3Q8DA

E. coli reco complex with ssb c-terminus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
231
Chain Sequence
b'EGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair protein recO
publication title Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 67
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3q8dA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3q8dA01
3HFZB 4LUOA 1MJCA 1PH7A 4LFAL 2B63G 3G4SA 2B63H 4TQUS 5IYDG 1HZBA 2Q2IA 5IYDH 2Q2TA 2UUCL 5C4JH 2ZM6L 4DV2L 2WAQE 1VQDA 3CP0A 1RIPA 2CFMA 1VQ8A 1JT8A 3PUXA 1PYBA 3RN5A 2IY5B 1E1OA 3UE1A 1QUQB 1YI2A 1OXVA 2B3GA 3LGJA 3S1RH 4A3BG 5LMNL 1Z47A 3U58A 1B70B 4K0KQ 4L5QA 1X9NA 1XPUA 1IYJB 4DR5Q 2BH2A 1HZCA 1XNRL 1QVGA 1VQCA 3AQQA 4H02A 4BA1I 3ULJA 3HOUG 2UUBQ 1N32L 3HOUH 1XMQL 2Z6KA 1NY4A 2A19A 2IHFA 4YWLA 3CCVA 2FXQA 2HIVA 1XMOQ 4JI3Q 2K5NA 1CSQA 1EIFA 1OXSC 1Y1WG 4EQ5A 1EYGA 2JA8H 5IWAQ 4KHPQ 2V1CC 1I5FA 2OQ0A 3PCOB 3H15A 3KF8B 4LNQA 3NEMA 5FLMH 2R6GA 5J3BA 1Y1VH 5M3MH 4DV3Q 1G6PA 4JI5Q 1VQPA 4QQBX 2MQHA 4IFDI 1YHAA 3KYHC 5IYCG 5IYCH 5E7NA 3A5ZB 2E2IH 2XTIA 1XNQL 1YEZA 2HT1A 3M4QA 4R4QA 2KCMA 4C3HH 1W2BA 3G71A 5M5XH 2JJQA 3DLLA 3ZJYC 1Q8KA 2ID0A 2K52A 2NVYH 1J5EQ 4A3KH 1D8LA 4LWCA 2VQFQ 3RN2A 2IX1A 3PF4A 1PVOA 1RL2A 3F8TA 1TWGH 3PSIA 1YNXA 4JOIC 2NN6G 4OO1I 2LSSA 1KL9A 4LFBQ 4DR5L 2E2HH 5AJ3L 3F2CA 4DR4Q 2I5HA 4JBJA 4GN3B 4BXXG 4OWXB 2QGQA 2YV5A 1N34L 3JAMc 2F3IA 1HR0L 4PG3A 2BA1A 1WJJA 4LFCL 4QGUA 3AYHB 4DUZL 4GKJQ 1IZ6A 3J81c 1IBKL 1QZGA 2LXJA 2IX0A 3G6EA 3PIOA 4X62L 4A3DH 4DR1L 2K50A 4JC0A 1GO3E 4A3GH 4RG1A 1XJVA 4A3CH 4DR6L 3NBHB 1G291 4DV5Q 5C0XG 1PH9A 1VQKA 2VUMG 1YVCA 2VUMH 1HNWQ 4NB3A 4JI7L 3S1QH 3I4NG 4DNIA 3WWVA 4IJLA 4LF9L 3TEHB 3GO5A 4B3TQ 1EWIA 4P71A 2CCZA 4JI4L 2PMZE 4EX5A 4DPGA 2K4KA 1Q86C 3PF5A 2ZJRA 2Y0SG 3MXNB 3HOXG 4AQYL 3T1YQ 3HOXH 1KRTA 1Q1BA 4LUZA 3S16H 1DGSA 1X56A 4JV5L 4A3LH 1I94Q 4BY7G 4KLKA 4X64L 3NELA 4A3JH 2YTXA 3PO3G 2R93G 4JCVE 1L0WA 1N33L 2R93H 2HHHQ 4TVAB 5M5WH 2I0QA 1C7YA 4L5TA 1CUKA 4IOAA 2IHEA 1E3PA 4LFAQ 4DV7L 1LTLA 3RLNA 4JI0L 1JJ2A 1PH3A 1MIUA 3A0JA 5LMNW 3S2DH 2JK8A 2F4VL 2UUCQ 1VQAA 2ZM6Q 2N8NA 4DV2Q 4DV4L 1LM0A 1OXTA 3S2HH 4GLAC 5LMNQ 1L1OA 4OWTB 3G48A 3JAMi 3UDXA 4PZ8A 1JMCA 5C4XG 5C4XH 1XNRQ 4BBRG 3K7AH 4BBRH 1PFSA 2WFWA 4NXNL 3J81i 1N32Q 3CF5A 4B3TL 1VQ5A 1XMQQ 2UXBL 4XIGS 3CW2C 1IBLL 4R4TA 1FL0A 1VQIA 1KC8C 2PNHA 3Q8DA 1X3GA 2MFIA 3FHWA 3CCUA 3GTKH 4OO1G 4BBSH 1H95A 4HJ9A 3PIPA 1HZ9A 1N9WA 2CKZB 3H0GG 3CD6A 3RZOH 3H0GH 1U5KA 2E5LQ 4AIMA 3U50C 4LW1A 3CCEA 2NZHA 1XNQQ 3HKSA 2AWNA 3HOVH 2OTLA 1KHIA 1CKOA 3FKIH 4YCWA 4PZ7A 4DK6C 1BBWA 1PA6A 1ASZA 2JE6I 3AFPA 1B7YB 1C0AA 2JQOA 3L0OA 5EAYA 4POFA 2QA4A 1KXLA 3T1HL 1YJWA 3KOJA 3EN2A 5FLXc 3TQYA 1HR0W 2UXDL 1VQJA 3S17H 1TWHH 3PUWA 3W5OA 1P16A 4DKAC 5AJ3Q 3UDGA 1PH2A 2AHOB 2VL6A 3RNUA 1XTDA 1KRSA 2Q2HA 1N34Q 1HR0Q 4HJ8A 3J81j 4OONA 2JA9A 1W3SA 3KDFA 4J15A 4LFCQ 4DUZQ 4GNXB 4UY8C 2ZTEA 2OWOA 2R92G 2R92H 1X55A 2RHQB 4YY3L 1IBKQ 1HNZL 4IPGA 1HNXL 3KF6A 2JA8G 4DR7L 3CMEA 1O7IA 2D0PA 4X62Q 4DR1Q 4GNXC 3HOZH 1I3QH 5FLMG 4A93H 1JE5A 1Y1VG 5M3MG 3JC66 4HJAA 1VQ4A 4NXML 4DR6Q 2AMCB 3BJUA 3CQZH 4YHHL 3UDFA 2E5LL 2C35B 4YCUA 4X65L 4JI7Q 1VQHA 4A3FH 1I50H 1UE6A 2JEAI 4UP8A 3CCLA 4LF9Q 4IO9A 5GQOA 3GTQH 4JG2A 1PV4A 4A3KG 2AWOA 4JI4Q 3CCMA 1QVFA 1HZAA 1PH1A 4GOPA 2YU9H 1IXRA 1OXUA 3ER0A 3TRZA 3OTOQ 4AQYQ 3HOWG 2RHSB 4A75A 5IYBG 2Y0SE 1CKNA 5IYBH 1Q82C 3RLOA 3HOWH 4FDBA 1K3RA 5HY6A 4JV5Q 2IT1A 4X64Q 4R1JA 2KHJA 2A1AA 4BA2I 1N33Q 3STBD 4UP9A 2E8GA 4LF5L 4DV6L 1S40A 4B3ML 1QVCA 1IBML 4GN5A 2LXKA 1IL2A 4DV7Q 4JI0Q 1HH2P 4O0AA 4HIMA 1K83H 2HQLA 3I7FA 1CSPA 1QUQA 4OX9L 4X66L 3F2DA 2F4VQ 4JBWA 4LF7Q 1X3EA 4DV4Q 3J7ZC 3S1NH 4A3GG 4A3DG 3M7NA 3HKZG 4P75A 2VS1A 4A3CG 3RR5A 1MJEA 5K36G 3M3YH 1CKMA 4RMFA 3B6YA 3TREA 4DV1L 1VQ9A 4R4IA 3M4OH 1VQMA 4DR2L 3PGZA 3GTOH 1UE5A 2HHHL 4P72A 1SR3A 1L1OB 1U0LA 4NXNQ 4R4CA 4YCVA 2VQEL 2VNUD 4DAYB 1X54A 1R9TH 2YYZA 2UXBQ 1SE8A 1JB7A 2JA6G 5M3FG 1IBLQ 2JA6H 3CCRA 5M3FH 1L1OC 2BH8A 1TWAH 2ZTCA 2N49A 4MZ9A 5BR8L 1EOVA 3OTOL 2YTVA 1A63A 1VQOA 4DR3L 3CPWA 4A3LG 4MNOA 4JYAL 3I56A 1FVIA 2KHIA 1UWVA 4A3JG 4B3SL 4QJFA 5JJIA 2N78A 1VQNA 1A0IA 2N3SA 2CWPA 4GN4B 4KHZA 4LF8L 3KJPA 5JEAJ 2GVBA 3D0FA 4UP7A 1UE7A 3CXCA 4JOIA 4A3IG 4A3IH 1N36L 3M4PA 4L5RC 4QIWE 4B3RL 3BU2A 5GAHC 1VQ6A 4JBKA 2L15A 2R7DA 1XPOA 5GADC 3PV0A 2B29A 5FJ8H 2K75A 3PUYA 2F52A 3CCJA 1K8AC 4LF7L 4HIKA 4GLXA 3A5UA 4L5SA 5GAGC 3ULPA 1LUZA 3I4OA 3T1HQ 2KBNA 4IPHA 4LF4L 4YWKA 2D62A 2UXDQ 3AFQA 5C0XJ 3ULLA 1YJ9A 1Q7YC 4P74A 1VQBA 2VZAA 3E9IA 4BY1G 4JI8L 5ELOA 4C3JH 4BY1H 4A4IA 4LFBL 1V43A 1E22A 3S1MH 4JBMA 1FJGL 4YY3Q 4GKKL 1HNZQ 1HNXQ 3CC2A 4DR7Q 2ALYB 1YIJA 4BBSG 2WB1E 3PUZA 3CC4A 3E0EA 1FGUA 3GTPH 4YWMA 3RLFA 4O2DA 2Z6KC 4NXMQ 2K5VA 1KQSA 1D7QA 4YHHQ 1EUJA 4DAMA 1WCMH 1NMFA 5DLQE 5ELNA 4X65Q 4APVA 3KJOA 4DUYL 1E24A 1BKBA 3UDIA 1PH4A 3HOVG 4HJ7A 3FKIG 1PH5A 1EQRA 1WFQA 4DV0L 1N8RC 1VS0A 1G51A 2MO0A 2ZTDA 4QL5A 1E1TA 1K0RA 2JA5G 1K9MC 2JA5H 4P73A 2K5HA 1VQFA 2UU9L 2NVQH 3I2ZA 4ME3A 1GD7A 2NVTH 3K0XA 1SRUA 4LF6L 4IFDJ 1KAWA 3CC7A 1YBYA 1TXYA 3STBC 2NVXH 3OW2A 3GTGH 2UUAL 5IP7G 1NMGA 1Y14B 5HGQA 5IP7H 3GTJH 1GVPA 1MKHA 4JI2L 1E7ZA 1YHBA 4AYBE 1PH6A 4LF5Q 3SGIA 4DV6Q 4B3MQ 4IPDA 1IBMQ 2UXCL 3DM3A 2HIXA 2VW9A 2E2JH 1C9OA 1HJPA 4LUVA 3W1GA 2WB1G 5GROA 5IP9G 4OX9Q 1YZ6A 3L7ZC 5IP9H 2EXDA 4X66Q 3HOZG 4A93G 3D31A 1NBWA 2AKWB 2GVAA 3L2PA 5LMUL 3HKZE 1SFOH 2KENA 4DV1Q 3S14H 1SLJA 4A3BH 4DR2Q 1OTCA 1A8VA 2YTYA 2PQAA 4A3FG 1VQGA 3KLWA 1SROA 3CCQA 2VQEQ 2JEBI 2EIFA 4PZ6A 4C2MH 4JI1L 5C44G 5C44H 2K14A 1M1KC 3E9HA 1A62A 1ASYA 2JA7G 4MTNA 2BA0A 2JA7H 4Y52H 5BR8Q 5IT9c 4JI6L 1Y1WH 1JJGA 4DR3Q 1AH9A 1PH8A 4JYAQ 3K8AA 2A8VA 3I4MG 3I4MH 3W1BA 4X6AH 3AEVA 3PUVA 1L2FA 5M5YH 4B3SQ 3K80C 4XTCS 1Q1EA 3TS0A 4OXPA 4AYBG 2Q2UA 3I55A 2QEXA 3K7UC 4LF8Q 3CPFA 3K81C 3J80c 3CAMA 4Y7NH 5JJLA 3M85A 1N36Q 1VQ7A 4OWWB 3H3VH 4B3RQ 3U4ZA 5IE8A 2DGYA 2OQKA 2WAQG 3GTLH 2MNAA 1TWCH 5JJKA 2D0OA 3CMAA 4AH6A 1Q46A 4C3IH 2OCEA 2ES2A 1XPRA 2R7FA 2EQSA 3IRBA 4LF4Q 1QZHA 4K0KL 4KI0A 4A3MG 4A3MH 3VDYA 5GAEC 3EIVA 4JI8Q 4GNXA 4UPAA 5JEAG 2UUBL 3NENA 2R7ZH 2R7ZG 4BXXH 2Z0SA 4GS3A 4A3EG 1GKHA 4A3EH 3J7A5 2CQOA 1UEBA 4JI3L 1XMOL 2XGTA 1FJGQ 1J6QA 2ZJQA 4GKKQ 5IY0A 1Q81C 1YHQA 3TS2A 1Q12A 1GM5A 5IWAL 4KHPL 1AE2A 1B8AA 4IOCA 4GLVB 4DV3L 2H5XA 4JI5L 5C3EG 1YJNA 5C3EH 1VCIA 1KIXA 1SN8A 5H1SE 1BBUA 3GD7A 4DUYQ 3I4NH 2ATWA 3A74A 1J5EL 2NZOA 2ZJPA 4DV0Q 5FJ8G 1WYDA 3ERSX 2VQFL 2RF4A 1LYLA 1PHJA 2UU9Q 3GTMH 3S15H 3GDEA 1JJCB 2PI2E 1K8GA 4DK3C 1OXXK 3ICEA 3BZKA 1V9PA 2PI2A 4IPCA 3J80i 4LF6Q 2RCNA 1P8LA 1X65A 4BY7H 3KFUA 2UUAQ 1WI5A 3PO3H 4JI2Q 4DR4L 1EIYB 1V1QA 1Z9FA 2UXCQ 2VY3A 3H3VI 4GKJL 4R4OA 1NTGA 3KDFB 3FP9A 4NPSA 3CCSA 1EFWA 3OYYA 1T9HA 4IJHA 1VQEA 1I6HH 4QY7A 3KF6B 5LMUQ 3HOYG 4HJ5A 2I5MX 3HOYH 4IFDG 4DV5L 2ASBA 1NE3A 1TWFH 2NN6I 1WCMG 3F1ZA 3F2BA 1HNWL 2DUDA 1NJIC 3UE0A 1AE3A 1S72A 4POGA 1SMXA 4WJ3M 3M9BA 3S24A 2PQAB 1BVSA 1X3FA 4JI1Q 2CWAA 3RZDH 3MEFA 1WOCA 2WP8J 1EQQA 3PO2G 3PO2H 3BZCA 1VQLA 4WJ4A 2GN5A 4ALPA 4JI6Q 1KD1C 3T1YL 4HIDA 3U4VA 4PMWA 4A76A 1I94L 4GOPB 1S3OA 1UE1A 1PYSB 1X6OA 3EBEA 1YITA 2MO1A 2I5LX 1CKNB 2OTJA 5C0XI 1K73C 1M90C 4GOPC 4HIOA 2KCTA
chains in the Genus database with same CATH superfamily
4IURA 4JW0A 1QCBD 5E3FA 1HZBA 4IQZA 4G7HC 1C8CA 5C4JH 2CVRA 2M00A 2K33A 2HCCA 1RIPA 2CFMA 1EU4A 5ELBA 1VQ8A 1PYBA 1BCPC 3RN5A 1JICA 4DA2A 3S2DB 1PZJD 3U58A 1B70B 4L5QA 2PO4A 1LACA 2BE5D 4CDDC 1VQCA 4BA1I 4H02A 3BDOA 1N32L 4DN4M 2UUBQ 1E2WA 1SMYC 2A19A 3NE5B 4FF1A 1XMOQ 2K5NA 2BL7A 1EIFA 4BBRB 1BCPF 2AUJD 1I5FA 1ICWA 1S5BD 1M4VA 1Y1VH 5M3MH 1YHAA 1CK1A 5E7NA 1F2LA 1TQOA 1XXGA 4C3HH 1B2TA 5M5XH 1KAAA 4CGYB 4C56C 1EL0A 1PVOA 2L4NA 4QIWB 3TSSA 4IN3A 1MSGA 3FKIB 3C3LA 2D2CC 2G9DA 4I7ZC 4WRDA 3F2CA 1BOSA 1ESRA 2F0EA 4GN3B 1EY7A 1N34L 2MGSA 4PG3A 1TWHB 4DUZL 1JE4A 4O42A 4CKBA 1EY6A 4FNFA 3G6EA 1GO3E 3PQIA 1XJVA 4DR6L 3AB9A 2R92B 3ONAB 4ZUIA 1CHPD 4O1NA 1HUNA 1MBYA 4IJLA 4JK1C 3GO5A 1GUSA 1I4QA 2M9VA 2RDGA 1Q86C 2ZJRA 2Y0SG 3S16H 1Q1BA 4LUZA 1DGSA 1X56A 4JV5L 4BY7G 4X64L 1GOZA 2B2TC 2YU9B 2JA7B 4FF3A 2R93G 2Z4IA 4NW2A 3HOWB 5M5WH 1E3PA 2NTSA 2TMPA 3RLNA 1G91A 5LMNW 4DNTB 2UUCQ 2F4VL 1WTXA 2YFAA 2SEBD 4DV4L 3J80E 1LM0A 3V05A 2B2VC 2QGMA 3UDXA 1JMCA 2P5ZX 1CQVA 3K7AH 3J81i 1NSNS 2EYHA 3NWTA 2MUYA 4TRDA 3Q23A 1XMQQ 4L8JA 1FL0A 3MC0B 4HFVA 1KC8C 1GUWA 2PNHA 3Q8DA 3FHWA 3X3MA 3GTKH 4HAEA 3DEPA 1KLUD 1EWCA 2JA6B 1SJED 1TWAB 3RZOH 4KKSA 1NR4A 5EPJA 2E5LQ 3VYTA 3CCEA 1XNQQ 1LTSD 3E5SA 3HOVH 5I9PA 1CKOA 1BUVT 4YCWA 4PZ7A 4DK6C 1BBWA 2JB3A 5L37A 2JE6I 4NV5A 1B7YB 2JQOA 5EAYA 4POFA 3T1HL 3EN2A 3IFTA 4LMQD 3K5LA 3C1FA 3PUWA 5AJ3Q 1ENFA 3EFXD 3UDGA 2Q2HA 3CU7A 1HR0Q 4HJ8A 4OONA 2JA9A 1FNVA 1K8MA 4UY8C 2ZTEA 2RHQB 2F0TA 1IBKQ 2JA8G 1O7IA 4DR1Q 4GNXC 1EIHA 5M9OA 5FLMG 1VQ4A 3NQIA 4YHHL 2XTRA 1CHQD 2RKSA 4FXGC 2CAZB 2C35B 4X65L 4A3FH 1PFNA 1MSHA 2CH4W 4A3KG 1PH1A 1IXRA 1OXUA 3OTOQ 2FHTA 4P2CB 1Q82C 4I65A 4FDBA 2BL8A 1J9OA 5D14A 4X3KA 3PO2B 2KHJA 3A54A 2L5TA 1N33Q 4K2KA 1DJRD 5EJWA 4DV6L 3IAYA 1QVCA 1IL2A 4DV7Q 4JI0Q 3GTGB 1DYQA 3I7FA 4OX9L 2AQ2B 3F2DA 1LTGD 4JBWA 1X3EA 4RCNA 4A3GG 3M7NA 4H13C 4H7BA 3KLSA 4P75A 2VS1A 3SE0A 4A3CG 5K36G 4GXTA 2B8GA 5D3DA 3SK4A 4HMIA 5KNDA 2HHHL 1V1OA 3DXJC 3MZ5A 3OMCA 4R4CA 2VQEL 3C2PA 2F3WA 1X54A 4BS9A 1IKLA 2UXBQ 5M3FG 1PTOH 2N49A 4MZ9A 1RDPD 1EOVA 2TSSA 4DR3L 3S9WA 3F4MA 3I56A 1FVIA 3I73A 4B3SL 2N78A 1VQNA 1A0IA 2Z6BA 1Y1WB 4KHZA 