;  4B3S L;  1K0R A;  1XNR L;  1K83 B;  1BBU A;  3DUZ A;  1D2B A;  2JK8 A;  4AYB E;  1TXY A;  1VMP A;  3L2P A;  4R1J A;  1STH A; 
#chains in the Genus database with same CATH homology
 4B3T L;  5GAH C;  4YZD A;  2JB1 A;  3OTO L;  1L2F A;  5JEA J;  4GOP C;  1IBM Q;  1XNQ L;  2R92 H;  4X62 Q;  1E3P A;  2IX0 A;  4JOI A;  2HHH L;  2HIX A;  3U4Z A;  3DM3 A;  4OON A;  1YNX A;  4UP9 A;  3LJ0 A;  5C4J H;  1KHI A;  2I5M X;  4YWM A;  1B7Y B;  5GAE C;  4HIM A;  4HJ8 A;  3AEV A;  3ICE A;  2R7F A;  3L0I A;  2F52 A;  3S2D H;  1PYS B;  2KHI A;  1SRO A;  4TVA B;  3PV0 A;  4A3E H;  3G4S A;  4JYA L;  1XNR L;  1UEB A;  4JI8 L;  3W1B A;  3L0O A;  4AQY Q;  4QGU A;  1PH1 A;  4JI1 L;  1N34 L;  1L1O C;  2UXD L;  3PO3 G;  4GXT A;  2N3S A;  1XTD A;  2HT1 A;  5IT9 c;  3UDG A;  1QVC A;  3K80 C;  1Z47 A;  3HOZ G;  4UPA A;  3T1H Q;  3DLL A;  4A3C G;  4DV1 L;  2L1L B;  4DV0 L;  1JJC B;  1NJI C;  1HNX L;  4WJ3 M;  4NPS A;  2F4V Q;  4DAM A;  2AWO A;  3LGJ A;  4R4I A;  3T1Y L;  3GTK H;  4IPG A;  2JA6 G;  2JA5 G;  3PF5 A;  2LSS A;  2R7Z G;  2V1C C;  3FBV A;  1I3Q H;  4DR6 Q;  3ERS X;  3KP9 A;  1OTC A;  4BA2 I;  4Z7G A;  5ELO A;  3JAM c;  5C3E G;  4HEA 1;  4X66 L;  4GLV B;  2JEA I;  2I5L X;  4O0A A;  1M1K C;  4DUY L;  1I5F A;  1X3E A;  2OQK A;  3AFP A;  1HZC A;  4JI0 Q;  2F6M B;  1U0L A;  5H1S E;  1Y1V G;  3FKI H;  3PIP A;  4IJH A;  3E0E A;  3DA3 A;  1VCI A;  4DV3 Q;  2UXB Q;  1K73 C;  2NN6 I;  4LNQ A;  3GTM H;  4J15 A;  3CC7 A;  4HID A;  2E5L L;  4BBR G;  4JI4 L;  1G29 1;  3S14 H;  4DR2 Q;  4JOI C;  4BBS H;  1VQG A;  1GVP A;  1X3F A;  2CFM A;  2D0O A;  4B3S Q;  2VUM H;  1JT8 A;  2JQO A;  4QQB X;  2KHJ A;  4AS2 A;  1HZ9 A;  3CW2 C;  3H0G G;  3SGI A;  3GTO H;  4DUZ Q;  4DV2 Q;  2FUG 1;  4LF8 Q;  1Q82 C;  1GM5 A;  2D62 A;  4C3I H;  2XGT A;  1VQO A;  3GTL H;  4A3D G;  3D31 A;  1VQ6 A;  4OO1 G;  1PFS A;  1M90 C;  4DV4 L;  1GKH A;  2ZM6 L;  3CXC A;  1YHQ A;  4B3R L;  2MFI A;  1AE2 A;  3RN2 A;  4OAU C;  4R4Q A;  4X64 Q;  3F4M A;  3CCQ A;  1X6O A;  2I5H A;  2R6G A;  1W2B A;  4O1P A;  2PQA B;  5IYB H;  1VQ9 A;  4GNX A;  3HKZ G;  3TRZ A;  4XIG S;  4K0K L;  4OXP A;  3CF5 A;  4YZC A;  1IBM L;  2QGQ A;  2JEB I;  4YCV A;  1Y1W G;  