3A8JE 5JEAJ 2GVBA 2RVLA 3D0FA 2FEFA 4KN7C 1N36L 4K6DA 4FXDA 4JBKA 1PRTC 4NV2A 3H91A 4L5SA 2MJ8A 2A6HC 5GAGC 2NWGA 1UEAB 4IPHA 2UXDQ 3CHBD 5JJZA 3AFQA 3OHXC 4FVMA 1DD2A 4ZQ3A 1Q7YC 4WJWA 4C3JG 3E9IA 1S5FD 5ELOA 4A4IA 5EPKA 5CC4A 5A2QL 3S1MH 4A3MB 1FJGL 1PRTF 1C48A 4GKKL 3CC2A 4DR7Q 5I2XA 2ICIA 1WTRA 4M1UB 1SNCA 3CC4A 3E0EA 3RLFA 2G9HD 1EQVA 3EA6A 1CA6A 2EYMA 2K7VA 3J81L 3B55A 1BKBA 3UDIA 2FU2A 3FKIG 1TKWB 4DV0L 1G51A 2MO0A 1B9NA 2SDFA 2NVQH 2DNEA 4K5VA 3FVQA 4LF6L 1JR0D 4IFDJ 3K0YA 2UUAL 1NMGA 1ONLA 1KABA 4Q5VA 2ZXPA 1KTKA 1YHBA 3HOXB 3EROA 4B3MQ 4IPDA 3T4AC 3I3CA 1O7YA 4LUVA 5JPNC 3AJFA 1YZ6A 3E0JA 2IP6A 4WORA 1NBWA 1MI2A 3HKZE 1SLJA 1A8VA 1EY4A 3CCQA 1TS2A 2OT2A 4C2MH 2K14A 2JA7G 1K8OA 4ZCKA 5IT9c 4EVOA 3NTKA 4L63B 1PH8A 4JYAQ 2PMZB 3K8AA 3ND8A 4X6AH 2RCFA 4JVZA 2WINB 3I55A 3K7UC 4LF8Q 1CA5A 4Y7NH 2A68D 1YNJC 1YNNC 3P7JA 4V0BA 1FGBD 4YZ9A 5T1GA 1SE2A 2MNAA 1TWCH 2XN9C 3ZYYX 3DMUA 4ID6A 4AH6A 4RGOS 3U9OA 4LF4Q 2EQSA 2EJMA 2OF1A 1EY0A 1WTHA 3IRBA 3PMFA 2F0MA 3L0IA 1QNUA 2EY2A 5JEAG 2R7ZG 4LFBQ 1EIGA 2KCCA 4JI3L 4N9PA 1J6QA 5JAVA 1GUTA 1ZYRC 5IY0A 4EGVA 4HN7A 2RSOA 4DV3L 1STEA 3BDLA 1ILPA 2A74C 4K8IA 4CDFC 1AZQA 2CHBD 2HQEA 1FR3A 1J5EL 4N8FA 5FJ8G 5G3LD 4Q9VA 1G2SA 4F8MA 3S15H 2F0NA 2WKDA 4DK3C 1JORA 1OXXK 3P23A 3BZKA 1V9PA 2NVYB 3R2IA 4FXKC 5E4XA 3J80i 1P8LA 4BY7H 2A6ED 3FRPB 4DR4L 1B9MA 3GQBA 1V1QA 3SXHA 1VF5C 2UXCQ 2R3ZA 2E2HB 1SNMA 1I4GA 1QWYA 3KDFB 1AEXA 3CCSA 2NZ1D 1D6EC 4QY7A 4IFDG 4DV5L 1NE3A 3LNNA 3F1ZA 4O1PA 2NN6I 3T16A 1IYUA 3J81E 1CT1D 3F2BA 1ZKOA 4A3DB 1SNDA 3M9BA 3S24A 4XQJA 2CWAA 3PO2G 3K59A 2B2YC 2GN5A 1VDZA 3T1YL 4XT3B 4HIDA 3U4VA 4PMWA 1I94L 1X6OA 3EBEA 2L0CA 2OTJA 2Y0SB 1K73C 5LHY1 4GOPC 3A7AB 3HFZB 3D4WA 4LFAL 2B63H 1SDFA 5IYDG 2R93B 4DV2L 1KDBA 2WAQE 3IL8A 3CP0A 1JT8A 3PUXA 1EYDA 1QUQB 1YI2A 3S1RH 1XPUA 1KDCA 2IPKD 3VA9A 1A2UA 1IYJB 2B2WA 2KCNA 1HZCA 4LAAA 2N55A 3KBGA 3S2HB 5IGDA 3AQQA 3ULJA 3HOUH 5CYUA 2Z6KA 2IHFA 4YWLA 2FXQA 2HIVA 1OXSC 1Y1WG 4EQ5A 1EYGA 2JA8H 5IWAQ 4KHPQ 3H15A 5FLMH 1STBA 2KQ3A 1G6PA 4IFDI 5IYCG 2XTIA 1YEZA 3M4QA 1YO7A 3H6MA 1LTTD 4A3KH 1D8LA 4RCOA 1H9SB 3DWQA 1YNXA 4JOIC 4OO1I 2AQ3B 3RUZA 4DR5L 2ZXOA 2PPBC 4BXXG 1A3TA 2YV5A 3JAMc 2F3IA 5FLXE 3E3XA 2BA1A 4QGUA 3AYHB 5JPMC 3Q22A 1RCVD 1IZ6A 2LXJA 1MD2D 3L9AX 4KY7A 3PIOA 4X62L 4U6RA 4JC0A 2K5QA 4A3GH 1U4LA 4RG1A 4A3CH 5K36H 2PQEA 5C0XG 3LJ0A 2VUMG 1R4PB 4ABNA 2YFBA 3HRZC 3LX0A 3Q0AA 4NB3A 4JI7L 3OOCA 1I3QB 3S1QH 4A93B 4FF4A 4DNIA 3CQZB 4LF9L 3TEHB 4P71A 4YZCA 1WTOA 2BDNA 1KLGD 3PF5A 2QF7A 4CDEC 3MXNB 1EEFD 3HOXG 3V2TA 4Z7GA 5KNCA 5C44B 4KLKA 3E6ZX 2YTXA 3TP7A 4DWLA 1KDAA 3MWYW 2IL8A 2I0QA 1CUKA 5IGEA 1MIUA 3S2DH 1F9QA 4NDXA 2O5IC 2ZM6Q 3HEJA 2MJFB 1OXTA 1SYFA 3J80L 4GLAC 2P22B 5LMNQ 3QO2A 4OWTB 4PZ8A 2L11A 2AUKA 1SYDA 3SK8A 5C4XG 1XNRQ 1B53A 4BBRH 1PFSA 4NXNL 3SK5A 3M3YB 4C3IB 4B3TL 1VQ5A 5FO7B 4R4TA 2F0LA 4DGZA 1SYBA 1SNOA 3A8KE 4ZAIA 1R9TB 1H95A 1JCKB 3MAQA 1HZ9A 2F3VA 5M3FB 5EKIA 3H0GG 4OEMB 4QUFA 3BZDB 4CKEA 4LW1A 2NZHA 1PTOC 4DAPA 2K01A 3FKIH 4IUTA 5C3EB 3NP8A 4E6IA 1KXLA 1YJWA 3BS1A 3KOJA 1TWHH 2Z1CA 1NAPA 3W5OA 2KVMA 3OIQA 2AHOB 4ZYSA 1PTOF 4OELB 4RHSA 1WTPA 2XSCA 3J81j 1JQOA 1W3SA 1SNQA 3KDFA 4LFCQ 5ELCA 2OWOA 2R92H 1X55A 2F0UA 4C3JB 1W6JA 3D6CA 1DXMA 3OWFA 5FKAC 4HJAA 2BOSA 4NXML 2K03A 2FMMA 1VQHA 3I4LA 2JEAI 4HSPA 1HA5A 4G76A 5CGKA 2AWOA 4JI4Q 1WCMB 3CCMA 1QVFA 2YU9H 3ER0A 1RD9D 3TRZA 4AQYQ 4A75A 5IYBG 3HOWH 4XYQA 1K3RA 4O1OA 4R1JA 3J7AF 4LF5L 5CV6A 1CFMA 1E2VA 1IBML 1LTBD 1X3QA 3SDZA 4O0AA 4HIMA 1K83H 3FDTA 1QUQA 2IJ0A 1QJOA 4A3DG 3Q6SA 3NXWA 3HKZG 1U4PA 3W3AA 4ULLA 4KY6A 1MJEA 4RMFA 3HS0C 2Q8IB 3BYYB 1EU3A 4HTHA 4UAIA 4DV1L 4EQOA 3J7AV 1VQMA 4DR2L 3GTOH 4ME5A 1L1OB 1U0LA 1SFOB 2VNUD 4A3BB 1SE8A 1IBLQ 2JA6H 1FD7D 1TWAH 5BR8L 2CH4A 2X6GA 1F9PA 1A63A 4A3LG 5CV9A 2AQ1B 3FBVA 3OSOA 2QILA 3QJYA 1RF2D 4G57A 3SVMA 3QOLA 3KJPA 4UP7A 1RTNA 1UE7A 3CXCA 5M5YB 1UUPA 4A3IH 2PW5A 3D8GA 4B3RL 3BU2A 2KOLA 1XPOA 5FJ8H 3PUYA 4GLXA 4OIKA 1LUZA 4PMCA 2D62A 4KY5A 1H9RA 3QG1A 1YJ9A 3KP9A 4P74A 1VQBA 4JI8L 4BY1G 3DWPA 1X32A 3G6JB 4K5XA 4JBMA 2F0WA 4PV1C 1S5DD 4YY3Q 4K14A 2LS01 3MXGA 1HNXQ 1HNZQ 1YIJA 2R7ZB 2HGKA 3JAME 4YWMA 1D1IA 2K5VA 4EQNA 1D7QA 1EUJA 5C3XA 1QG7A 5DLQE 1F2YA 1Y8OB 3KJOA 1E24A 1RTOA 1PH4A 1LT3D 2EJFC 4HR7B 3MXNA 1N8RC 1E1TA 2EE1A 2JA5G 1K9MC 3I4NB 2UU9L 4ME3A 1GUOA 1BXTA 2E76C 3TDQA 1L0XB 5TSSA 1EFID 3LWEA 3GTGH 5HGQA 1Y14B 3TP8A 5IP7H 1S5ED 1MKHA 1E7ZA 4AYBE 3SGIA 1LT4D 2E2JH 4CKCA 1C9OA 3PO3B 2WB1G 1MGSA 5GROA 1AFPA 4RKBA 5IP9H 4X66Q 2JN4A 4A93G 3D31A 2RDHA 2AKWB 5LMUL 2GVAA 2KENA 3R3OA 2F03A 1HFNA 1X3PA 1R4QB 4C1NK 1OTCA 1LT5D 2F6MB 2PQAA 5CBAE 3H94A 2DY7A 3A56A 3QIAA 2JEBI 5CMDA 1EQTA 5C44G 1A62A 2N88A 1ASYA 1QILA 4MTNA 4Y52H 2KEEA 4JI6L 4JPBW 1Y1WH 3I4MG 3W1BA 1TS5A 3RZDB 3AEVA 1RKNA 3K80C 3TS0A 1TS4A 1TT2A 1EZ6A 2QEXA 3GTKB 2A73B 3CPFA 1TU2B 2CQAA 4OWWB 4PL3A 4XQNA 5IE8A 1V1PB 4DAVA 2WAQG 3GTLH 3TP5A 4FP5D 2NBFA 5I4DA 3CMAA 1QOHA 1UAPA 4KTAA 1EYAA 2QCPX 4C3IG 1XPRA 2R7FA 3V96A 1D5MC 1QZHA 3UITA 4A3MH 5GAEC 5AFWA 4UPAA 2UUBL 3NENA 4BXXH 2Z0SA 4GS3A 4A3EG 1GKHA 1LT6D 5A35A 1FYCA 1XMOL 2E74C 4CDCC 1YHQA 3TS2A 4I1TA 1AE2A 1B8AA 4IUVA 4RKLA 4GLVB 1XYIA 5C3EG 1VCIA 5C0XH 1KIXA 2B2UA 2FFKB 4LJZC 1HFGA 3D3RA 4B08A 1BBUA 4DUYQ 4OAVB 3A74A 2NZOA 2RDFA 1WYDA 3ERSX 2E2IB 4U673 4DK0A 1I4PA 1PHJA 3GTMH 1ZEQX 2PI2A 4IPCA 1FNUA 1X65A 2A69D 2JYOA 5CBEE 1CQFA 3M4YA 4JI2Q 1TWGB 1SEBD 1F2ZA 3D4DA 4ZLTF 5F2DA 3H3VI 3HZXA 1IW7D 4NPSA 1EFWA 5DM73 1BBXC 4IJHA 1VQEA 1I6HH 3FMCA 3KF6B 3MVVA 4HJ5A 2I5MX 3HOYH 3K5OA 1TWFH 2K32A 1WCMG 2BE5C 2DUDA 1NJIC 3UE0A 3FNBA 1SMXA 2LKVA 4KMUC 3TN2A 3I9V1 3NUCA 2JBWA 1F9SA 4JI1Q 2VUMB 2WP8J 2JP1A 3BZCA 1KD1C 3NK9A 5ELEA 4FF2A 4A76A 3HP3A 1EY8A 3CKIB 3T13A 1I4XA 5FO9B 4HIOA 3IFDA 1IKMA 1HQMC 5E1FA 1Y69U 2K5DA 1PH7A 4A3JB 1BCPB 2UUCL 3BDCA 2VB3X 2F66B 1LO5D 1VQDA 1EWHA 1E1OA 3UE1A 1E2ZA 4FYDA 1OXVA 4A3BG 4S3SA 1WTVA 2QDLA 4MHEA 1Z47A 4K0KQ 3DEOA 1X9NA 1STNA 4DR5Q 1ENCA 2BH2A 1K0SA 1QVGA 2HD3A 1LABA 2MP1A 4BWGB 3T51B 2XRQD 1XMQL 1NY4A 4ZKCB 3CCVA 4V190 2KKMA 1XX8A 5C4XB 2CW0D 4PL5A 1XTCD 2F0GA 3SR1A 2V1CC 3QR8A 3S1MB 3VR4A 1AZPA 2H1EA 2KEDA 3NEMA 4LNQA 2R6GA 2DJFC 4JI5Q 1VQPA 4QQBX 2MQHA 1PDQA 4BBSB 1UNSA 1XNQL 3SEBA 4UDUC 4MN3A 4J1MA 1B50A 3VR3A 2JJQA 3H0GB 3OWEB 1Q8KA 2K52A 2NVYH 5IGGA 4LWCA 2VQFQ 3PF4A 2IX1A 4H44C 4IUQA 4NMZA 3F8TA 1BCPD 1DOLA 2NN6G 2E2HH 5AJ3L 1HRJA 2NVQB 2I5HA 1S4ZA 4JBJA 1HR0L 1GHKA 1WJJA 1SMYD 5FLXL 2NUCA 4GKJQ 1IBKL 4X3TA 4A3DH 4DR1L 2K50A 1SAPA 5C5MA 3NBHB 1G291 2L55A 1YVCA 4HMJA 4PQXA 1HNWQ 3J7YW 3HOZB 1Q3LA 3I4NG 3WWVA 3VR2A 1STGA 4K6LA 1BO0A 4B3TQ 4I7AA 1ENAA 2QW7A 2F0JA 1I50B 1ILQA 2MPMA 5C4HA 2PZWA 4A3LH 2QSBA 5HURA 3NELA 1T5EA 3PO3G 4JCVE 1N33L 2R93H 3FPPA 1CI3M 2HHHQ 3TZDA 1V1PA 2IHEA 3I70A 4DV7L 1PLFA 4JI0L 1TS3A 3D4RA 1JJ2A 1HCZA 3NTHA 3A0JA 4OHJA 1VQAA 2N8NA 1PZKD 3OIPA 4Y7NB 3S2HH 2KA7A 4DNRB 3JAMi 1O78A 1TWCB 3S1NB 1HQRD 3GV6A 3HKZB 3MXUA 1N32Q 1EY9A 5FO8B 2F0IA 3M4OB 2UXBL 3CW2C 3N52A 2LFNA 3EVQA 3CCUA 2MFIA 4OO1G 4HJ9A 3PIPA 1D5XC 1F9RA 4ZK9B 4NP5A 3G7LA 3SHLA 1WTWA 2CKZB 1II3A 1NNXA 3FPUB 3KUPA 4AIMA 3HKSA 2AWNA 3WDNA 3KK7A 3BVGA 2F1MA 2B39A 1Y8PB 4DXGA 1ET9A 1PA6A 3TMEA 2F0VA 3AFPA 1A2TA 2L1LB 2UXDL 4F87A 3TQYA 2EYJA 1VQJA 5FK9C 3S17H 4DKAC 1PH2A 1CM9A 2VL6A 3RNUA 1A3UA 2FINB 1N34Q 1O7LA 3MFGA 2I07B 4DUZQ 4GNXB 4BY1B 3KF6A 4DR7L 4OL7A 2D0PA 3WOEA 1I3QH 3NQTA 4A93H 1JE5A 4DR6Q 3BJUA 3CQZH 1TDPA 5JVH3 1OO9B 2E2DC 1UE6A 4UP8A 3CCLA 4IO9A 5GQOA 3GTQH 4JG2A 5C4ZA 1TY0A 3T53B 2WACA 5IGBA 1JC7A 2PCFB 2GA4B 4JV5Q 5HY6A 2A2DA 4X64Q 1BDOA 2A1AA 2RQXA 2JA5B 2JB2A 4BA2I 1SYCA 4UP9A 2NVTB 2E8GA 1S40A 4B3ML 4YZDA 4GN5A 4DU9A 5HGIA 1HH2P 2NVXB 3GTJB 2HQLA 1CSPA 2F4VQ 5C5LA 4DV4Q 2XVSA 2ENBA 3M3YH 1CKMA 2B63B 1VQ9A 3SK6A 2WB1B 3KLRA 1HTPA 3PGZA 3PIO3 5DNFA 1UE5A 4P72A 1SR3A 1D2BA 4DAYB 1R9TH 2XTQA 3S14B 2K04A 3LJ2A 1JB7A 3CCRA 5M3FH 2BH8A 3A55A 3U9SA 2ZTCA 4PMBA 1VQOA 2M2LA 3CPWA 1G6ZA 4JYAL 2FUG1 4AS3A 2PYKA 4RWSC 2KHIA 3LWUA 3DA4A 4R8NA 4A3JG 5JJIA 4J8QA 3P75A 2OXPA 2J4XA 3F2UA 5IT9E 2CWPA 4GN4B 4H0LC 4IUPA 5KIXA 4LF8L 2IX3A 2IW3A 2XIWA 1PRTB 3I4MB 4L5RC 4QIWE 5J22A 2F4IA 1VQ6A 4PL4A 4YIJA 2ZT9C 3ERQA 3PV0A 4LF7L 2I46A 1PMRA 3ULPA 3I4OA 1NR2A 2KBNA 2FJ2A 3BG3A 4YWKA 3T1HQ 1JB3A 4LF4L 2WAQB 3ULLA 5EBDA 4C3JH 1SXTA 4LFBL 1V43A 1E22A 5LL6X 1SE3A 4X3UA 2EYFA 2B2WC 2ALYB 3NBHA 4BBSG 4A3EB 5BN4A 4XDXA 3JAML 2Z6KC 1Z7TA 1KQSA 3NSWA 4YHHQ 3HGBA 4DAMA 4KV6A 1WCMH 4RAUC 4MIUA 2DY8A 4X65Q 5ELNA 2A5HA 4WFN3 3R2TA 1HA6A 1PH5A 1EQRA 4QB4A 3X3NA 1PRTD 2K5HA 3DWAA 2SOBA 1T5XD 3I2ZA 4IUUA 1GD7A 2A6HD 1SRUA 4XXEA 4IUNA 1LTAD 2V4DA 5D3IB 3D6WA 3STBC 1PZID 1B3QA 2A68C 4DV6Q 2B2VA 2UXCL 3DM3A 1JOKA 3I90A 4OX9Q 4DF7A 3HOZG 2EYPA 3L2PA 1ESFA 1PFMA 1SFOH 4A3BH 2DN8A 2YTYA 1VQGA 1SROA 4ODGA 5HGTA 1KNEA 1FNWA 4EQPA 3K57A 2VQEQ 5C6AA 5K5PA 2ZW3A 2L1BA 4PZ6A 1H9JA 4OIJA 1M1KC 3E9HA 2ETDA 5IIFA 4G4KA 3ND9A 2JA7H 5CV7A 2RA4A 5IODA 4DR3Q 1K28A 2V6EA 3DM1A 1DM0B 2K1BA 5M5YH 4B3SQ 4R8IA 1Q1EA 2F0QA 2MHVA 2Q2UA 2ZRRA 5KYLA 2OEOA 2EZVA 5EKKA 5JJLA 3M85A 2EY5A 1WD0A 1N36Q 3U4ZA 2DGYA 1RJTA 1IHZA 3M7GA 3GTPB 5JJKA 4K8JA 2D0OA 4AS2A 1BQQT 1Q46A 4CJ1B 3NWSA 4Q0FA 2A6EC 2NN6H 5C4JB 3VDYA 4N9TA 3EIVA 4GNXA 1B44D 5JEAH 2R7ZH 5CORA 1UEBA 1IYVA 3BYTB 1SJ8A 5G3LF 1FJGQ 1DONA 4GKKQ 3EQLC 2D9UA 3OPOA 1Q81C 1Q12A 3QWNA 5IWAL 1GM5A 4KHPL 2K05A 4IOCA 2L9HA 1JOQA 3I72A 2H5XA 1YJNA 4G7ZC 5EKLA 2NB0A 2RBMA 2KECA 5D65A 5H1SE 1SYGA 2DJGC 