4GS3 A;  4G75 A;  2MQH A;  4BA1 I;  4QIW E;  1LTL A;  1PVO A;  1QVG A;  4A3B G;  2F3I A;  4JI1 Q;  5IY0 A;  2VQE Q;  3I4N G;  2E2H H;  2F66 B;  5HGI A;  1J6Q A;  3TEH B;  3CCM A;  1KD1 C;  3S24 A;  2CCZ A;  4NXN Q;  4NV2 A;  1RL2 A;  4DAY B;  2ASB A;  4H02 A;  4P75 A;  4Q9V A;  4GOP B;  5J3B A;  4I1T A;  4JCV E;  2YTX A;  3KJO A;  5C0X I;  2D0P A;  1IZ6 A;  4DV0 Q;  4DV5 L;  4JG2 A;  2Q2T A;  4A3I H;  4QY7 A;  2UXC Q;  4R4C A;  1Q8K A;  4IJL A;  3F1Z A;  1E7Z A;  1MKH A;  4JI3 Q;  4X6A H;  5M5X H;  3GTJ H;  4A3M H;  4JBK A;  2YFA A;  3KYH C;  3PCO B;  5IWA Q;  3GTG H;  4JC0 A;  4KLK A;  3HOX G;  1T9H A;  1YJW A;  2F4V L;  3I4M G;  5M3F G;  4IO9 A;  2L15 A;  2A2C A;  2XTR A;  2K52 A;  2E2I H;  3PF4 A;  5AJ3 Q;  1CKM A;  5IP9 H;  4DR6 L;  5HY6 A;  1X56 A;  4JBM A;  3AFQ A;  4DKA C;  2NVT H;  2AWN A;  1SJ8 A;  2E5L Q;  4DR1 L;  1ASY A;  3PO2 G;  4APV A;  1VQD A;  4GN3 B;  3CCS A;  1WOC A;  2B63 H;  2UXB L;  3S1N H;  4DV3 L;  1WYD A;  2CKZ B;  2BH2 A;  4LF5 Q;  3J81 c;  1N33 L;  2LXJ A;  4AS3 A;  1QUQ A;  2NZO A;  1KXL A;  4WJ4 A;  1PHJ A;  1KAW A;  1LM0 A;  3PUW A;  1BBW A;  2FXQ A;  1OXX K;  4BY1 H;  3KF8 B;  3AYH B;  3HKS A;  4DWL A;  3HOY G;  1EWI A;  2GVA A;  3TQY A;  5K36 G;  1X9N A;  4DV2 L;  2ZJQ A;  4B3R Q;  3JC6 6;  3TS0 A;  1C0A A;  3K0X A;  2ZRR A;  1WFQ A;  4LF8 L;  2XMX A;  2YU9 H;  1CKO A;  2ID0 A;  1U5K A;  3I9V 1;  2K4K A;  4HJ7 A;  1WCM G;  3GO5 A;  4LF9 Q;  4R4T A;  1BVS A;  2JA7 G;  3H3V I;  2Q2U A;  5C4X G;  1HR0 L;  3SDJ A;  4A3F H;  1I50 H;  1K83 H;  2Y0S E;  4X64 L;  4A3J G;  1FJG Q;  2UUA L;  2XTI A;  1B8A A;  4QL5 A;  3A5Z B;  2UUC Q;  4JI5 L;  4LW1 A;  2JE6 I;  3E9H A;  4LFA L;  4GLA C;  4DR4 Q;  1V9P A;  3PUV A;  1E1T A;  2WFW A;  5ELN A;  2VQE L;  4DUZ L;  4DV6 Q;  4JV5 Q;  5JJK A;  4NXN L;  3RLN A;  3JAM i;  1UE1 A;  3H15 A;  4DV5 Q;  3CPF A;  2KKM A;  4HJ5 A;  4LF4 Q;  3M9B A;  1FGU A;  4TQU S;  2JA9 A;  2JB3 A;  3A0J A;  2EIF A;  3S2H H;  3GTP H;  3P23 A;  4LUO A;  1YEZ A;  2H5X A;  3K8A A;  1V43 A;  3NBH B;  5IP7 H;  1D8L A;  4DV7 Q;  4L5S A;  4OX9 Q;  3H3V H;  4K0K Q;  1HNW L;  3DA4 A;  2UXC L;  2EQS A;  4HJ9 A;  1L0W A;  2VQF Q;  4JI3 L;  4HIK A;  