3I4NH 1Y1VB 2F0PA 5M3MB 3I8ZA 1YNJD 1H9SA 1YNND 4DV0Q 1A6XA 4HEDA 3K6OA 1GUNA 2RF4A 1GJXA 1STYA 2J7ZA 1XWEA 4C3HB 1PYWD 3GDEA 5M5XB 5BN5A 1K8GA 1F2MA 4LF6Q 1JQYD 3ICEA 1LV9A 2RCNA 1M8AA 2JAEA 1Y8NB 3KFUA 2UUAQ 1QE6A 1G2TA 1WI5A 3PO3H 1EIYB 3RD4A 3MHBA 1A15A 1Z9FA 1WD1A 3NBIA 2XMXA 2VY3A 4R4OA 3GV3A 1NTGA 5LNK1 5IGCA 3VA5A 3FP9A 1ZYRD 5J1ZA 4KD3A 1K83B 1GXDC 2ASBA 4IFDH 4KN4C 4DAYA 3KBXA 1AE3A 1JOOA 1S72A 1BVSA 1X3FA 2F0OA 2X6LA 3RZDH 5JOBA 1EQQA 3PO2H 3GTOB 1VQLA 1B4OA 4QMGA 4OAUC 3MA2B 1SYEA 3BVMA 4OO1H 4GOPB 1Q8IA 1S3OA 2RADA 1CKNB 3S16B 1SNPA 4DFAA 1M90C 3IAM1 5CR3A 4LUOA 1MJCA 2B63G 3G4SA 4KD4A 4TQUS 4ILWA 2Q2IA 5IYDH 1MHWC 5IGFA 1GHJA 5CV5A 2Q2TA 2ZM6L 5M5WB 4QCLA 2IY5B 5CV8A 4A3IB 2B3GA 2JB1A 3LGJA 2Z9HA 2PW7A 1I4HA 5LMNL 1WTQA 1STHA 3A8IE 3MXPA 1XNRL 3QOJA 5CV4A 1DZ1A 3HOUG 3W2DA 3AMUA 4JI3Q 1CSQA 3K7AB 2JSOA 1SBBB 3CRKC 3DHQA 2OQ0A 3PCOB 2F0SA 1V8QA 3KF8B 5J3BA 4DV3Q 1SE4A 3KYHC 5IYCH 5DAUA 3A5ZB 2E2IH 3Q24A 3SDJA 2HT1A 4R4QA 2KCMA 1W2BA 2HUGA 3G71A 3RZOB 1J5EQ 1CZGA 3ZJYC 3DLLA 2ID0A 2LMCB 3RN2A 1RL2A 3IAS1 2K28A 1TWGH 3PSIA 1AN8A 4G75A 3HOVB 1HHVA 3QB3A 4L6TB 2LSSA 1KL9A 2K6AA 4DR4Q 2KJXA 3ITPA 1D1KA 4OWXB 1A3VA 2QGQA 2ZXRA 2NYZD 1KNAA 3MEHA 4LFCL 1NUCA 3J81c 1SJHD 2HDLA 1QZGA 2IX0A 1TR5A 2ICEC 4HCEA 4Z9CB 3FVVA 2E2JB 1DCZA 1CZWA 4DV5Q 4XT1B 5BN3A 1PH9A 1VQKA 4HCSA 2VUMH 5KYIA 5E4WC 2H4OA 2BDOA 5C3WA 2PZTA 5EBCA 1EWIA 2CCZA 4JI4L 5DM63 2PMZE 4EX5A 4DPGA 1EZ8A 1HUMA 2K4KA 1JWUD 4A3FB 4X3SA 4AQYL 3T1YQ 3HOXH 1KRTA 1I94Q 4HSVA 5EPLA 2RIOA 2QKIC 4A3JH 1E0BA 1W6KA 1L0WA 2RSNA 4TVAB 1O7ZA 1C7YA 4L5TA 1HTLD 4IOAA 2EPBA 1U9RA 4QF4A 4LFAQ 1LTLA 2C5CA 1PH3A 4AYBB 2JK8A 1EOTA 4DV2Q 1LTID 2EOTA 2NTTA 1L1OA 3G48A 3GTLB 4KK7A 2PZUA 1B1ZA 3C1EA 4K5WA 3TZUA 3T56B 5C4XH 3H3VC 3EJIA 4BBRG 2WFWA 1S5CD 3CF5A 4KJNA 2KHSA 4XQQA 4XIGS 1IBLL 2J0TD 1VQIA 4PNYA 1X3GA 1VMPA 1LTRD 4BBSH 1STAA 1JWMD 1PTOB 2LY7A 1N9WA 3CD6A 3H0GH 1U5KA 2R61A 3U50C 3NTIA 1L0YB 4DK1A 2OTLA 1KHIA 2SNSA 1ASZA 2DNCA 1GUGA 1C0AA 2QA4A 3L0OA 1PFBA 1HR0W 4FO2A 5FLXc 2C9OA 1P16A 3K5MA 1XTDA 1KRSA 2Z8LA 3GTMB 2Q8RE 4J15A 4LK1C 2R92G 1HPCA 4YY3L 1HNZL 4IPGA 1HNXL 2EVBA 4UHVA 4X62Q 3CMEA 3HOZH 3KLSX 4HEA1 3P1HA 1Y1VG 5M3MG 3JC66 1I6VC 2AMCB 3UDFA 3VYSA 2B2YA 2E5LL 4RA8A 4YCUA 2K5WA 4JI7Q 4C3HG 1I50H 5KEEA 1I6HB 3VR6A 1PTOD 1WVLA 4LF9Q 2EY6A 3HOYB 1ICFB 1TWFB 1PV4A 3A7LA 1HZAA 4GOPA 2B2UC 4RHRA 3HOWG 2RHSB 2Y0SE 1CKNA 5IYBH 3RLOA 5FOBB 2IT1A 2EY1A 4NKLA 1SSOA 2WIIB 3DO9A 2PNRC 3STBD 2SNMA 5JVG3 2LXKA 1K3BC 3DUZA 3GP7A 4X66L 3K5NA 3S1NH 4LF7Q 1ZXTA 3J7ZC 3RR5A 3B6YA 3TREA 2EYOA 4N8X1 4R4IA 3M4OH 5EGTA 4XYOA 2HCIA 4NXNQ 3R93A 1EEID 1ML0D 4YCVA 2B8FA 2YYZA 5KNBA 3CRLC 2JA6G 1EY5A 3K58A 1QNKA 1L1OC 2VB2X 5I6WA 3L3OC 2IWHA 3OTOL 3KF8A 2YTVA 4MNOA 4C2MB 2RLDA 2GSCA 1UWVA 1H9MA 4QJFA 2E75C 2G5DA 2N3SA 4C1NI 1D5ZC 4IZ8A 5IT9L 5DEHA 5COYA 1B3AA 2BCOA 4JOIA 4A3IG 3M4PA 1IL8A 5GAHC 2L15A 2R7DA 5GADC 2B29A 4B9XA 2K75A 3CCJA 2F52A 1K8AC 2KUMA 4HIKA 3A5UA 2EJGC 1DOKA 5C0XJ 3P20A 3VR5A 2VZAA 1LLRD 4BY1H 3R8BA 2XWBB 5A2QE 4M8AA 5I9OA 2XRSD 4CJ2C 2F0FA 1EYCA 3NPPA 2WB1E 3PUZA 1TY2A 1RHPA 2O2LD 1F77A 1FGUA 2QDBA 4O2DA 4TSSA 4U68A 4NXMQ 1ET6A 2Q8TA 3JSBA 1NMFA 3WOFA 4APVA 3PIP3 2O4XA 4DUYL 5I6YA 1Z6HA 3HOVG 1TIID 4HJ7A 1WFQA 2WV6D 5EQ0A 1VS0A 3N6RA 2ZTDA 4QL5A 1K0RA 1QB5D 5KRUA 2JA5H 4P73A 1VQFA 4CBVA 2NVTH 3K0XA 1KAWA 4J6HA 5ELDA 3CC7A 1YBYA 4CHTB 1TXYA 2NVXH 3OW2A 5IP7G 3GTJH 2A2CA 4KKUA 1GVPA 4JI2L 1Q90A 1BNZA 3S15B 1PH6A 4LF5Q 4CJ0B 1IBMQ 4BY7B 2EYLA 2VW9A 2HIXA 1HJPA 3W1GA 2O5JC 5IP9G 3L7ZC 3OMGA 2EXDA 4RGTA 4Z7HA 5I2YA 1G8ZD 4DV1Q 3S14H 4DR2Q 4A3FG 3KLWA 4GZYC 1I4RA 1TVXA 3VYUA 2EIFA 3IKJA 4ZUJA 4JI1L 1CTMA 5C44H 2HDMA 1U4RA 2BA0A 1JWSD 5BR8Q 5ISRA 1JJGA 1AH9A 3MFYA 2X69A 4KKTA 2A8VA 3I4MH 2EXZA 1L2FA 3PUVA 4K2LA 4XTCS 4OXPA 4AYBG 1AP0A 1C4QA 3K81C 3J80c 3CAMA 1U4MA 1VQ7A 3H3VH 3H09A 2VXWA 4RGMA 5IOCA 4B3RQ 2OQKA 4MTKA 2F0KA 3NHHA 2XWJB 1AW7A 4C3IH 2OCEA 2ES2A 2QZGA 2A69C 4TKOB 4F88A 4K0KL 4KI0A 4A3MG 1BR9A 2QEJC 4JI8Q 4KJOA 1HXYD 5NUCA 3S1RB 2XNAC 2D5DA 5LL6S 3J7A5 2JXMB 4A3EH 2CQOA 4R9WA 3S17B 2XGTA 3C46A 4QUCA 1IW7C 2ZJQA 1RODA 3OW7A 3TP6A 3HOUB 3BVZA 2WKCA 4ZRZA 4JI5L 3MTSA 5C3EH 2JA8B 2L12A 3UI2A 4RH6A 1SN8A 5J39A 3GD7A 3FEWX 1J8IA 2ATWA 2ZJPA 4ZKBB 2VQFL 1LYLA 3O13A 4G7OC 2UU9Q 1JJCB 2PI2E 4IALA 3GTQB 4A3KB 2FMCA 2EDGA 4RGNA 3HG9A 1DOMA 4GKJL 1H9KA 5ELFA 1VF7A 5T1IA 2F0DA 3OYYA 1T9HA 1O80A 2F0HA 5LMUQ 3HOYG 3VYRA 4RFBA 1HNWL 3AU7A 4DXFA 4KHVA 4A3GB 2Z4HA 3VA7A 3DA3A 4POGA 4WJ3M 3TBIB 2PQAB 3I91A 2B2TA 2K19A 3MEFA 1WOCA 2CW0C 3RMHA 1PXUA 3S1QB 1BF4A 4WJ4A 4ALPA 4JI6Q 4OGQC 1NCVA 4F7XA 1UE1A 1PYSB 1YITA 1VMCA 4B9WA 2MO1A 2I5LX 3URYA 5C0XI 3LJ1A 5KGUA 3GTPH 2KCTA
chains in the Genus database with same CATH topology
3HFZB 4LUOA 1MJCA 1PH7A 4LFAL 2B63G 3G4SA 2B63H 4TQUS 5IYDG 1HZBA 2Q2IA 5IYDH 2Q2TA 2UUCL 5C4JH 2ZM6L 4DV2L 2F66B 2WAQE 1VQDA 3CP0A 1RIPA 2CFMA 1VQ8A 1JT8A 3PUXA 1PYBA 3RN5A 2IY5B 1E1OA 3UE1A 1QUQB 1YI2A 1OXVA 2B3GA 2JB1A 3LGJA 3S1RH 5LMNL 4A3BG 1Z47A 3U58A 1B70B 4K0KQ 4L5QA 1X9NA 1XPUA 3VA9A 1IYJB 4DR5Q 2BH2A 1HZCA 1XNRL 1QVGA 1VQCA 3AQQA 4H02A 4BA1I 3ULJA 3HOUG 2UUBQ 1N32L 3HOUH 1XMQL 2Z6KA 1NY4A 2A19A 2IHFA 4YWLA 3CCVA 2FXQA 2HIVA 2KKMA 1XMOQ 4JI3Q 2K5NA 1CSQA 1EIFA 1OXSC 1Y1WG 4PL5A 4EQ5A 1EYGA 2JA8H 5IWAQ 4KHPQ 2V1CC 1I5FA 2OQ0A 3PCOB 3H15A 3KF8B 4LNQA 3NEMA 5FLMH 2R6GA 5J3BA 1Y1VH 5M3MH 4DV3Q 1G6PA 4JI5Q 1VQPA 4QQBX 2MQHA 4IFDI 1YHAA 3KYHC 5IYCG 5IYCH 5E7NA 3A5ZB 2E2IH 2XTIA 1XNQL 1YEZA 3SDJA 2HT1A 3M4QA 4R4QA 2KCMA 4C3HH 1W2BA 3G71A 5M5XH 2JJQA 3DLLA 1YO7A 1Q8KA 2ID0A 2K52A 2NVYH 3ZJYC 1J5EQ 4A3KH 1D8LA 4LWCA 2VQFQ 3RN2A 2IX1A 3PF4A 1PVOA 1RL2A 3F8TA 3IAS1 1TWGH 3PSIA 4G75A 1YNXA 4JOIC 2NN6G 4OO1I 2LSSA 1KL9A 4LFBQ 4DR5L 2E2HH 5AJ3L 3F2CA 4DR4Q 2I5HA 4JBJA 4GN3B 4BXXG 4OWXB 2QGQA 2YV5A 1N34L 3JAMc 2F3IA 1HR0L 4PG3A 2BA1A 1WJJA 4LFCL 4QGUA 3AYHB 4DUZL 4GKJQ 1IZ6A 3J81c 1IBKL 1QZGA 2LXJA 2IX0A 3G6EA 3PIOA 4X62L 4A3DH 4DR1L 4U6RA 2K50A 4JC0A 1GO3E 4A3GH 4RG1A 1XJVA 4A3CH 4DR6L 3NBHB 1G291 4DV5Q 5C0XG 1PH9A 1VQKA 3LJ0A 2VUMG 1YVCA 2YFBA 2VUMH 1HNWQ 4NB3A 4JI7L 3S1QH 3I4NG 4DNIA 3WWVA 4IJLA 4LF9L 3TEHB 3GO5A 4B3TQ 1EWIA 4P71A 2CCZA 4YZCA 4JI4L 2PMZE 4EX5A 4DPGA 2K4KA 1Q86C 3PF5A 2ZJRA 2Y0SG 3MXNB 3HOXG 4AQYL 3T1YQ 3HOXH 1KRTA 1Q1BA 4LUZA 3S16H 4Z7GA 1DGSA 1X56A 4JV5L 4A3LH 1I94Q 4BY7G 4KLKA 4X64L 2RIOA 3NELA 4A3JH 2YTXA 3PO3G 2R93G 4DWLA 4JCVE 1L0WA 1N33L 2R93H 2HHHQ 4TVAB 5M5WH 2I0QA 1C7YA 4L5TA 1CUKA 4IOAA 2IHEA 1E3PA 4LFAQ 4DV7L 1LTLA 3RLNA 4JI0L 1JJ2A 1PH3A 1MIUA 3A0JA 5LMNW 3S2DH 2JK8A 2F4VL 2UUCQ 1VQAA 2ZM6Q 2YFAA 2N8NA 4DV2Q 4DV4L 1LM0A 2MJFB 1OXTA 3S2HH 4GLAC 2P22B 5LMNQ 1L1OA 4OWTB 3G48A 3JAMi 3UDXA 4PZ8A 1JMCA 5C4XG 5C4XH 1XNRQ 4BBRG 3K7AH 4BBRH 1PFSA 2WFWA 4NXNL 3J81i 1N32Q 3CF5A 4B3TL 1VQ5A 1XMQQ 2UXBL 4XIGS 3CW2C 1IBLL 4R4TA 1FL0A 1VQIA 4HFVA 1KC8C 2PNHA 3Q8DA 1X3GA 2MFIA 3FHWA 3CCUA 3GTKH 4OO1G 4BBSH 1H95A 4HJ9A 3PIPA 1HZ9A 1N9WA 2CKZB 3H0GG 3CD6A 3RZOH 3H0GH 1U5KA 2E5LQ 4AIMA 3U50C 4LW1A 3CCEA 2NZHA 1XNQQ 3HKSA 2AWNA 3HOVH 2OTLA 1KHIA 1CKOA 3FKIH 4YCWA 4PZ7A 4DK6C 1BBWA 2JB3A 1PA6A 1ASZA 2JE6I 3AFPA 4NV5A 1B7YB 2L1LB 2JQOA 3L0OA 5EAYA 4POFA 2QA4A 1C0AA 3T1HL 1YJWA 3KOJA 3EN2A 5FLXc 3TQYA 1HR0W 2UXDL 1VQJA 3S17H 1TWHH 3PUWA 3W5OA 1P16A 4DKAC 5AJ3Q 3UDGA 1PH2A 2AHOB 2VL6A 3RNUA 1XTDA 1KRSA 2Q2HA 1N34Q 1HR0Q 4HJ8A 3J81j 4OONA 2JA9A 1W3SA 3KDFA 4J15A 4LFCQ 4DUZQ 4GNXB 4UY8C 2ZTEA 2OWOA 2R92G 2R92H 1X55A 2RHQB 4YY3L 1IBKQ 1HNZL 4IPGA 1HNXL 3KF6A 2JA8G 4DR7L 3CMEA 1O7IA 2D0PA 4X62Q 4DR1Q 4GNXC 3HOZH 1I3QH 4HEA1 5FLMG 4A93H 1JE5A 1Y1VG 5M3MG 3JC66 4HJAA 1VQ4A 4NXML 4DR6Q 2AMCB 3BJUA 3CQZH 4YHHL 2XTRA 3UDFA 2E5LL 2CAZB 2C35B 4YCUA 4X65L 4JI7Q 1VQHA 4A3FH 1I50H 1UE6A 2JEAI 4UP8A 3CCLA 4LF9Q 4G76A 5GQOA 4IO9A 4JG2A 1PV4A 4A3KG 2AWOA 4JI4Q 3GTQH 4X6AH 3CCMA 1QVFA 1HZAA 1PH1A 4GOPA 2YU9H 1IXRA 1OXUA 3ER0A 3TRZA 3OTOQ 4AQYQ 3HOWG 2RHSB 4A75A 5IYBG 2Y0SE 1CKNA 5IYBH 1Q82C 3RLOA 3HOWH 4FDBA 1K3RA 5HY6A 2A2DA 4JV5Q 2IT1A 4X64Q 4O1OA 4R1JA 2KHJA 2A1AA 2JB2A 4BA2I 3DO9A 1N33Q 3STBD 4UP9A 2E8GA 4LF5L 4DV6L 1S40A 4B3ML 4YZDA 1QVCA 1IBML 4GN5A 2LXKA 1IL2A 4DV7Q 5HGIA 1HH2P 4JI0Q 4O0AA 4HIMA 1K83H 2HQLA 3I7FA 1CSPA 1QUQA 4OX9L 4X66L 3F2DA 2F4VQ 4JBWA 4LF7Q 1X3EA 4DV4Q 3J7ZC 3S1NH 4A3GG 4A3DG 3M7NA 3HKZG 4P75A 2VS1A 4A3CG 3RR5A 1MJEA 5K36G 4GXTA 3M3YH 1CKMA 4RMFA 3B6YA 3TREA 4DV1L 1VQ9A 4R4IA 3M4OH 1VQMA 4DR2L 3PGZA 3GTOH 1UE5A 2HHHL 4P72A 1SR3A 1L1OB 1U0LA 4NXNQ 4R4CA 4YCVA 2VQEL 2VNUD 4DAYB 1X54A 2XTQA 1R9TH 2YYZA 2UXBQ 1SE8A 3LJ2A 1JB7A 5M3FG 1IBLQ 2JA6G 3CCRA 5M3FH 2JA6H 1L1OC 2BH8A 1TWAH 2ZTCA 2N49A 4MZ9A 5BR8L 1EOVA 3OTOL 2YTVA 1A63A 1VQOA 4DR3L 3CPWA 4A3LG 4MNOA 4JYAL 3F4MA 3I56A 2FUG1 4AS3A 3FBVA 1FVIA 2KHIA 3DA4A 1UWVA 4A3JG 4B3SL 4QJFA 5JJIA 2N78A 1VQNA 1A0IA 2N3SA 2CWPA 4GN4B 4KHZA 4LF8L 3KJPA 5JEAJ 2GVBA 3D0FA 4UP7A 1UE7A 3CXCA 4JOIA 4A3IG 4A3IH 1N36L 3M4PA 4L5RC 4QIWE 4B3RL 3BU2A 5GAHC 4PL4A 1VQ6A 4JBKA 2L15A 2R7DA 1XPOA 5GADC 3PV0A 2B29A 5FJ8H 2K75A 3PUYA 2F52A 3CCJA 1K8AC 4LF7L 4HIKA 4NV2A 4GLXA 3A5UA 4L5SA 5GAGC 3ULPA 1LUZA 3I4OA 3T1HQ 2KBNA 4IPHA 4LF4L 4YWKA 2D62A 2UXDQ 3AFQA 5C0XJ 3ULLA 1YJ9A 3KP9A 1Q7YC 4P74A 1VQBA 2VZAA 3E9IA 4BY1G 4JI8L 5ELOA 4C3JH 4BY1H 4A4IA 4LFBL 1V43A 1E22A 3S1MH 4JBMA 1FJGL 4YY3Q 4GKKL 1HNZQ 1HNXQ 3CC2A 4DR7Q 2ALYB 1YIJA 4BBSG 2WB1E 3PUZA 3CC4A 3E0EA 1FGUA 3GTPH 4YWMA 3RLFA 4O2DA 2Z6KC 4NXMQ 2K5VA 1KQSA 1D7QA 4YHHQ 1EUJA 3JSBA 4DAMA 1WCMH 1NMFA 5DLQE 5ELNA 4X65Q 4APVA 3KJOA 4DUYL 1E24A 1BKBA 3UDIA 1PH4A 3HOVG 4HJ7A 3FKIG 1PH5A 1EQRA 1WFQA 4DV0L 1N8RC 1VS0A 1G51A 2MO0A 2ZTDA 4QL5A 1E1TA 1K0RA 2JA5G 1K9MC 2JA5H 4P73A 2K5HA 1VQFA 2UU9L 2NVQH 3I2ZA 4ME3A 1GD7A 2NVTH 3K0XA 1SRUA 4LF6L 4IFDJ 1KAWA 3CC7A 1YBYA 1TXYA 3STBC 2NVXH 3OW2A 3GTGH 2UUAL 5IP7G 1NMGA 2A2CA 1Y14B 5HGQA 5IP7H 1GVPA 1MKHA 3GTJH 4JI2L 3ICEA 1E7ZA 1YHBA 4AYBE 1PH6A 4LF5Q 3SGIA 4DV6Q 4B3MQ 4IPDA 1IBMQ 2UXCL 3DM3A 2HIXA 2VW9A 2E2JH 1C9OA 1HJPA 4LUVA 3W1GA 2WB1G 5GROA 5IP9G 3AJFA 1YZ6A 3L7ZC 5IP9H 2EXDA 4X66Q 4OX9Q 2IP6A 3HOZG 4A93G 4Z7HA 3D31A 1NBWA 2AKWB 2GVAA 3L2PA 5LMUL 3HKZE 1SFOH 2KENA 4DV1Q 3S14H 1SLJA 4A3BH 4DR2Q 1OTCA 1A8VA 2YTYA 2F6MB 2PQAA 4A3FG 1VQGA 3KLWA 1SROA 3CCQA 2VQEQ 2JEBI 2EIFA 4PZ6A 4C2MH 4JI1L 5C44G 5C44H 2K14A 1M1KC 3E9HA 1A62A 1ASYA 2JA7G 4MTNA 2BA0A 2JA7H 4Y52H 5BR8Q 5IT9c 4JI6L 1Y1WH 1JJGA 4DR3Q 1AH9A 1PH8A 1KXLA 4JYAQ 3K8AA 2A8VA 3I4MG 3I4MH 2V6EA 3W1BA 3AEVA 3PUVA 1L2FA 5M5YH 4B3SQ 3K80C 4XTCS 1Q1EA 3TS0A 4OXPA 4AYBG 2Q2UA 3I55A 2QEXA 2ZRRA 3K7UC 4LF8Q 3CPFA 3K81C 3J80c 3CAMA 4Y7NH 5JJLA 3M85A 1N36Q 1VQ7A 4PL3A 4OWWB 3H3VH 4B3RQ 3U4ZA 5IE8A 4YZ9A 2DGYA 2OQKA 2WAQG 3GTLH 2MNAA 1TWCH 5JJKA 2D0OA 3CMAA 4AS2A 4AH6A 1Q46A 4C3IH 2OCEA 2ES2A 1XPRA 2R7FA 2EQSA 3IRBA 4LF4Q 1QZHA 4K0KL 4KI0A 3UITA 4A3MG 4A3MH 3VDYA 5GAEC 3L0IA 3EIVA 4JI8Q 4GNXA 4UPAA 5JEAG 2UUBL 3NENA 2R7ZH 2R7ZG 4BXXH 2Z0SA 4GS3A 4A3EG 1GKHA 4A3EH 3J7A5 2CQOA 1UEBA 1SJ8A 4JI3L 1XMOL 2XGTA 1FJGQ 1J6QA 2ZJQA 4GKKQ 5IY0A 1Q81C 1YHQA 3TS2A 4I1TA 1Q12A 5IWAL 1GM5A 4KHPL 1AE2A 1B8AA 4IOCA 4GLVB 4DV3L 2H5XA 4JI5L 5C3EG 1YJNA 5C3EH 1VCIA 1KIXA 1SN8A 5H1SE 1BBUA 3GD7A 4DUYQ 3I4NH 2ATWA 4OAVB 3A74A 1J5EL 2NZOA 2ZJPA 4DV0Q 5FJ8G 1WYDA 3ERSX 2VQFL 2RF4A 1LYLA 1PHJA 2UU9Q 4Q9VA 3GTMH 3S15H 3GDEA 1JJCB 2PI2E 1K8GA 4DK3C 1OXXK 3P23A 3BZKA 1V9PA 2PI2A 4IPCA 3J80i 4LF6Q 2RCNA 1P8LA 2JAEA 1X65A 4BY7H 3KFUA 2UUAQ 1WI5A 3PO3H 4JI2Q 4DR4L 1EIYB 1V1QA 1Z9FA 2XMXA 2UXCQ 2VY3A 3H3VI 4GKJL 4R4OA 1NTGA 5LNK1 3KDFB 3FP9A 4NPSA 3CCSA 1EFWA 3OYYA 1T9HA 4IJHA 1VQEA 1I6HH 4QY7A 3KF6B 5LMUQ 3HOYG 4HJ5A 2I5MX 3HOYH 4IFDG 4DV5L 2ASBA 1NE3A 1TWFH 4O1PA 1WCMG 2NN6I 3F1ZA 3F2BA 1HNWL 2DUDA 1NJIC 3UE0A 1AE3A 3DA3A 1S72A 1SMXA 4POGA 4WJ3M 3M9BA 3S24A 3I9V1 1BVSA 1X3FA 2K19A 2PQAB 4JI1Q 2CWAA 3RZDH 3MEFA 1WOCA 2WP8J 1EQQA 3PO2G 3PO2H 3BZCA 1VQLA 4WJ4A 2GN5A 4ALPA 4JI6Q 1KD1C 4OAUC 3T1YL 4HIDA 3U4VA 4PMWA 4A76A 1I94L 4GOPB 1S3OA 1UE1A 1PYSB 1X6OA 3EBEA 1YITA 2MO1A 2I5LX 1CKNB 2OTJA 5C0XI 1K73C 3LJ1A 1M90C 3IAM1 4GOPC 4HIOA 2KCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFZ B;  4LUO A;  1MJC A;  1PH7 A;  4LFA L;  2B63 G;  3G4S A;  2B63 H;  4TQU S;  5IYD G;  1HZB A;  2Q2I A;  5IYD H;  2Q2T A;  2UUC L;  5C4J H;  2ZM6 L;  4DV2 L;  2WAQ E;  1VQD A;  3CP0 A;  1RIP A;  2CFM A;  1VQ8 A;  1JT8 A;  3PUX A;  1PYB A;  3RN5 A;  2IY5 B;  1E1O A;  3UE1 A;  1QUQ B;  1YI2 A;  1OXV A;  2B3G A;  3LGJ A;  3S1R H;  4A3B G;  5LMN L;  1Z47 A;  3U58 A;  1B70 B;  4K0K Q;  4L5Q A;  1X9N A;  1XPU A;  1IYJ B;  4DR5 Q;  2BH2 A;  1HZC A;  1XNR L;  1QVG A;  1VQC A;  3AQQ A;  4H02 A;  4BA1 I;  3ULJ A;  3HOU G;  2UUB Q;  1N32 L;  3HOU H;  1XMQ L;  2Z6K A;  1NY4 A;  2A19 A;  2IHF A;  4YWL A;  3CCV A;  2FXQ A;  2HIV A;  1XMO Q;  4JI3 Q;  2K5N A;  1CSQ A;  1EIF A;  1OXS C;  1Y1W G;  4EQ5 A;  1EYG A;  2JA8 H;  5IWA Q;  4KHP Q;  2V1C C;  1I5F A;  2OQ0 A;  3PCO B;  3H15 A;  3KF8 B;  4LNQ A;  3NEM A;  5FLM H;  2R6G A;  5J3B A;  1Y1V H;  5M3M H;  4DV3 Q;  1G6P A;  4JI5 Q;  1VQP A;  4QQB X;  2MQH A;  4IFD I;  1YHA A;  3KYH C;  5IYC G;  5IYC H;  5E7N A;  3A5Z B;  2E2I H;  2XTI A;  1XNQ L;  1YEZ A;  2HT1 A;  3M4Q A;  4R4Q A;  2KCM A;  4C3H H;  1W2B A;  3G71 A;  5M5X H;  2JJQ A;  3DLL A;  3ZJY C;  1Q8K A;  2ID0 A;  2K52 A;  2NVY H;  1J5E Q;  4A3K H;  1D8L A;  4LWC A;  2VQF Q;  3RN2 A;  2IX1 A;  3PF4 A;  1PVO A;  1RL2 A;  3F8T A;  1TWG H;  3PSI A;  1YNX A;  4JOI C;  2NN6 G;  4OO1 I;  2LSS A;  1KL9 A;  4LFB Q;  4DR5 L;  2E2H H;  5AJ3 L;  3F2C A;  4DR4 Q;  2I5H A;  4JBJ A;  4GN3 B;  4BXX G;  4OWX B;  2QGQ A;  2YV5 A;  1N34 L;  3JAM c;  2F3I A;  1HR0 L;  4PG3 A;  2BA1 A;  1WJJ A;  4LFC L;  4QGU A;  3AYH B;  4DUZ L;  4GKJ Q;  1IZ6 A;  3J81 c;  1IBK L;  1QZG A;  2LXJ A;  2IX0 A;  3G6E A;  3PIO A;  4X62 L;  4A3D H;  4DR1 L;  2K50 A;  4JC0 A;  1GO3 E;  4A3G H;  4RG1 A;  1XJV A;  4A3C H;  4DR6 L;  3NBH B;  1G29 1;  4DV5 Q;  5C0X G;  1PH9 A;  1VQK A;  2VUM G;  1YVC A;  2VUM H;  1HNW Q;  4NB3 A;  4JI7 L;  3S1Q H;  3I4N G;  4DNI A;  3WWV A;  4IJL A;  4LF9 L;  3TEH B;  3GO5 A;  4B3T Q;  1EWI A;  4P71 A;  2CCZ A;  4JI4 L;  2PMZ E;  4EX5 A;  4DPG A;  2K4K A;  1Q86 C;  3PF5 A;  2ZJR A;  2Y0S G;  3MXN B;  3HOX G;  4AQY L;  3T1Y Q;  3HOX H;  1KRT A;  1Q1B A;  4LUZ A;  3S16 H;  1DGS A;  1X56 A;  4JV5 L;  4A3L H;  1I94 Q;  4BY7 G;  4KLK A;  4X64 L;  3NEL A;  4A3J H;  2YTX A;  3PO3 G;  2R93 G;  4JCV E;  1L0W A;  1N33 L;  2R93 H;  2HHH Q;  4TVA B;  5M5W H;  2I0Q A;  1C7Y A;  4L5T A;  1CUK A;  4IOA A;  2IHE A;  1E3P A;  4LFA Q;  4DV7 L;  1LTL A;  3RLN A;  4JI0 L;  1JJ2 A;  1PH3 A;  1MIU A;  3A0J A;  5LMN W;  3S2D H;  2JK8 A;  2F4V L;  2UUC Q;  1VQA A;  2ZM6 Q;  2N8N A;  4DV2 Q;  4DV4 L;  1LM0 A;  1OXT A;  3S2H H;  4GLA C;  5LMN Q;  1L1O A;  4OWT B;  3G48 A;  3JAM i;  3UDX A;  4PZ8 A;  1JMC A;  5C4X G;  5C4X H;  1XNR Q;  4BBR G;  3K7A H;  4BBR H;  1PFS A;  2WFW A;  4NXN L;  3J81 i;  1N32 Q;  3CF5 A;  4B3T L;  1VQ5 A;  1XMQ Q;  2UXB L;  4XIG S;  3CW2 C;  1IBL L;  4R4T A;  1FL0 A;  1VQI A;  1KC8 C;  2PNH A;  3Q8D A;  1X3G A;  2MFI A;  3FHW A;  3CCU A;  3GTK H;  4OO1 G;  4BBS H;  1H95 A;  4HJ9 A;  3PIP A;  1HZ9 A;  1N9W A;  2CKZ B;  3H0G G;  3CD6 A;  3RZO H;  3H0G H;  1U5K A;  2E5L Q;  4AIM A;  3U50 C;  4LW1 A;  3CCE A;  2NZH A;  1XNQ Q;  3HKS A;  2AWN A;  3HOV H;  2OTL A;  1KHI A;  1CKO A;  3FKI H;  4YCW A;  4PZ7 A;  4DK6 C;  1BBW A;  1PA6 A;  1ASZ A;  2JE6 I;  3AFP A;  1B7Y B;  1C0A A;  2JQO A;  3L0O A;  5EAY A;  4POF A;  2QA4 A;  1KXL A;  3T1H L;  1YJW A;  3KOJ A;  3EN2 A;  5FLX c;  3TQY A;  1HR0 W;  2UXD L;  1VQJ A;  3S17 H;  1TWH H;  3PUW A;  3W5O A;  1P16 A;  4DKA C;  5AJ3 Q;  3UDG A;  1PH2 A;  2AHO B;  2VL6 A;  3RNU A;  1XTD A;  1KRS A;  2Q2H A;  1N34 Q;  1HR0 Q;  4HJ8 A;  3J81 j;  4OON A;  2JA9 A;  1W3S A;  3KDF A;  4J15 A;  4LFC Q;  4DUZ Q;  4GNX B;  4UY8 C;  2ZTE A;  2OWO A;  2R92 G;  2R92 H;  1X55 A;  2RHQ B;  4YY3 L;  1IBK Q;  1HNZ L;  4IPG A;  1HNX L;  3KF6 A;  2JA8 G;  4DR7 L;  3CME A;  1O7I A;  2D0P A;  4X62 Q;  4DR1 Q;  4GNX C;  3HOZ H;  1I3Q H;  5FLM G;  4A93 H;  1JE5 A;  1Y1V G;  5M3M G;  3JC6 6;  4HJA A;  1VQ4 A;  4NXM L;  4DR6 Q;  2AMC B;  3BJU A;  3CQZ H;  4YHH L;  3UDF A;  2E5L L;  2C35 B;  4YCU A;  4X65 L;  4JI7 Q;  1VQH A;  4A3F H;  1I50 H;  1UE6 A;  2JEA I;  4UP8 A;  3CCL A;  4LF9 Q;  4IO9 A;  5GQO A;  3GTQ H;  4JG2 A;  1PV4 A;  4A3K G;  2AWO A;  4JI4 Q;  3CCM A;  1QVF A;  1HZA A;  1PH1 A;  4GOP A;  2YU9 H;  1IXR A;  1OXU A;  3ER0 A;  3TRZ A;  3OTO Q;  4AQY Q;  3HOW G;  2RHS B;  4A75 A;  5IYB G;  2Y0S E;  1CKN A;  5IYB H;  1Q82 C;  3RLO A;  3HOW H;  4FDB A;  1K3R A;  5HY6 A;  4JV5 Q;  2IT1 A;  4X64 Q;  4R1J A;  2KHJ A;  2A1A A;  4BA2 I;  1N33 Q;  3STB D;  4UP9 A;  2E8G A;  4LF5 L;  4DV6 L;  1S40 A;  4B3M L;  1QVC A;  1IBM L;  4GN5 A;  2LXK A;  1IL2 A;  4DV7 Q;  4JI0 Q;  1HH2 P;  4O0A A;  4HIM A;  1K83 H;  2HQL A;  3I7F A;  1CSP A;  1QUQ A;  4OX9 L;  4X66 L;  3F2D A;  2F4V Q;  4JBW A;  4LF7 Q;  1X3E A;  4DV4 Q;  3J7Z C;  3S1N H;  4A3G G;  4A3D G;  3M7N A;  3HKZ G;  4P75 A;  2VS1 A;  4A3C G;  3RR5 A;  1MJE A;  5K36 G;  3M3Y H;  1CKM A;  4RMF A;  3B6Y A;  3TRE A;  4DV1 L;  1VQ9 A;  4R4I A;  3M4O H;  1VQM A;  4DR2 L;  3PGZ A;  3GTO H;  1UE5 A;  2HHH L;  4P72 A;  1SR3 A;  1L1O B;  1U0L A;  4NXN Q;  4R4C A;  4YCV A;  2VQE L;  2VNU D;  4DAY B;  1X54 A;  1R9T H;  2YYZ A;  2UXB Q;  1SE8 A;  1JB7 A;  2JA6 G;  5M3F G;  1IBL Q;  2JA6 H;  3CCR A;  5M3F H;  1L1O C;  2BH8 A;  1TWA H;  2ZTC A;  2N49 A;  4MZ9 A;  5BR8 L;  1EOV A;  3OTO L;  2YTV A;  1A63 A;  1VQO A;  4DR3 L;  3CPW A;  4A3L G;  4MNO A;  4JYA L;  3I56 A;  1FVI A;  2KHI A;  1UWV A;  4A3J G;  4B3S L;  4QJF A;  5JJI A;  2N78 A;  1VQN A;  1A0I A;  2N3S A;  2CWP A;  4GN4 B;  4KHZ A;  4LF8 L;  3KJP A;  5JEA J;  2GVB A;  3D0F A;  4UP7 A;  1UE7 A;  3CXC A;  4JOI A;  4A3I G;  4A3I H;  1N36 L;  3M4P A;  4L5R C;  4QIW E;  4B3R L;  3BU2 A;  5GAH C;  1VQ6 A;  4JBK A;  2L15 A;  2R7D A;  1XPO A;  5GAD C;  3PV0 A;  2B29 A;  5FJ8 H;  2K75 A;  3PUY A;  2F52 A;  3CCJ A;  1K8A C;  4LF7 L;  4HIK A;  4GLX A;  3A5U A;  4L5S A;  5GAG C;  3ULP A;  1LUZ A;  3I4O A;  3T1H Q;  2KBN A;  4IPH A;  4LF4 L;  4YWK A;  2D62 A;  2UXD Q;  3AFQ A;  5C0X J;  3ULL A;  1YJ9 A;  1Q7Y C;  4P74 A;  1VQB A;  2VZA A;  3E9I A;  4BY1 G;  4JI8 L;  5ELO A;  4C3J H;  4BY1 H;  4A4I A;  4LFB L;  1V43 A;  1E22 A;  3S1M H;  4JBM A;  1FJG L;  4YY3 Q;  4GKK L;  1HNZ Q;  1HNX Q;  3CC2 A;  4DR7 Q;  2ALY B;  1YIJ A;  4BBS G;  2WB1 E;  3PUZ A;  3CC4 A;  3E0E A;  1FGU A;  3GTP H;  4YWM A;  3RLF A;  4O2D A;  2Z6K C;  4NXM Q;  2K5V A;  1KQS A;  1D7Q A;  4YHH Q;  1EUJ A;  4DAM A;  1WCM H;  1NMF A;  5DLQ E;  5ELN A;  4X65 Q;  4APV A;  3KJO A;  4DUY L;  1E24 A;  1BKB A;  3UDI A;  1PH4 A;  3HOV G;  4HJ7 A;  3FKI G;  1PH5 A;  1EQR A;  1WFQ A;  4DV0 L;  1N8R C;  1VS0 A;  1G51 A;  2MO0 A;  2ZTD A;  