4GKK L;  2ALY B;  5C44 H;  1YJ9 A;  5IWA L;  3CD6 A;  1LUZ A;  1I94 L;  4LUV A;  4DR1 Q;  5M3M G;  3HOW H;  2HQL A;  3CCE A;  3U58 A;  5AJ3 L;  1VQL A;  3W1G A;  2IP6 A;  1G51 A;  2GVB A;  4GN5 A;  1VQ7 A;  2RHQ B;  2K50 A;  4X65 Q;  3S17 H;  1HJP A;  3BZK A;  4LUZ A;  1N33 Q;  3IAS 1;  1X55 A;  5FJ8 G;  2KEN A;  1P16 A;  1PYB A;  2C35 B;  4RMF A;  4JI7 Q;  4AYB G;  2XTQ A;  2B29 A;  2KBN A;  2N8N A;  1VQN A;  2AMC B;  2I0Q A;  4P73 A;  5GAD C;  3CCR A;  1B70 B;  4LF5 L;  2RHS B;  3EBE A;  3I55 A;  2K5H A;  1VQC A;  4YWL A;  4JBJ A;  3OW2 A;  5FLM G;  3RN5 A;  3S1R H;  4A93 G;  2HIV A;  3ULP A;  4MTN A;  1S72 A;  1P8L A;  4BY7 G;  3KDF B;  4YY3 Q;  4EQ5 A;  1PA6 A;  1RIP A;  3CME A;  3PO3 H;  3CC2 A;  3F2D A;  4IPD A;  4P74 A;  1SFO H;  1HR0 Q;  1NBW A;  1PH4 A;  1TWC H;  1HNZ L;  3HOZ H;  4A3G G;  4A3C H;  4LFB L;  2CAZ B;  1NTG A;  5E7N A;  4ALP A;  3HOU G;  1NMF A;  5GRO A;  2EXD A;  2JA8 G;  5IYC G;  4LF9 L;  2UUA Q;  2JA6 H;  2JA5 H;  2R93 G;  2R7Z H;  1JJ2 A;  4JI5 Q;  1YHA A;  2VS1 A;  3A5U A;  2NVX H;  4IFD G;  5C3E H;  4L5T A;  5IYD G;  1FJG L;  1R9T H;  3IAM 1;  4A3L G;  4OO1 I;  2VNU D;  2UUB Q;  1YHB A;  4LF6 L;  1HR0 W;  2Z0S A;  4UP8 A;  2UUC L;  1CKN B;  1Q12 A;  1Y1V H;  3UE0 A;  4A76 A;  2RCN A;  4JI2 L;  1VQ8 A;  2YFB A;  1OXS C;  4DR4 L;  1AH9 A;  1VQM A;  3STB D;  4L5Q A;  4BBR H;  4JV5 L;  4DV6 L;  3S1M H;  1Q86 C;  1X65 A;  3B6Y A;  2JAE A;  1K3R A;  1OXT A;  4NB3 A;  1HNW Q;  1NMG A;  4LF4 L;  1FVI A;  4ME3 A;  4MZ9 A;  1VQ4 A;  2K19 A;  2AHO B;  2WAQ E;  2KCM A;  2Z6K A;  3CAM A;  1EFW A;  1E22 A;  4GKK Q;  3H0G H;  1UE5 A;  5GAG C;  1EIF A;  2YYZ A;  3U50 C;  4OX9 L;  3F2C A;  4DV7 L;  2CWA A;  1L1O B;  1HH2 P;  1I94 Q;  2NVQ H;  3PIO A;  4IOA A;  1XMQ L;  2A8V A;  3J81 i;  3LJ2 A;  1WI5 A;  1YZ6 A;  2VQF L;  4A3D H;  3BJU A;  4PZ7 A;  1PH5 A;  2NVY H;  3VDY A;  1JB7 A;  3CC4 A;  4LFC L;  3E9I A;  3NEL A;  4DK3 C;  5IE8 A;  3BZC A;  4A3K G;  1PH7 A;  3HOV G;  4KHP Q;  1Q46 A;  4AH6 A;  1VQE A;  1N32 Q;  2P22 B;  1YO7 A;  3KF6 B;  1VQK A;  3AQQ A;  2A1A A;  2YV5 A;  4X65 L;  2ZTC A;  3MEF A;  4O2D A;  4GNX C;  4GOP A;  1E24 A;  5M5W H;  1Y1W H;  1PH3 A;  1CSP