4QL5 A;  1E1T A;  1K0R A;  2JA5 G;  1K9M C;  2JA5 H;  4P73 A;  2K5H A;  1VQF A;  2UU9 L;  2NVQ H;  3I2Z A;  4ME3 A;  1GD7 A;  2NVT H;  3K0X A;  1SRU A;  4LF6 L;  4IFD J;  1KAW A;  3CC7 A;  1YBY A;  1TXY A;  3STB C;  2NVX H;  3OW2 A;  3GTG H;  2UUA L;  5IP7 G;  1NMG A;  1Y14 B;  5HGQ A;  5IP7 H;  3GTJ H;  1GVP A;  1MKH A;  4JI2 L;  1E7Z A;  1YHB A;  4AYB E;  1PH6 A;  4LF5 Q;  3SGI A;  4DV6 Q;  4B3M Q;  4IPD A;  1IBM Q;  2UXC L;  3DM3 A;  2HIX A;  2VW9 A;  2E2J H;  1C9O A;  1HJP A;  4LUV A;  3W1G A;  2WB1 G;  5GRO A;  5IP9 G;  4OX9 Q;  1YZ6 A;  3L7Z C;  5IP9 H;  2EXD A;  4X66 Q;  3HOZ G;  4A93 G;  3D31 A;  1NBW A;  2AKW B;  2GVA A;  3L2P A;  5LMU L;  3HKZ E;  1SFO H;  2KEN A;  4DV1 Q;  3S14 H;  1SLJ A;  4A3B H;  4DR2 Q;  1OTC A;  1A8V A;  2YTY A;  2PQA A;  4A3F G;  1VQG A;  3KLW A;  1SRO A;  3CCQ A;  2VQE Q;  2JEB I;  2EIF A;  4PZ6 A;  4C2M H;  4JI1 L;  5C44 G;  5C44 H;  2K14 A;  1M1K C;  3E9H A;  1A62 A;  1ASY A;  2JA7 G;  4MTN A;  2BA0 A;  2JA7 H;  4Y52 H;  5BR8 Q;  5IT9 c;  4JI6 L;  1Y1W H;  1JJG A;  4DR3 Q;  1AH9 A;  1PH8 A;  4JYA Q;  3K8A A;  2A8V A;  3I4M G;  3I4M H;  3W1B A;  4X6A H;  3AEV A;  3PUV A;  1L2F A;  5M5Y H;  4B3S Q;  3K80 C;  4XTC S;  1Q1E A;  3TS0 A;  4OXP A;  4AYB G;  2Q2U A;  3I55 A;  2QEX A;  3K7U C;  4LF8 Q;  3CPF A;  3K81 C;  3J80 c;  3CAM A;  4Y7N H;  5JJL A;  3M85 A;  1N36 Q;  1VQ7 A;  4OWW B;  3H3V H;  4B3R Q;  3U4Z A;  5IE8 A;  2DGY A;  2OQK A;  2WAQ G;  3GTL H;  2MNA A;  1TWC H;  5JJK A;  2D0O A;  3CMA A;  4AH6 A;  1Q46 A;  4C3I H;  2OCE A;  2ES2 A;  1XPR A;  2R7F A;  2EQS A;  3IRB A;  4LF4 Q;  1QZH A;  4K0K L;  4KI0 A;  4A3M G;  4A3M H;  3VDY A;  5GAE C;  3EIV A;  4JI8 Q;  4GNX A;  4UPA A;  5JEA G;  2UUB L;  3NEN A;  2R7Z H;  2R7Z G;  4BXX H;  2Z0S A;  4GS3 A;  4A3E G;  1GKH A;  4A3E H;  3J7A 5;  2CQO A;  1UEB A;  4JI3 L;  1XMO L;  2XGT A;  1FJG Q;  1J6Q A;  2ZJQ A;  4GKK Q;  5IY0 A;  1Q81 C;  1YHQ A;  3TS2 A;  1Q12 A;  1GM5 A;  5IWA L;  4KHP L;  1AE2 A;  1B8A A;  4IOC A;  4GLV B;  4DV3 L;  2H5X A;  4JI5 L;  5C3E G;  1YJN A;  5C3E H;  1VCI A;  1KIX A;  1SN8 A;  5H1S E;  1BBU A;  3GD7 A;  4DUY Q;  3I4N H;  2ATW A;  3A74 A;  1J5E L;  2NZO A;  2ZJP A;  4DV0 Q;  5FJ8 G;  1WYD A;  3ERS X;  2VQF L;  2RF4 A;  1LYL A;  1PHJ A;  2UU9 Q;  3GTM H;  3S15 H;  3GDE A;  1JJC B;  2PI2 E;  1K8G A;  4DK3 C;  1OXX K;  3ICE A;  3BZK A;  1V9P A;  2PI2 A;  4IPC A;  3J80 i;  4LF6 Q;  2RCN A;  1P8L A;  1X65 A;  4BY7 H;  3KFU A;  2UUA Q;  1WI5 A;  3PO3 H;  4JI2 Q;  4DR4 L;  1EIY B;  1V1Q A;  1Z9F A;  2UXC Q;  2VY3 A;  3H3V I;  4GKJ L;  4R4O A;  1NTG A;  3KDF B;  3FP9 A;  4NPS A;  3CCS A;  1EFW A;  3OYY A;  1T9H A;  4IJH A;  1VQE A;  1I6H H;  4QY7 A;  3KF6 B;  5LMU Q;  3HOY G;  4HJ5 A;  2I5M X;  3HOY H;  4IFD G;  4DV5 L;  2ASB A;  1NE3 A;  1TWF H;  2NN6 I;  1WCM G;  3F1Z A;  3F2B A;  1HNW L;  2DUD A;  1NJI C;  3UE0 A;  1AE3 A;  1S72 A;  4POG A;  1SMX A;  4WJ3 M;  3M9B A;  3S24 A;  2PQA B;  1BVS A;  1X3F A;  4JI1 Q;  2CWA A;  3RZD H;  3MEF A;  1WOC A;  2WP8 J;  1EQQ A;  3PO2 G;  3PO2 H;  3BZC A;  1VQL A;  4WJ4 A;  2GN5 A;  4ALP A;  4JI6 Q;  1KD1 C;  3T1Y L;  4HID A;  3U4V A;  4PMW A;  4A76 A;  1I94 L;  4GOP B;  1S3O A;  1UE1 A;  1PYS B;  1X6O A;  3EBE A;  1YIT A;  2MO1 A;  2I5L X;  1CKN B;  2OTJ A;  5C0X I;  1K73 C;  1M90 C;  4GOP C;  4HIO A;  2KCT A; 
#chains in the Genus database with same CATH topology
 4IUR A;  4JW0 A;  1QCB D;  5E3F A;  1HZB A;  4IQZ A;  4G7H C;  1C8C A;  5C4J H;  2CVR A;  2M00 A;  2K33 A;  2HCC A;  1RIP A;  2CFM A;  1EU4 A;  5ELB A;  1VQ8 A;  1PYB A;  1BCP C;  3RN5 A;  1JIC A;  4DA2 A;  3S2D B;  1PZJ D;  3U58 A;  1B70 B;  4L5Q A;  2PO4 A;  1LAC A;  2BE5 D;  4CDD C;  1VQC A;  4BA1 I;  4H02 A;  3BDO A;  1N32 L;  4DN4 M;  2UUB Q;  1E2W A;  1SMY C;  2A19 A;  3NE5 B;  4FF1 A;  1XMO Q;  2K5N A;  2BL7 A;  1EIF A;  4BBR B;  1BCP F;  2AUJ D;  1I5F A;  1ICW A;  1S5B D;  1M4V A;  1Y1V H;  5M3M H;  1YHA A;  1CK1 A;  5E7N A;  1F2L A;  1TQO A;  1XXG A;  4C3H H;  1B2T A;  5M5X H;  1KAA A;  4CGY B;  4C56 C;  1EL0 A;  1PVO A;  2L4N A;  4QIW B;  3TSS A;  4IN3 A;  1MSG A;  3FKI B;  3C3L A;  2D2C C;  2G9D A;  4I7Z C;  4WRD A;  3F2C A;  1BOS A;  1ESR A;  2F0E A;  4GN3 B;  1EY7 A;  1N34 L;  2MGS A;  4PG3 A;  1TWH B;  4DUZ L;  1JE4 A;  4O42 A;  4CKB A;  1EY6 A;  4FNF A;  3G6E A;  1GO3 E;  3PQI A;  1XJV A;  4DR6 L;  3AB9 A;  2R92 B;  3ONA B;  4ZUI A;  1CHP D;  4O1N A;  1HUN A;  1MBY A;  4IJL A;  4JK1 C;  3GO5 A;  1GUS A;  1I4Q A;  2M9V A;  2RDG A;  1Q86 C;  2ZJR A;  2Y0S G;  3S16 H;  1Q1B A;  4LUZ A;  1DGS A;  1X56 A;  4JV5 L;  4BY7 G;  4X64 L;  1GOZ A;  2B2T C;  2YU9 B;  2JA7 B;  4FF3 A;  2R93 G;  2Z4I A;  4NW2 A;  3HOW B;  5M5W H;  1E3P A;  2NTS A;  2TMP A;  3RLN A;  1G91 A;  5LMN W;  4DNT B;  2UUC Q;  2F4V L;  1WTX A;  2YFA A;  2SEB D;  4DV4 L;  3J80 E;  1LM0 A;  3V05 A;  2B2V C;  2QGM A;  3UDX A;  1JMC A;  2P5Z X;  1CQV A;  3K7A H;  3J81 i;  1NSN S;  2EYH A;  3NWT A;  2MUY A;  4TRD A;  3Q23 A;  1XMQ Q;  4L8J A;  1FL0 A;  3MC0 B;  4HFV A;  1KC8 C;  1GUW A;  2PNH A;  3Q8D A;  3FHW A;  3X3M A;  3GTK H;  4HAE A;  3DEP A;  1KLU D;  1EWC A;  2JA6 B;  1SJE D;  1TWA B;  3RZO H;  4KKS A;  1NR4 A;  5EPJ A;  2E5L Q;  3VYT A;  3CCE A;  1XNQ Q;  1LTS D;  3E5S A;  3HOV H;  5I9P A;  1CKO A;  1BUV T;  4YCW A;  4PZ7 A;  4DK6 C;  1BBW A;  2JB3 A;  5L37 A;  2JE6 I;  4NV5 A;  1B7Y B;  2JQO A;  5EAY A;  4POF A;  3T1H L;  3EN2 A;  3IFT A;  4LMQ D;  3K5L A;  3C1F A;  3PUW A;  5AJ3 Q;  1ENF A;  3EFX D;  3UDG A;  2Q2H A;  3CU7 A;  1HR0 Q;  4HJ8 A;  4OON A;  2JA9 A;  1FNV A;  1K8M A;  4UY8 C;  2ZTE A;  2RHQ B;  2F0T A;  1IBK Q;  2JA8 G;  1O7I A;  4DR1 Q;  4GNX C;  1EIH A;  5M9O A;  5FLM G;  1VQ4 A;  3NQI A;  4YHH L;  2XTR A;  1CHQ D;  2RKS A;  4FXG C;  2CAZ B;  2C35 B;  4X65 L;  4A3F H;  1PFN A;  1MSH A;  2CH4 W;  4A3K G;  1PH1 A;  1IXR A;  1OXU A;  3OTO Q;  2FHT A;  4P2C B;  1Q82 C;  4I65 A;  4FDB A;  2BL8 A;  1J9O A;  5D14 A;  4X3K A;  3PO2 B;  2KHJ A;  3A54 A;  2L5T A;  1N33 Q;  4K2K A;  1DJR D;  5EJW A;  4DV6 L;  3IAY A;  1QVC A;  1IL2 A;  4DV7 Q;  4JI0 Q;  3GTG B;  1DYQ A;  3I7F A;  4OX9 L;  2AQ2 B;  3F2D A;  1LTG D;  4JBW A;  1X3E A;  4RCN A;  4A3G G;  3M7N A;  4H13 C;  4H7B A;  3KLS A;  4P75 A;  2VS1 A;  3SE0 A;  4A3C G;  5K36 G;  4GXT A;  2B8G A;  5D3D A;  3SK4 A;  4HMI A;  5KND A;  2HHH L;  1V1O A;  3DXJ C;  3MZ5 A;  3OMC A;  4R4C A;  2VQE L;  3C2P A;  2F3W A;  1X54 A;  4BS9 A;  1IKL A;  2UXB Q;  5M3F G;  1PTO H;  2N49 A;  4MZ9 A;  1RDP D;  1EOV A;  2TSS A;  4DR3 L;  3S9W A;  3F4M A;  3I56 A;  1FVI A;  3I73 A;  4B3S L;  2N78 A;  1VQN A;  1A0I A;  2Z6B A;  1Y1W B;  4KHZ A;  3A8J E;  5JEA J;  2GVB A;  2RVL A;  3D0F A;  2FEF A;  4KN7 C;  1N36 L;  4K6D A;  4FXD A;  4JBK A;  1PRT C;  4NV2 A;  3H91 A;  4L5S A;  2MJ8 A;  2A6H C;  5GAG C;  2NWG A;  1UEA B;  4IPH A;  2UXD Q;  3CHB D;  5JJZ A;  3AFQ A;  3OHX C;  4FVM A;  1DD2 A;  4ZQ3 A;  1Q7Y C;  4WJW A;  4C3J G;  3E9I A;  1S5F D;  5ELO A;  4A4I A;  5EPK A;  5CC4 A;  5A2Q L;  3S1M H;  4A3M B;  1FJG L;  1PRT F;  1C48 A;  4GKK L;  3CC2 A;  4DR7 Q;  5I2X A;  2ICI A;  1WTR A;  4M1U B;  1SNC A;  3CC4 A;  3E0E A;  3RLF A;  2G9H D;  1EQV A;  3EA6 A;  1CA6 A;  2EYM A;  2K7V A;  3J81 L;  3B55 A;  1BKB A;  3UDI A;  2FU2 A;  3FKI G;  1TKW B;  4DV0 L;  1G51 A;  2MO0 A;  1B9N A;  2SDF A;  2NVQ H;  2DNE A;  4K5V A;  3FVQ A;  4LF6 L;  1JR0 D;  4IFD J;  3K0Y A;  2UUA L;  1NMG A;  1ONL A;  1KAB A;  4Q5V A;  2ZXP A;  1KTK A;  1YHB A;  3HOX B;  3ERO A;  4B3M Q;  4IPD A;  3T4A C;  3I3C A;  1O7Y A;  4LUV A;  5JPN C;  3AJF A;  1YZ6 A;  3E0J A;  2IP6 A;  4WOR A;  1NBW A;  1MI2 A;  3HKZ E;  1SLJ A;  1A8V A;  1EY4 A;  3CCQ A;  1TS2 A;  2OT2 A;  4C2M H;  2K14 A;  2JA7 G;  1K8O A;  4ZCK A;  5IT9 c;  4EVO A;  3NTK A;  4L63 B;  1PH8 A;  4JYA Q;  2PMZ B;  3K8A A;  3ND8 A;  4X6A H;  2RCF A;  4JVZ A;  2WIN B;  3I55 A;  3K7U C;  4LF8 Q;  1CA5 A;  4Y7N H;  2A68 D;  1YNJ C;  1YNN C;  3P7J A;  4V0B A;  1FGB D;  4YZ9 A;  5T1G A;  1SE2 A;  2MNA A;  1TWC H;  2XN9 C;  3ZYY X;  3DMU A;  4ID6 A;  4AH6 A;  4RGO S;  3U9O A;  4LF4 Q;  2EQS A;  2EJM A;  2OF1 A;  1EY0 A;  1WTH A;  3IRB A;  3PMF A;  2F0M A;  3L0I A;  1QNU A;  2EY2 A;  5JEA G;  2R7Z G;  4LFB Q;  1EIG A;  2KCC A;  4JI3 L;  4N9P A;  1J6Q A;  5JAV A;  1GUT A;  1ZYR C;  5IY0 A;  4EGV A;  4HN7 A;  2RSO A;  4DV3 L;  1STE A;  3BDL A;  1ILP A;  2A74 C;  4K8I A;  4CDF C;  1AZQ A;  2CHB D;  2HQE A;  1FR3 A;  1J5E L;  4N8F A;  5FJ8 G;  5G3L D;  4Q9V A;  1G2S A;  4F8M A;  3S15 H;  2F0N A;  2WKD A;  4DK3 C;  1JOR A;  1OXX K;  3P23 A;  3BZK A;  1V9P A;  2NVY B;  3R2I A;  4FXK C;  5E4X A;  3J80 i;  1P8L A;  4BY7 H;  2A6E D;  3FRP B;  4DR4 L;  1B9M A;  3GQB A;  1V1Q A;  3SXH A;  1VF5 C;  2UXC Q;  2R3Z A;  2E2H B;  1SNM A;  1I4G A;  1QWY A;  3KDF B;  1AEX A;  3CCS A;  2NZ1 D;  1D6E C;  4QY7 A;  4IFD G;  4DV5 L;  1NE3 A;  3LNN A;  3F1Z A;  4O1P A;  2NN6 I;  3T16 A;  1IYU A;  3J81 E;  1CT1 D;  3F2B A;  1ZKO A;  4A3D B;  1SND A;  3M9B A;  3S24 A;  4XQJ A;  2CWA A;  3PO2 G;  3K59 A;  2B2Y C;  2GN5 A;  1VDZ A;  3T1Y L;  4XT3 B;  4HID A;  3U4V A;  4PMW A;  1I94 L;  1X6O A;  3EBE A;  2L0C A;  2OTJ A;  2Y0S B;  1K73 C;  5LHY 1;  4GOP C;  3A7A B;  3HFZ B;  3D4W A;  4LFA L;  2B63 H;  1SDF A;  5IYD G;  2R93 B;  4DV2 L;  1KDB A;  2WAQ E;  3IL8 A;  3CP0 A;  1JT8 A;  3PUX A;  1EYD A;  1QUQ B;  1YI2 