A;  1GO3 E;  2VW9 A;  3D0F A;  1XPR A;  1SLJ A;  4C3H H;  4JI7 L;  1QVF A;  4P71 A;  1W3S A;  4A3B H;  1YIJ A;  3I4N H;  1Q1B A;  3S1Q H;  4DNI A;  3PGZ A;  4AIM A;  4KHZ A;  5LMU Q;  3M85 A;  4YZ9 A;  1PH2 A;  4PMW A;  2QEX A;  3RLF A;  3UE1 A;  2OWO A;  2JB2 A;  4A3E G;  1HNZ Q;  3K7A H;  1VQJ A;  5LNK 1;  1C9O A;  4YY3 L;  4IOC A;  4LFB Q;  2JJQ A;  4YWK A;  2NZH A;  4KI0 A;  3RLO A;  3EIV A;  2E2J H;  3RZO H;  3K7U C;  1XMO L;  2Z6K C;  3UIT A;  2BA1 A;  4PZ8 A;  5M5Y H;  3HOX H;  3I4M H;  1JJG A;  1IBL Q;  1SN8 A;  5M3F H;  1VQ5 A;  4Z7H A;  1ASZ A;  1I6H H;  3ULJ A;  3J80 c;  1TWA H;  4LF6 Q;  3KOJ A;  1H95 A;  4DR5 L;  4C3J H;  1JE5 A;  2N78 A;  4JI2 Q;  3UDX A;  2ZJP A;  4PG3 A;  2ZTE A;  4NXM Q;  1C7Y A;  3F8T A;  1IYJ B;  1G6P A;  2UUB L;  3PO2 H;  2V6E A;  3PSI A;  1YI2 A;  1KC8 C;  2YTY A;  4HJA A;  2OTL A;  3FKI G;  4PL4 A;  5LMN L;  2E8G A;  4HFV A;  3IRB A;  2IT1 A;  4DK6 C;  2QA4 A;  1QZG A;  3G6E A;  4YCU A;  3M4O H;  1IL2 A;  1XMQ Q;  1CUK A;  4BBS G;  1UE7 A;  1VQF A;  2VUM G;  1KQS A;  3HOY H;  1JMC A;  1QZH A;  1MJC A;  4LFC Q;  1J5E Q;  4GN4 B;  1A63 A;  2R7D A;  3LJ1 A;  2PI2 A;  4B3M L;  1VQP A;  3RR5 A;  4DPG A;  4GKJ Q;  3J7Z C;  1NY4 A;  3HKZ E;  3HOV H;  1EQR A;  1WCM H;  1EUJ A;  2CQO A;  2PMZ E;  2JA7 H;  2Q2H A;  4A75 A;  3BU2 A;  4U6R A;  5C4X H;  4POF A;  5JEA G;  2OTJ A;  3CCJ A;  3GDE A;  1IXR A;  3G71 A;  1A0I A;  1KL9 A;  2YTV A;  4KHP L;  2IHE A;  4JBW A;  1E1O A;  1TWG H;  5BR8 Q;  2K14 A;  4A3J H;  1N32 L;  2WB1 E;  3K81 C;  3L7Z C;  1FL0 A;  1XJV A;  3PUY A;  2NN6 G;  2ZTD A;  1PH8 A;  5IYB G;  4OWT B;  2A2D A;  4IPC A;  3RNU A;  1EQQ A;  2MJF B;  3KFU A;  1BKB A;  1MIU A;  1OXU A;  1SR3 A;  4IFD J;  4IPH A;  1YVC A;  4NV5 A;  3M4Q A;  1IBK Q;  3RZD H;  3MXN B;  1N36 Q;  1K8A C;  2Y0S G;  4JI6 L;  5LMU L;  2VZA A;  3CQZ H;  3I56 A;  3G48 A;  5JJL A;  4UP7 A;  1SE8 A;  4GNX B;  2A19 A;  1XMO Q;  1HZB A;  4LF7 L;  2ATW A;  4OAV B;  4FDB A;  1KRS A;  1SRU A;  4DR7 L;  2LXK A;  2ZJR A;  1Q7Y C;  1N8R C;  4POG A;  4EX5 A;  2N49 A;  4YHH L;  1XPU A;  3KLW A;  4DR5 Q;  4PZ6 A;  4A3I G;  3VA9 A;  1UWV A;  3S16 H;  3HFZ B;  1Y14 B;  2OCE A;  5C0X