A;  3S1R H;  1XPU A;  1KDC A;  2IPK D;  3VA9 A;  1A2U A;  1IYJ B;  2B2W A;  2KCN A;  1HZC A;  4LAA A;  2N55 A;  3KBG A;  3S2H B;  5IGD A;  3AQQ A;  3ULJ A;  3HOU H;  5CYU A;  2Z6K A;  2IHF A;  4YWL A;  2FXQ A;  2HIV A;  1OXS C;  1Y1W G;  4EQ5 A;  1EYG A;  2JA8 H;  5IWA Q;  4KHP Q;  3H15 A;  5FLM H;  1STB A;  2KQ3 A;  1G6P A;  4IFD I;  5IYC G;  2XTI A;  1YEZ A;  3M4Q A;  1YO7 A;  3H6M A;  1LTT D;  4A3K H;  1D8L A;  4RCO A;  1H9S B;  3DWQ A;  1YNX A;  4JOI C;  4OO1 I;  2AQ3 B;  3RUZ A;  4DR5 L;  2ZXO A;  2PPB C;  4BXX G;  1A3T A;  2YV5 A;  3JAM c;  2F3I A;  5FLX E;  3E3X A;  2BA1 A;  4QGU A;  3AYH B;  5JPM C;  3Q22 A;  1RCV D;  1IZ6 A;  2LXJ A;  1MD2 D;  3L9A X;  4KY7 A;  3PIO A;  4X62 L;  4U6R A;  4JC0 A;  2K5Q A;  4A3G H;  1U4L A;  4RG1 A;  4A3C H;  5K36 H;  2PQE A;  5C0X G;  3LJ0 A;  2VUM G;  1R4P B;  4ABN A;  2YFB A;  3HRZ C;  3LX0 A;  3Q0A A;  4NB3 A;  4JI7 L;  3OOC A;  1I3Q B;  3S1Q H;  4A93 B;  4FF4 A;  4DNI A;  3CQZ B;  4LF9 L;  3TEH B;  4P71 A;  4YZC A;  1WTO A;  2BDN A;  1KLG D;  3PF5 A;  2QF7 A;  4CDE C;  3MXN B;  1EEF D;  3HOX G;  3V2T A;  4Z7G A;  5KNC A;  5C44 B;  4KLK A;  3E6Z X;  2YTX A;  3TP7 A;  4DWL A;  1KDA A;  3MWY W;  2IL8 A;  2I0Q A;  1CUK A;  5IGE A;  1MIU A;  3S2D H;  1F9Q A;  4NDX A;  2O5I C;  2ZM6 Q;  3HEJ A;  2MJF B;  1OXT A;  1SYF A;  3J80 L;  4GLA C;  2P22 B;  5LMN Q;  3QO2 A;  4OWT B;  4PZ8 A;  2L11 A;  2AUK A;  1SYD A;  3SK8 A;  5C4X G;  1XNR Q;  1B53 A;  4BBR H;  1PFS A;  4NXN L;  3SK5 A;  3M3Y B;  4C3I B;  4B3T L;  1VQ5 A;  5FO7 B;  4R4T A;  2F0L A;  4DGZ A;  1SYB A;  1SNO A;  3A8K E;  4ZAI A;  1R9T B;  1H95 A;  1JCK B;  3MAQ A;  1HZ9 A;  2F3V A;  5M3F B;  5EKI A;  3H0G G;  4OEM B;  4QUF A;  3BZD B;  4CKE A;  4LW1 A;  2NZH A;  1PTO C;  4DAP A;  2K01 A;  3FKI H;  4IUT A;  5C3E B;  3NP8 A;  4E6I A;  1KXL A;  1YJW A;  3BS1 A;  3KOJ A;  1TWH H;  2Z1C A;  1NAP A;  3W5O A;  2KVM A;  3OIQ A;  2AHO B;  4ZYS A;  1PTO F;  4OEL B;  4RHS A;  1WTP A;  2XSC A;  3J81 j;  1JQO A;  1W3S A;  1SNQ A;  3KDF A;  4LFC Q;  5ELC A;  2OWO A;  2R92 H;  1X55 A;  2F0U A;  4C3J B;  1W6J A;  3D6C A;  1DXM A;  3OWF A;  5FKA C;  4HJA A;  2BOS A;  4NXM L;  2K03 A;  2FMM A;  1VQH A;  3I4L A;  2JEA I;  4HSP A;  1HA5 A;  4G76 A;  5CGK A;  2AWO A;  4JI4 Q;  1WCM B;  3CCM A;  1QVF A;  2YU9 H;  3ER0 A;  1RD9 D;  3TRZ A;  4AQY Q;  4A75 A;  5IYB G;  3HOW H;  4XYQ A;  1K3R A;  4O1O A;  4R1J A;  3J7A F;  4LF5 L;  5CV6 A;  1CFM A;  1E2V A;  1IBM L;  1LTB D;  1X3Q A;  3SDZ A;  4O0A A;  4HIM A;  1K83 H;  3FDT A;  1QUQ A;  2IJ0 A;  1QJO A;  4A3D G;  3Q6S A;  3NXW A;  3HKZ G;  1U4P A;  3W3A A;  4ULL A;  4KY6 A;  1MJE A;  4RMF A;  3HS0 C;  2Q8I B;  3BYY B;  1EU3 A;  4HTH A;  4UAI A;  4DV1 L;  4EQO A;  3J7A V;  1VQM A;  4DR2 L;  3GTO H;  4ME5 A;  1L1O B;  1U0L A;  1SFO B;  2VNU D;  4A3B B;  1SE8 A;  1IBL Q;  2JA6 H;  1FD7 D;  1TWA H;  5BR8 L;  2CH4 A;  2X6G A;  1F9P A;  1A63 A;  4A3L G;  5CV9 A;  2AQ1 B;  3FBV A;  3OSO A;  2QIL A;  3QJY A;  1RF2 D;  4G57 A;  3SVM A;  3QOL A;  3KJP A;  4UP7 A;  1RTN A;  1UE7 A;  3CXC A;  5M5Y B;  1UUP A;  4A3I H;  2PW5 A;  3D8G A;  4B3R L;  3BU2 A;  2KOL A;  1XPO A;  5FJ8 H;  3PUY A;  4GLX A;  4OIK A;  1LUZ A;  4PMC A;  2D62 A;  4KY5 A;  1H9R A;  3QG1 A;  1YJ9 A;  3KP9 A;  4P74 A;  1VQB A;  4JI8 L;  4BY1 G;  3DWP A;  1X32 A;  3G6J B;  4K5X A;  4JBM A;  2F0W A;  4PV1 C;  1S5D D;  4YY3 Q;  4K14 A;  2LS0 1;  3MXG A;  1HNX Q;  1HNZ Q;  1YIJ A;  2R7Z B;  2HGK A;  3JAM E;  4YWM A;  1D1I A;  2K5V A;  4EQN A;  1D7Q A;  1EUJ A;  5C3X A;  1QG7 A;  5DLQ E;  1F2Y A;  1Y8O B;  3KJO A;  1E24 A;  1RTO A;  1PH4 A;  1LT3 D;  2EJF C;  4HR7 B;  3MXN A;  1N8R C;  1E1T A;  2EE1 A;  2JA5 G;  1K9M C;  3I4N B;  2UU9 L;  4ME3 A;  1GUO A;  1BXT A;  2E76 C;  3TDQ A;  1L0X B;  5TSS A;  1EFI D;  3LWE A;  3GTG H;  5HGQ A;  1Y14 B;  3TP8 A;  5IP7 H;  1S5E D;  1MKH A;  1E7Z A;  4AYB E;  3SGI A;  1LT4 D;  2E2J H;  4CKC A;  1C9O A;  3PO3 B;  2WB1 G;  1MGS A;  5GRO A;  1AFP A;  4RKB A;  5IP9 H;  4X66 Q;  2JN4 A;  4A93 G;  3D31 A;  2RDH A;  2AKW B;  5LMU L;  2GVA A;  2KEN A;  3R3O A;  2F03 A;  1HFN A;  1X3P A;  1R4Q B;  4C1N K;  1OTC A;  1LT5 D;  2F6M B;  2PQA A;  5CBA E;  3H94 A;  2DY7 A;  3A56 A;  3QIA A;  2JEB I;  5CMD A;  1EQT A;  5C44 G;  1A62 A;  2N88 A;  1ASY A;  1QIL A;  4MTN A;  4Y52 H;  2KEE A;  4JI6 L;  4JPB W;  1Y1W H;  3I4M G;  3W1B A;  1TS5 A;  3RZD B;  3AEV A;  1RKN A;  3K80 C;  3TS0 A;  1TS4 A;  1TT2 A;  1EZ6 A;  2QEX A;  3GTK B;  2A73 B;  3CPF A;  1TU2 B;  2CQA A;  4OWW B;  4PL3 A;  4XQN A;  5IE8 A;  1V1P B;  4DAV A;  2WAQ G;  3GTL H;  3TP5 A;  4FP5 D;  2NBF A;  5I4D A;  3CMA A;  1QOH A;  1UAP A;  4KTA A;  1EYA A;  2QCP X;  4C3I G;  1XPR A;  2R7F A;  3V96 A;  1D5M C;  1QZH A;  3UIT A;  4A3M H;  5GAE C;  5AFW A;  4UPA A;  2UUB L;  3NEN A;  4BXX H;  2Z0S A;  4GS3 A;  4A3E G;  1GKH A;  1LT6 D;  5A35 A;  1FYC A;  1XMO L;  2E74 C;  4CDC C;  1YHQ A;  3TS2 A;  4I1T A;  1AE2 A;  1B8A A;  4IUV A;  4RKL A;  4GLV B;  1XYI A;  5C3E G;  1VCI A;  5C0X H;  1KIX A;  2B2U A;  2FFK B;  4LJZ C;  1HFG A;  3D3R A;  4B08 A;  1BBU A;  4DUY Q;  4OAV B;  3A74 A;  2NZO A;  2RDF A;  1WYD A;  3ERS X;  2E2I B;  4U67 3;  4DK0 A;  1I4P A;  1PHJ A;  3GTM H;  1ZEQ X;  2PI2 A;  4IPC A;  1FNU A;  1X65 A;  2A69 D;  2JYO A;  5CBE E;  1CQF A;  3M4Y A;  4JI2 Q;  1TWG B;  1SEB D;  1F2Z A;  3D4D A;  4ZLT F;  5F2D A;  3H3V I;  3HZX A;  1IW7 D;  4NPS A;  1EFW A;  5DM7 3;  1BBX C;  4IJH A;  1VQE A;  1I6H H;  3FMC A;  3KF6 B;  3MVV A;  4HJ5 A;  2I5M X;  3HOY H;  3K5O A;  1TWF H;  2K32 A;  1WCM G;  2BE5 C;  2DUD A;  1NJI C;  3UE0 A;  3FNB A;  1SMX A;  2LKV A;  4KMU C;  3TN2 A;  3I9V 1;  3NUC A;  2JBW A;  1F9S A;  4JI1 Q;  2VUM B;  2WP8 J;  2JP1 A;  3BZC A;  1KD1 C;  3NK9 A;  5ELE A;  4FF2 A;  4A76 A;  3HP3 A;  1EY8 A;  3CKI B;  3T13 A;  1I4X A;  5FO9 B;  4HIO A;  3IFD A;  1IKM A;  1HQM C;  5E1F A;  1Y69 U;  2K5D A;  1PH7 A;  4A3J B;  1BCP B;  2UUC L;  3BDC A;  2VB3 X;  2F66 B;  1LO5 D;  1VQD A;  1EWH A;  1E1O A;  3UE1 A;  1E2Z A;  4FYD A;  1OXV A;  4A3B G;  4S3S A;  1WTV A;  2QDL A;  4MHE A;  1Z47 A;  4K0K Q;  3DEO A;  1X9N A;  1STN A;  4DR5 Q;  1ENC A;  2BH2 A;  1K0S A;  1QVG A;  2HD3 A;  1LAB A;  2MP1 A;  4BWG B;  3T51 B;  2XRQ D;  1XMQ L;  1NY4 A;  4ZKC B;  3CCV A;  4V19 0;  2KKM A;  1XX8 A;  5C4X B;  2CW0 D;  4PL5 A;  1XTC D;  2F0G A;  3SR1 A;  2V1C C;  3QR8 A;  3S1M B;  3VR4 A;  1AZP A;  2H1E A;  2KED A;  3NEM A;  4LNQ A;  2R6G A;  2DJF C;  4JI5 Q;  1VQP A;  4QQB X;  2MQH A;  1PDQ A;  4BBS B;  1UNS A;  1XNQ L;  3SEB A;  4UDU C;  4MN3 A;  4J1M A;  1B50 A;  3VR3 A;  2JJQ A;  3H0G B;  3OWE B;  1Q8K A;  2K52 A;  2NVY H;  5IGG A;  4LWC A;  2VQF Q;  3PF4 A;  2IX1 A;  4H44 C;  4IUQ A;  4NMZ A;  3F8T A;  1BCP D;  1DOL A;  2NN6 G;  2E2H H;  5AJ3 L;  1HRJ A;  2NVQ B;  2I5H A;  1S4Z A;  4JBJ A;  1HR0 L;  1GHK A;  1WJJ A;  1SMY D;  5FLX L;  2NUC A;  4GKJ Q;  1IBK L;  4X3T A;  4A3D H;  4DR1 L;  2K50 A;  1SAP A;  5C5M A;  3NBH B;  1G29 1;  2L55 A;  1YVC A;  4HMJ A;  4PQX A;  1HNW Q;  3J7Y W;  3HOZ B;  1Q3L A;  3I4N G;  3WWV A;  3VR2 A;  1STG A;  4K6L A;  1BO0 A;  4B3T Q;  4I7A A;  1ENA A;  2QW7 A;  2F0J A;  1I50 B;  1ILQ A;  2MPM A;  5C4H A;  2PZW A;  4A3L H;  2QSB A;  5HUR A;  3NEL A;  1T5E A;  3PO3 G;  4JCV E;  1N33 L;  2R93 H;  3FPP A;  1CI3 M;  2HHH Q;  3TZD A;  1V1P A;  2IHE A;  3I70 A;  4DV7 L;  1PLF A;  4JI0 L;  1TS3 A;  3D4R A;  1JJ2 A;  1HCZ A;  3NTH A;  3A0J A;  4OHJ A;  1VQA A;  2N8N A;  1PZK D;  3OIP A;  4Y7N B;  3S2H H;  2KA7 A;  4DNR B;  3JAM i;  1O78 A;  1TWC B;  3S1N B;  1HQR D;  3GV6 A;  3HKZ B;  3MXU A;  1N32 Q;  1EY9 A;  5FO8 B;  2F0I A;  3M4O B;  2UXB L;  3CW2 C;  3N52 A;  2LFN A;  3EVQ A;  3CCU A;  2MFI A;  4OO1 G;  4HJ9 A;  3PIP A;  1D5X C;  1F9R A;  4ZK9 B;  4NP5 A;  3G7L A;  3SHL A;  1WTW A;  2CKZ B;  1II3 A;  1NNX A;  3FPU B;  3KUP A;  4AIM A;  3HKS A;  2AWN A;  3WDN A;  3KK7 A;  3BVG A;  2F1M A;  2B39 A;  1Y8P B;  4DXG A;  1ET9 A;  1PA6 A;  3TME A;  2F0V A;  3AFP A;  1A2T A;  2L1L B;  2UXD L;  4F87 A;  3TQY A;  2EYJ A;  1VQJ A;  5FK9 C;  3S17 H;  4DKA C;  1PH2 A;  1CM9 A;  2VL6 A;  3RNU A;  1A3U A;  2FIN B;  1N34 Q;  1O7L A;  3MFG A;  2I07 B;  4DUZ Q;  4GNX B;  4BY1 B;  3KF6 A;  4DR7 L;  4OL7 A;  2D0P A;  3WOE A;  1I3Q H;  3NQT A;  4A93 H;  1JE5 A;  4DR6 Q;  3BJU A;  3CQZ H;  1TDP A;  5JVH 3;  1OO9 B;  2E2D C;  1UE6 A;  4UP8 A;  3CCL A;  4IO9 A;  5GQO A;  3GTQ H;  4JG2 A;  5C4Z A;  1TY0 A;  3T53 B;  2WAC A;  5IGB A;  1JC7 A;  2PCF B;  2GA4 B;  4JV5 Q;  5HY6 A;  2A2D A;  4X64 Q;  1BDO A;  2A1A A;  2RQX A;  2JA5 B;  2JB2 A;  4BA2 I;  1SYC A;  4UP9 A;  2NVT B;  2E8G A;  1S40 A;  4B3M L;  4YZD A;  4GN5 A;  4DU9 A;  5HGI A;  1HH2 P;  2NVX B;  3GTJ B;  2HQL A;  1CSP A;  2F4V Q;  5C5L A;  4DV4 Q;  2XVS A;  2ENB A;  3M3Y H;  1CKM A;  2B63 B;  1VQ9 A;  3SK6 A;  2WB1 B;  3KLR A;  1HTP A;  3PGZ A;  3PIO 3;  5DNF A;  1UE5 A;  4P72 A;  1SR3 A;  1D2B A;  4DAY B;  1R9T H;  2XTQ A;  3S14 B;  2K04 A;  3LJ2 A;  1JB7 A;  3CCR A;  5M3F H;  2BH8 A;  3A55 A;  3U9S A;  2ZTC A;  4PMB A;  1VQO A;  2M2L A;  3CPW A;  1G6Z A;  4JYA L;  2FUG 1;  4AS3 A;  2PYK A;  4RWS C;  2KHI A;  3LWU A;  3DA4 A;  4R8N A;  4A3J G;  5JJI A;  4J8Q A;  3P75 A;  2OXP A;  2J4X A;  3F2U A;  5IT9 E;  2CWP A;  4GN4 B;  4H0L C;  4IUP A;  5KIX A;  4LF8 L;  2IX3 A;  2IW3 A;  2XIW A;  1PRT B;  3I4M B;  