J;  4A3M G;  4DR3 L;  4LFA Q;  2PI2 E;  4A3K H;  1Q81 C;  1IBL L;  1XNR Q;  1TWH H;  5M3M H;  4GLX A;  1A8V A;  4C2M H;  1PV4 A;  1EOV A;  1WJJ A;  3FP9 A;  2UU9 Q;  2IX1 A;  1LYL A;  1PH9 A;  2B3G A;  3TS2 A;  2DGY A;  5IP9 G;  2GN5 A;  4NXM L;  5LMN Q;  1K9M C;  4B3T Q;  3S15 H;  2MO1 A;  2VY3 A;  3ULL A;  3PUZ A;  3OTO Q;  3GTQ H;  2PNH A;  4Y52 H;  1K8G A;  1VQB A;  4A4I A;  5FJ8 H;  4P72 A;  3KDF A;  1XNQ Q;  4IFD I;  2HHH Q;  2K5N A;  3J81 j;  2AKW B;  3UDI A;  2RIO A;  1N9W A;  5DLQ E;  2B63 G;  5C0X G;  3KJP A;  3ER0 A;  1X3G A;  3GD7 A;  3OYY A;  1EYG A;  1HZA A;  3EN2 A;  4A93 H;  1AE3 A;  4LWC A;  5FLM H;  1YJN A;  2WP8 J;  4X62 L;  4UY8 C;  4JYA Q;  2IHF A;  4B3M Q;  4BY7 H;  4BXX G;  4XTC S;  4JI8 Q;  5JJI A;  2UXD Q;  5LMN W;  2PQA A;  1N34 Q;  4BY1 G;  2DUD A;  3M4P A;  2KCT A;  2WB1 G;  3DO9 A;  2CWP A;  3M3Y H;  4G76 A;  1V1Q A;  1J5E L;  3NEN A;  3PUX A;  2ES2 A;  2VL6 A;  1XPO A;  4A3G H;  4MNO A;  4GKJ L;  2MO0 A;  4AQY L;  1VS0 A;  2BH8 A;  3HOU H;  3FHW A;  1QUQ B;  4YCW A;  3CPW A;  4DV1 Q;  3AJF A;  2JA8 H;  1HNX Q;  5IYC H;  1KIX A;  1CKN A;  2IY5 B;  2R93 H;  1A62 A;  3T1Y Q;  3ZJY C;  4PL5 A;  4L5R C;  4RG1 A;  1Q1E A;  1DGS A;  1CSQ A;  3M7N A;  3NEM A;  3Q8D A;  3T1H L;  3CMA A;  5GQO A;  1TWF H;  5BR8 L;  4A3F G;  5IYD H;  4A3L H;  3CCL A;  5HGQ A;  2K5V A;  4X66 Q;  3CCV A;  4HIO A;  2R92 G;  1VQH A;  4QJF A;  4DUY Q;  1PH6 A;  1VQA A;  1O7I A;  1MJE A;  4JI6 Q;  4OWW B;  3UDF A;  4O1O A;  1VQI A;  3I2Z A;  3J80 i;  2MNA A;  3CCU A;  1IBK L;  4LF7 Q;  1D7Q A;  1L1O A;  3CP0 A;  1KRT A;  1X54 A;  1N36 L;  4DR7 Q;  4OWX B;  4JI0 L;  4JI4 Q;  4Y7N H;  4YHH Q;  2K75 A;  3JSB A;  1YIT A;  5EAY A;  4PL3 A;  1S3O A;  4R4O A;  5FLX c;  1YBY A;  3KF6 A;  3I4O A;  5IP7 G;  4DR3 Q;  4BXX H;  4DR2 L;  1EIY B;  1NE3 A;  3W5O A;  3WWV A;  4B3S L;  3I7F A;  2RF4 A;  3STB C;  1S40 A;  5C44 G;  1K0R A;  2WAQ G;  4DV4 Q;  1BBU A;  1SMX A;  3U4V A;  2ZM6 Q;  1OXV A;  1GD7 A;  2OQ0 A;  2JK8 A;  3TRE A;  4AYB E;  1TXY A;  2Q2I A;  3F2B A;  2UU9 L;  3HOW G;  3L2P A;  4R1J A;  1UE6 A;  3A74 A;  1Z9F A;  2BA0 A;  3J7A 5; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...