4L5R C;  4QIW E;  5J22 A;  2F4I A;  1VQ6 A;  4PL4 A;  4YIJ A;  2ZT9 C;  3ERQ A;  3PV0 A;  4LF7 L;  2I46 A;  1PMR A;  3ULP A;  3I4O A;  1NR2 A;  2KBN A;  2FJ2 A;  3BG3 A;  4YWK A;  3T1H Q;  1JB3 A;  4LF4 L;  2WAQ B;  3ULL A;  5EBD A;  4C3J H;  1SXT A;  4LFB L;  1V43 A;  1E22 A;  5LL6 X;  1SE3 A;  4X3U A;  2EYF A;  2B2W C;  2ALY B;  3NBH A;  4BBS G;  4A3E B;  5BN4 A;  4XDX A;  3JAM L;  2Z6K C;  1Z7T A;  1KQS A;  3NSW A;  4YHH Q;  3HGB A;  4DAM A;  4KV6 A;  1WCM H;  4RAU C;  4MIU A;  2DY8 A;  4X65 Q;  5ELN A;  2A5H A;  4WFN 3;  3R2T A;  1HA6 A;  1PH5 A;  1EQR A;  4QB4 A;  3X3N A;  1PRT D;  2K5H A;  3DWA A;  2SOB A;  1T5X D;  3I2Z A;  4IUU A;  1GD7 A;  2A6H D;  1SRU A;  4XXE A;  4IUN A;  1LTA D;  2V4D A;  5D3I B;  3D6W A;  3STB C;  1PZI D;  1B3Q A;  2A68 C;  4DV6 Q;  2B2V A;  2UXC L;  3DM3 A;  1JOK A;  3I90 A;  4OX9 Q;  4DF7 A;  3HOZ G;  2EYP A;  3L2P A;  1ESF A;  1PFM A;  1SFO H;  4A3B H;  2DN8 A;  2YTY A;  1VQG A;  1SRO A;  4ODG A;  5HGT A;  1KNE A;  1FNW A;  4EQP A;  3K57 A;  2VQE Q;  5C6A A;  5K5P A;  2ZW3 A;  2L1B A;  4PZ6 A;  1H9J A;  4OIJ A;  1M1K C;  3E9H A;  2ETD A;  5IIF A;  4G4K A;  3ND9 A;  2JA7 H;  5CV7 A;  2RA4 A;  5IOD A;  4DR3 Q;  1K28 A;  2V6E A;  3DM1 A;  1DM0 B;  2K1B A;  5M5Y H;  4B3S Q;  4R8I A;  1Q1E A;  2F0Q A;  2MHV A;  2Q2U A;  2ZRR A;  5KYL A;  2OEO A;  2EZV A;  5EKK A;  5JJL A;  3M85 A;  2EY5 A;  1WD0 A;  1N36 Q;  3U4Z A;  2DGY A;  1RJT A;  1IHZ A;  3M7G A;  3GTP B;  5JJK A;  4K8J A;  2D0O A;  4AS2 A;  1BQQ T;  1Q46 A;  4CJ1 B;  3NWS A;  4Q0F A;  2A6E C;  2NN6 H;  5C4J B;  3VDY A;  4N9T A;  3EIV A;  4GNX A;  1B44 D;  5JEA H;  2R7Z H;  5COR A;  1UEB A;  1IYV A;  3BYT B;  1SJ8 A;  5G3L F;  1FJG Q;  1DON A;  4GKK Q;  3EQL C;  2D9U A;  3OPO A;  1Q81 C;  1Q12 A;  3QWN A;  5IWA L;  1GM5 A;  4KHP L;  2K05 A;  4IOC A;  2L9H A;  1JOQ A;  3I72 A;  2H5X A;  1YJN A;  4G7Z C;  5EKL A;  2NB0 A;  2RBM A;  2KEC A;  5D65 A;  5H1S E;  1SYG A;  2DJG C;  3I4N H;  1Y1V B;  2F0P A;  5M3M B;  3I8Z A;  1YNJ D;  1H9S A;  1YNN D;  4DV0 Q;  1A6X A;  4HED A;  3K6O A;  1GUN A;  2RF4 A;  1GJX A;  1STY A;  2J7Z A;  1XWE A;  4C3H B;  1PYW D;  3GDE A;  5M5X B;  5BN5 A;  1K8G A;  1F2M A;  4LF6 Q;  1JQY D;  3ICE A;  1LV9 A;  2RCN A;  1M8A A;  2JAE A;  1Y8N B;  3KFU A;  2UUA Q;  1QE6 A;  1G2T A;  1WI5 A;  3PO3 H;  1EIY B;  3RD4 A;  3MHB A;  1A15 A;  1Z9F A;  1WD1 A;  3NBI A;  2XMX A;  2VY3 A;  4R4O A;  3GV3 A;  1NTG A;  5LNK 1;  5IGC A;  3VA5 A;  3FP9 A;  1ZYR D;  5J1Z A;  4KD3 A;  1K83 B;  1GXD C;  2ASB A;  4IFD H;  4KN4 C;  4DAY A;  3KBX A;  1AE3 A;  1JOO A;  1S72 A;  1BVS A;  1X3F A;  2F0O A;  2X6L A;  3RZD H;  5JOB A;  1EQQ A;  3PO2 H;  3GTO B;  1VQL A;  1B4O A;  4QMG A;  4OAU C;  3MA2 B;  1SYE A;  3BVM A;  4OO1 H;  4GOP B;  1Q8I A;  1S3O A;  2RAD A;  1CKN B;  3S16 B;  1SNP A;  4DFA A;  1M90 C;  3IAM 1;  5CR3 A;  4LUO A;  1MJC A;  2B63 G;  3G4S A;  4KD4 A;  4TQU S;  4ILW A;  2Q2I A;  5IYD H;  1MHW C;  5IGF A;  1GHJ A;  5CV5 A;  2Q2T A;  2ZM6 L;  5M5W B;  4QCL A;  2IY5 B;  5CV8 A;  4A3I B;  2B3G A;  2JB1 A;  3LGJ A;  2Z9H A;  2PW7 A;  1I4H A;  5LMN L;  1WTQ A;  1STH A;  3A8I E;  3MXP A;  1XNR L;  3QOJ A;  5CV4 A;  1DZ1 A;  3HOU G;  3W2D A;  3AMU A;  4JI3 Q;  1CSQ A;  3K7A B;  2JSO A;  1SBB B;  3CRK C;  3DHQ A;  2OQ0 A;  3PCO B;  2F0S A;  1V8Q A;  3KF8 B;  5J3B A;  4DV3 Q;  1SE4 A;  3KYH C;  5IYC H;  5DAU A;  3A5Z B;  2E2I H;  3Q24 A;  3SDJ A;  2HT1 A;  4R4Q A;  2KCM A;  1W2B A;  2HUG A;  3G71 A;  3RZO B;  1J5E Q;  1CZG A;  3ZJY C;  3DLL A;  2ID0 A;  2LMC B;  3RN2 A;  1RL2 A;  3IAS 1;  2K28 A;  1TWG H;  3PSI A;  1AN8 A;  4G75 A;  3HOV B;  1HHV A;  3QB3 A;  4L6T B;  2LSS A;  1KL9 A;  2K6A A;  4DR4 Q;  2KJX A;  3ITP A;  1D1K A;  4OWX B;  1A3V A;  2QGQ A;  2ZXR A;  2NYZ D;  1KNA A;  3MEH A;  4LFC L;  1NUC A;  3J81 c;  1SJH D;  2HDL A;  1QZG A;  2IX0 A;  1TR5 A;  2ICE C;  4HCE A;  4Z9C B;  3FVV A;  2E2J B;  1DCZ A;  1CZW A;  4DV5 Q;  4XT1 B;  5BN3 A;  1PH9 A;  1VQK A;  4HCS A;  2VUM H;  5KYI A;  5E4W C;  2H4O A;  2BDO A;  5C3W A;  2PZT A;  5EBC A;  1EWI A;  2CCZ A;  4JI4 L;  5DM6 3;  2PMZ E;  4EX5 A;  4DPG A;  1EZ8 A;  1HUM A;  2K4K A;  1JWU D;  4A3F B;  4X3S A;  4AQY L;  3T1Y Q;  3HOX H;  1KRT A;  1I94 Q;  4HSV A;  5EPL A;  2RIO A;  2QKI C;  4A3J H;  1E0B A;  1W6K A;  1L0W A;  2RSN A;  4TVA B;  1O7Z A;  1C7Y A;  4L5T A;  1HTL D;  4IOA A;  2EPB A;  1U9R A;  4QF4 A;  4LFA Q;  1LTL A;  2C5C A;  1PH3 A;  4AYB B;  2JK8 A;  1EOT A;  4DV2 Q;  1LTI D;  2EOT A;  2NTT A;  1L1O A;  3G48 A;  3GTL B;  4KK7 A;  2PZU A;  1B1Z A;  3C1E A;  4K5W A;  3TZU A;  3T56 B;  5C4X H;  3H3V C;  3EJI A;  4BBR G;  2WFW A;  1S5C D;  3CF5 A;  4KJN A;  2KHS A;  4XQQ A;  4XIG S;  1IBL L;  2J0T D;  1VQI A;  4PNY A;  1X3G A;  1VMP A;  1LTR D;  4BBS H;  1STA A;  1JWM D;  1PTO B;  2LY7 A;  1N9W A;  3CD6 A;  3H0G H;  1U5K A;  2R61 A;  3U50 C;  3NTI A;  1L0Y B;  4DK1 A;  2OTL A;  1KHI A;  2SNS A;  1ASZ A;  2DNC A;  1GUG A;  1C0A A;  2QA4 A;  3L0O A;  1PFB A;  1HR0 W;  4FO2 A;  5FLX c;  2C9O A;  1P16 A;  3K5M A;  1XTD A;  1KRS A;  2Z8L A;  3GTM B;  2Q8R E;  4J15 A;  4LK1 C;  2R92 G;  1HPC A;  4YY3 L;  1HNZ L;  4IPG A;  1HNX L;  2EVB A;  4UHV A;  4X62 Q;  3CME A;  3HOZ H;  3KLS X;  4HEA 1;  3P1H A;  1Y1V G;  5M3M G;  3JC6 6;  1I6V C;  2AMC B;  3UDF A;  3VYS A;  2B2Y A;  2E5L L;  4RA8 A;  4YCU A;  2K5W A;  4JI7 Q;  4C3H G;  1I50 H;  5KEE A;  1I6H B;  3VR6 A;  1PTO D;  1WVL A;  4LF9 Q;  2EY6 A;  3HOY B;  1ICF B;  1TWF B;  1PV4 A;  3A7L A;  1HZA A;  4GOP A;  2B2U C;  4RHR A;  3HOW G;  2RHS B;  2Y0S E;  1CKN A;  5IYB H;  3RLO A;  5FOB B;  2IT1 A;  2EY1 A;  4NKL A;  1SSO A;  2WII B;  3DO9 A;  2PNR C;  3STB D;  2SNM A;  5JVG 3;  2LXK A;  1K3B C;  3DUZ A;  3GP7 A;  4X66 L;  3K5N A;  3S1N H;  4LF7 Q;  1ZXT A;  3J7Z C;  3RR5 A;  3B6Y A;  3TRE A;  2EYO A;  4N8X 1;  4R4I A;  3M4O H;  5EGT A;  4XYO A;  2HCI A;  4NXN Q;  3R93 A;  1EEI D;  1ML0 D;  4YCV A;  2B8F A;  2YYZ A;  5KNB A;  3CRL C;  2JA6 G;  1EY5 A;  3K58 A;  1QNK A;  1L1O C;  2VB2 X;  5I6W A;  3L3O C;  2IWH A;  3OTO L;  3KF8 A;  2YTV A;  4MNO A;  4C2M B;  2RLD A;  2GSC A;  1UWV A;  1H9M A;  4QJF A;  2E75 C;  2G5D A;  2N3S A;  4C1N I;  1D5Z C;  4IZ8 A;  5IT9 L;  5DEH A;  5COY A;  1B3A A;  2BCO A;  4JOI A;  4A3I G;  3M4P A;  1IL8 A;  5GAH C;  2L15 A;  2R7D A;  5GAD C;  2B29 A;  4B9X A;  2K75 A;  3CCJ A;  2F52 A;  1K8A C;  2KUM A;  4HIK A;  3A5U A;  2EJG C;  1DOK A;  5C0X J;  3P20 A;  3VR5 A;  2VZA A;  1LLR D;  4BY1 H;  3R8B A;  2XWB B;  5A2Q E;  4M8A A;  5I9O A;  2XRS D;  4CJ2 C;  2F0F A;  1EYC A;  3NPP A;  2WB1 E;  3PUZ A;  1TY2 A;  1RHP A;  2O2L D;  1F77 A;  1FGU A;  2QDB A;  4O2D A;  4TSS A;  4U68 A;  4NXM Q;  1ET6 A;  2Q8T A;  3JSB A;  1NMF A;  3WOF A;  4APV A;  3PIP 3;  2O4X A;  4DUY L;  5I6Y A;  1Z6H A;  3HOV G;  1TII D;  4HJ7 A;  1WFQ A;  2WV6 D;  5EQ0 A;  1VS0 A;  3N6R A;  2ZTD A;  4QL5 A;  1K0R A;  1QB5 D;  5KRU A;  2JA5 H;  4P73 A;  1VQF A;  4CBV A;  2NVT H;  3K0X A;  1KAW A;  4J6H A;  5ELD A;  3CC7 A;  1YBY A;  4CHT B;  1TXY A;  2NVX H;  3OW2 A;  5IP7 G;  3GTJ H;  2A2C A;  4KKU A;  1GVP A;  4JI2 L;  1Q90 A;  1BNZ A;  3S15 B;  1PH6 A;  4LF5 Q;  4CJ0 B;  1IBM Q;  4BY7 B;  2EYL A;  2VW9 A;  2HIX A;  1HJP A;  3W1G A;  2O5J C;  5IP9 G;  3L7Z C;  3OMG A;  2EXD A;  4RGT A;  4Z7H A;  5I2Y A;  1G8Z D;  4DV1 Q;  3S14 H;  4DR2 Q;  4A3F G;  3KLW A;  4GZY C;  1I4R A;  1TVX A;  3VYU A;  2EIF A;  3IKJ A;  4ZUJ A;  4JI1 L;  1CTM A;  5C44 H;  2HDM A;  1U4R A;  2BA0 A;  1JWS D;  5BR8 Q;  5ISR A;  1JJG A;  1AH9 A;  3MFY A;  2X69 A;  4KKT A;  2A8V A;  3I4M H;  2EXZ A;  1L2F A;  3PUV A;  4K2L A;  4XTC S;  4OXP A;  4AYB G;  1AP0 A;  1C4Q A;  3K81 C;  3J80 c;  3CAM A;  1U4M A;  1VQ7 A;  3H3V H;  3H09 A;  2VXW A;  4RGM A;  5IOC A;  4B3R Q;  2OQK A;  4MTK A;  2F0K A;  3NHH A;  2XWJ B;  1AW7 A;  4C3I H;  2OCE A;  2ES2 A;  2QZG A;  2A69 C;  4TKO B;  4F88 A;  4K0K L;  4KI0 A;  4A3M G;  1BR9 A;  2QEJ C;  4JI8 Q;  4KJO A;  1HXY D;  5NUC A;  3S1R B;  2XNA C;  2D5D A;  5LL6 S;  3J7A 5;  2JXM B;  4A3E H;  2CQO A;  4R9W A;  3S17 B;  2XGT A;  3C46 A;  4QUC A;  1IW7 C;  2ZJQ A;  1ROD A;  3OW7 A;  3TP6 A;  3HOU B;  3BVZ A;  2WKC A;  4ZRZ A;  4JI5 L;  3MTS A;  5C3E H;  2JA8 B;  2L12 A;  3UI2 A;  4RH6 A;  1SN8 A;  5J39 A;  3GD7 A;  3FEW X;  1J8I A;  2ATW A;  2ZJP A;  4ZKB B;  2VQF L;  1LYL A;  3O13 A;  4G7O C;  2UU9 Q;  1JJC B;  2PI2 E;  4IAL A;  3GTQ B;  4A3K B;  2FMC A;  2EDG A;  4RGN A;  3HG9 A;  1DOM A;  4GKJ L;  1H9K A;  5ELF A;  1VF7 A;  5T1I A;  2F0D A;  3OYY A;  1T9H A;  1O80 A;  2F0H A;  5LMU Q;  3HOY G;  3VYR A;  4RFB A;  1HNW L;  3AU7 A;  4DXF A;  4KHV A;  4A3G B;  2Z4H A;  3VA7 A;  3DA3 A;  4POG A;  4WJ3 M;  3TBI B;  2PQA B;  3I91 A;  2B2T A;  2K19 A;  3MEF A;  1WOC A;  2CW0 C;  3RMH A;  1PXU A;  3S1Q B;  1BF4 A;  4WJ4 A;  4ALP A;  4JI6 Q;  4OGQ C;  1NCV A;  4F7X A;  1UE1 A;  1PYS B;  1YIT A;  1VMC A;  4B9W A;  2MO1 A;  2I5L X;  3URY A;  5C0X I;  3LJ1 A;  5KGU A;  3GTP H;  2KCT A; 
#chains in the Genus database with same CATH homology
 3HFZ B;  4LUO A;  1MJC A;  1PH7 A;  4LFA L;  2B63 G;  3G4S A;  2B63 H;  4TQU S;  5IYD G;  1HZB A;  2Q2I A;  5IYD H;  2Q2T A;  2UUC L;  5C4J H;  2ZM6 L;  4DV2 L;  2F66 B;  2WAQ E;  1VQD A;  3CP0 A;  1RIP A;  2CFM A;  1VQ8 A;  1JT8 A;  3PUX A;  1PYB A;  3RN5 A;  2IY5 B;  1E1O A;  3UE1 A;  1QUQ B;  1YI2 A;  1OXV A;  2B3G A;  2JB1 A;  3LGJ A;  3S1R H;  5LMN L;  4A3B G;  1Z47 A;  3U58 A;  1B70 B;  4K0K Q;  4L5Q A;  1X9N A;  1XPU A;  3VA9 A;  1IYJ B;  4DR5 Q;  2BH2 A;  1HZC A;  1XNR L;  1QVG A;  1VQC A;  3AQQ A;  4H02 A;  4BA1 I;  3ULJ A;  3HOU G;  2UUB Q;  1N32 L;  3HOU H;  1XMQ L;  2Z6K A;  1NY4 A;  2A19 A;  2IHF A;  4YWL A;  3CCV A;  2FXQ A;  2HIV A;  2KKM A;  1XMO Q;  4JI3 Q;  2K5N A;  1CSQ A;  1EIF A;  1OXS C;  1Y1W G;  4PL5 A;  4EQ5 A;  1EYG A;  2JA8 H;  5IWA Q;  4KHP Q;  2V1C C;  1I5F A;  2OQ0 A;  3PCO B;  3H15 A;  3KF8 B;  4LNQ A;  3NEM A;  5FLM H;  2R6G A;  5J3B A;  1Y1V H;  5M3M H;  4DV3 Q;  1G6P A;  4JI5 Q;  1VQP A;  4QQB X;  2MQH A;  4IFD I;  1YHA A;  3KYH C;  5IYC G;  5IYC H;  5E7N A;  3A5Z B;  2E2I H;  2XTI A;  1XNQ L;  1YEZ A;  3SDJ A;  2HT1 A;  3M4Q A;  4R4Q A;  2KCM A;  4C3H H;  1W2B A;  3G71 A;  5M5X H;  2JJQ A;  3DLL A;  1YO7 A;  1Q8K A;  2ID0 A;  2K52 A;  2NVY H;  3ZJY C;  1J5E Q;  4A3K H;  1D8L A;  4LWC A;  2VQF Q;  3RN2 A;  2IX1 A;  3PF4 A;  1PVO A;  1RL2 A;  3F8T A;  3IAS 1;  1TWG H;  3PSI A;  4G75 A;  1YNX A;  4JOI C;  2NN6 G;  4OO1 I;  2LSS A;  1KL9 A;  4LFB Q;  4DR5 L;  2E2H H;  5AJ3 L;  3F2C A;  4DR4 Q;  2I5H A;  4JBJ A;  4GN3 B;  4BXX G;  4OWX B;  2QGQ A;  2YV5 A;  1N34 L;  3JAM c;  2F3I A;  1HR0 L;  4PG3 A;  2BA1 A;  1WJJ A;  4LFC L;  4QGU A;  3AYH B;  4DUZ L;  4GKJ Q;  1IZ6 A;  3J81 c;  1IBK L;  1QZG A;  2LXJ A;  2IX0 A;  3G6E A;  3PIO A;  4X62 L;  4A3D H;  4DR1 L;  4U6R A;  2K50 A;  4JC0 A;  1GO3 E;  4A3G H;  4RG1 A;  1XJV A;  4A3C H;  4DR6 L;  3NBH B;  1G29 1;  4DV5 Q;  5C0X G;  1PH9 A;  1VQK A;  3LJ0 A;  2VUM G;  1YVC A;  2YFB A;  2VUM H;  1HNW Q;  4NB3 A;  4JI7 L;  3S1Q H;  3I4N G;  4DNI A;  3WWV A;  4IJL A;  4LF9 L;  3TEH B;  3GO5 A;  4B3T Q;  1EWI A;  4P71 A;  2CCZ A;  4YZC A;  4JI4 L;  2PMZ E;  4EX5 A;  4DPG A;  2K4K A;  1Q86 C;  3PF5 A;  2ZJR A;  2Y0S G;  3MXN B;  3HOX G;  4AQY L;  3T1Y Q;  3HOX H;  1KRT A;  1Q1B A;  4LUZ A;  3S16 H;  4Z7G A;  1DGS A;  1X56 A;  4JV5 L;  4A3L H;  1I94 Q;  4BY7 G;  4KLK A;  4X64 L;  2RIO A;  3NEL A;  4A3J H;  2YTX A;  3PO3 G;  2R93 G;  4DWL A;  4JCV E;  1L0W A;  1N33 L;  2R93 H;  2HHH Q;  4TVA B;  5M5W H;  2I0Q A;  1C7Y A;  4L5T A;  1CUK A;  4IOA A;  2IHE A;  1E3P A;  4LFA Q;  4DV7 L;  1LTL A;  3RLN A;  4JI0 L;  1JJ2 A;  1PH3 A;  1MIU A;  3A0J A;  5LMN W;  3S2D H;  2JK8 A;  2F4V L;  2UUC Q;  1VQA A;  2ZM6 Q;  2YFA A;  2N8N A;  4DV2 Q;  4DV4 L;  1LM0 A;  2MJF B;  1OXT A;  3S2H H;  4GLA C;  2P22 B;  5LMN Q;  1L1O A;  4OWT B;  3G48 A;  3JAM i;  3UDX A;  4PZ8 A;  1JMC A;  5C4X G;  5C4X H;  1XNR Q;  4BBR G;  3K7A H;  4BBR H;  1PFS A;  2WFW A;  4NXN L;  3J81 i;  1N32 Q;  3CF5 A;  4B3T L;  1VQ5 A;  1XMQ Q;  2UXB L;  4XIG S;  3CW2 C;  1IBL L;  4R4T A;  1FL0 A;  1VQI A;  4HFV A;  1KC8 C;  2PNH A;  3Q8D A;  1X3G A;  2MFI A;  3FHW A;  3CCU A;  3GTK H;  4OO1 G;  4BBS H;  1H95 A;  4HJ9 A;  3PIP A;  1HZ9 A;  1N9W A;  2CKZ B;  3H0G G;  3CD6 A;  3RZO H;  3H0G H;  1U5K A;  2E5L Q;  4AIM A;  3U50 C;  4LW1 A;  3CCE A;  2NZH A;  1XNQ Q;  3HKS A;  2AWN A;  3HOV H;  2OTL A;  1KHI A;  1CKO A;  3FKI H;  4YCW A;  4PZ7 A;  4DK6 C;  1BBW A;  2JB3 A;  1PA6 A;  1ASZ A;  2JE6 I;  3AFP A;  4NV5 A;  1B7Y B;  2L1L B;  2JQO A;  3L0O A;  5EAY A;  4POF A;  2QA4 A;  1C0A A;  3T1H L;  1YJW A;  3KOJ A;  3EN2 A;  5FLX c;  3TQY A;  1HR0 W;  2UXD L;  1VQJ A;  3S17 H;  1TWH H;  3PUW A;  3W5O A;  1P16 A;  4DKA C;  5AJ3 Q;  3UDG A;  1PH2 A;  2AHO B;  2VL6 A;  3RNU A;  1XTD A;  1KRS A;  2Q2H A;  1N34 Q;  1HR0 Q;  4HJ8 A;  3J81 j;  4OON A;  2JA9 A;  1W3S A;  3KDF A;  4J15 A;  4LFC Q;  4DUZ Q;  4GNX B;  4UY8 C;  2ZTE A;  2OWO A;  2R92 G;  2R92 H;  1X55 A;  2RHQ B;  4YY3 L;  1IBK Q;  1HNZ L;  4IPG A;  1HNX L;  3KF6 A;  2JA8 G;  4DR7 L;  3CME A;  1O7I A;  2D0P A;  4X62 Q;  4DR1 Q;  4GNX C;  3HOZ H;  1I3Q H;  4HEA 1;  5FLM G;  4A93 H;  1JE5 A;  1Y1V G;  5M3M G;  3JC6 6;  4HJA A;  1VQ4 A;  4NXM L;  4DR6 Q;  2AMC B;  3BJU A;  3CQZ H;  4YHH L;  2XTR A;  3UDF A;  2E5L L;  2CAZ B;  2C35 B;  4YCU A;  4X65 L;  4JI7 Q;  1VQH A;  4A3F H;  1I50 H;  1UE6 A;  2JEA I;  4UP8 A;  3CCL A;  4LF9 Q;  4G76 A;  5GQO A;  4IO9 A;  4JG2 A;  1PV4 A;  4A3K G;  2AWO A;  4JI4 Q;  3GTQ H;  4X6A H;  3CCM A;  1QVF A;  1HZA A;  1PH1 A;  4GOP A;  2YU9 H;  1IXR A;  1OXU A;  3ER0 A;  3TRZ A;  3OTO Q;  4AQY Q;  3HOW G;  2RHS B;  4A75 A;  5IYB G;  2Y0S E;  1CKN A;  5IYB H;  1Q82 C;  3RLO A;  3HOW H;  4FDB A;  1K3R A;  5HY6 A;  2A2D A;  4JV5 Q;  2IT1 A;  4X64 Q;  4O1O A;  4R1J A;  2KHJ A;  2A1A A;  2JB2 A;  4BA2 I;  3DO9 A;  1N33 Q;  3STB D;  4UP9 A;  2E8G A;  4LF5 L;  4DV6 L;  1S40 A;  4B3M L;  4YZD A;  1QVC A;  1IBM L;  4GN5 A;  2LXK A;  1IL2 A;  4DV7 Q;  5HGI A;  1HH2 P;  4JI0 Q;  4O0A A;  4HIM A;  1K83 H;  2HQL A;  3I7F A;  1CSP A;  1QUQ A;  4OX9 L;  4X66 L;  3F2D A;  2F4V Q;  4JBW A;  4LF7 Q;  1X3E A;  4DV4 Q;  3J7Z C;  3S1N H;  4A3G G;  4A3D G;  3M7N A;  3HKZ G;  4P75 A;  2VS1 A;  4A3C G;  3RR5 A;  1MJE A;  5K36 G;  4GXT A;  3M3Y H;  1CKM A;  4RMF A;  3B6Y A;  3TRE A;  4DV1 L;  1VQ9 A;  4R4I A;  3M4O H;  1VQM A;  4DR2 L;  3PGZ A;  3GTO H;  1UE5 A;  2HHH L;  4P72 A;  1SR3 A;  1L1O B;  1U0L A;  4NXN Q;  4R4C A;  4YCV A;  2VQE L;  2VNU D;  4DAY B;  1X54 A;  2XTQ A;  1R9T H;  2YYZ A;  2UXB Q;  1SE8 A;  3LJ2 A;  1JB7 A;  5M3F G;  1IBL Q;  2JA6 G;  3CCR A;  5M3F H;  2JA6 H;  1L1O C;  2BH8 A;  1TWA H;  2ZTC A;  2N49 A;  4MZ9 A;  5BR8 L;  1EOV A;  3OTO L;  2YTV A;  1A63 A;  1VQO A;  4DR3 L;  3CPW A;  4A3L G;  4MNO A;  4JYA L;  3F4M A;  3I56 A;  2FUG 1;  4AS3 A;  3FBV A;  1FVI A;  2KHI A;  3DA4 A;  1UWV A;  4A3J G;  4B3S L;  4QJF A;  5JJI A;  2N78 A;  1VQN A;  1A0I A;  2N3S A;  2CWP A;  4GN4 B;  4KHZ A;  4LF8 L;  3KJP A;  5JEA J;  2GVB A;  3D0F A;  4UP7 A;  1UE7 A;  3CXC A;  4JOI A;  4A3I G;  4A3I H;  1N36 L;  3M4P A;  4L5R C;  4QIW E;  4B3R L;  3BU2 A;  5GAH C;  4PL4 A;  1VQ6 A;  4JBK A;  2L15 A;  2R7D A;  1XPO A;  5GAD C;  3PV0 A;  2B29 A;  5FJ8 H;  2K75 A;  3PUY A;  2F52 A;  3CCJ A;  1K8A C;  4LF7 L;  4HIK A;  4NV2 A;  4GLX A;  3A5U A;  4L5S A;  5GAG C;  3ULP A;  1LUZ A;  3I4O A;  3T1H Q;  2KBN A;  4IPH A;  4LF4 L;  4YWK A;  2D62 A;  2UXD Q;  3AFQ A;  5C0X J;  3ULL A;  1YJ9 A;  3KP9 A;  1Q7Y C;  4P74 A;  1VQB A;  2VZA A;  3E9I A;  4BY1 G;  4JI8 L;  5ELO A;  4C3J H;  4BY1 H;  4A4I A;  4LFB L;  1V43 A;  1E22 A;  3S1M H;  4JBM A;  1FJG L;  4YY3 Q;  4GKK L;  1HNZ Q;  1HNX Q;  3CC2 A;  4DR7 Q;  2ALY B;  1YIJ A;  4BBS G;  2WB1 E;  3PUZ A;  3CC4 A;  3E0E A;  1FGU A;  3GTP H;  4YWM A;  3RLF A;  4O2D A;  2Z6K C;  4NXM Q;  2K5V A;  1KQS A;  1D7Q A;  4YHH Q;  1EUJ A;  3JSB A;  4DAM A;  1WCM H;  1NMF A;  5DLQ E;  5ELN A;  4X65 Q;  4APV A;  3KJO A;  4DUY L;  1E24 A;  1BKB A;  3UDI A;  1PH4 A;  3HOV G;  4HJ7 A;  3FKI G;  1PH5 A;  1EQR A;  1WFQ A;  4DV0 L;  1N8R C;  1VS0 A;  1G51 A;  2MO0 A;  2ZTD A;  4QL5 A;  1E1T A;  1K0R A;  2JA5 G;  1K9M C;  2JA5 H;  4P73 A;  2K5H A;  1VQF A;  2UU9 L;  2NVQ H;  3I2Z A;  4ME3 A;  1GD7 A;  2NVT H;  3K0X A;  1SRU A;  4LF6 L;  4IFD J;  1KAW A;  3CC7 A;  1YBY A;  1TXY A;  3STB C;  2NVX H;  3OW2 A;  3GTG H;  2UUA L;  5IP7 G;  1NMG A;  2A2C A;  1Y14 B;  5HGQ A;  5IP7 H;  1GVP A;  1MKH A;  3GTJ H;  4JI2 L;  3ICE A;  1E7Z A;  1YHB A;  4AYB E;  1PH6 A;  4LF5 Q;  3SGI A;  4DV6 Q;  4B3M Q;  4IPD A;  1IBM Q;  2UXC L;  3DM3 A;  2HIX A;  2VW9 A;  2E2J H;  1C9O A;  1HJP A;  4LUV A;  3W1G A;  2WB1 G;  5GRO A;  5IP9 G;  3AJF A;  1YZ6 A;  3L7Z C;  5IP9 H;  2EXD A;  4X66 Q;  4OX9 Q;  2IP6 A;  3HOZ G;  4A93 G;  4Z7H A;  3D31 A;  1NBW A;  2AKW B;  2GVA A;  3L2P A;  5LMU L;  3HKZ E;  1SFO H;  2KEN A;  4DV1 Q;  3S14 H;  1SLJ A;  4A3B H;  4DR2 Q;  1OTC A;  1A8V A;  2YTY A;  2F6M B;  2PQA A;  4A3F G;  1VQG A;  3KLW A;  1SRO A;  3CCQ A;  2VQE Q;  2JEB I;  2EIF A;  4PZ6 A;  4C2M H;  4JI1 L;  5C44 G;  5C44 H;  2K14 A;  1M1K C;  3E9H A;  1A62 A;  1ASY A;  2JA7 G;  4MTN A;  2BA0 A;  2JA7 H;  4Y52 H;  5BR8 Q;  5IT9 c;  4JI6 L;  1Y1W H;  1JJG A;  4DR3 Q;  1AH9 A;  1PH8 A;  1KXL A;  4JYA Q;  3K8A A;  2A8V A;  3I4M G;  3I4M H;  2V6E A;  3W1B A;  3AEV A;  3PUV A;  1L2F A;  5M5Y H;  4B3S Q;  3K80 C;  4XTC S;  1Q1E A;  3TS0 A;  4OXP A;  4AYB G;  2Q2U A;  3I55 A;  2QEX A;  2ZRR A;  3K7U C;  4LF8 Q;  3CPF A;  3K81 C;  3J80 c;  3CAM A;  4Y7N H;  5JJL A;  3M85 A;  1N36 Q;  1VQ7 A;  4PL3 A;  4OWW B;  3H3V H;  4B3R Q;  3U4Z A;  5IE8 A;  4YZ9 A;  2DGY A;  2OQK A;  2WAQ G;  3GTL H;  2MNA A;  1TWC H;  5JJK A;  2D0O A;  3CMA A;  4AS2 A;  4AH6 A;  1Q46 A;  4C3I H;  2OCE A;  2ES2 A;  1XPR A;  2R7F A;  2EQS A;  3IRB A;  4LF4 Q;  1QZH A;  4K0K L;  4KI0 A;  3UIT A;  4A3M G;  4A3M H;  3VDY A;  5GAE C;  3L0I A;  3EIV A;  4JI8 Q;  4GNX A;  4UPA A;  5JEA G;  2UUB L;  3NEN A;  2R7Z H;  2R7Z G;  4BXX H;  2Z0S A;  4GS3 A;  4A3E G;  1GKH A;  4A3E H;  3J7A 5;  2CQO A;  1UEB A;  1SJ8 A;  4JI3 L;  1XMO L;  2XGT A;  1FJG Q;  1J6Q A;  2ZJQ A;  4GKK Q;  5IY0 A;  1Q81 C;  1YHQ A;  3TS2 A;  4I1T A;  1Q12 A;  5IWA L;  1GM5 A;  4KHP L;  1AE2 A;  1B8A A;  4IOC A;  4GLV B;  4DV3 L;  2H5X A;  4JI5 L;  5C3E G;  1YJN A;  5C3E H;  1VCI A;  1KIX A;  1SN8 A;  5H1S E;  1BBU A;  3GD7 A;  4DUY Q;  3I4N H;  2ATW A;  4OAV B;  3A74 A;  1J5E L;  2NZO A;  2ZJP A;  4DV0 Q;  5FJ8 G;  1WYD A;  3ERS X;  2VQF L;  2RF4 A;  1LYL A;  1PHJ A;  2UU9 Q;  4Q9V A;  3GTM H;  3S15 H;  3GDE A;  1JJC B;  2PI2 E;  1K8G A;  4DK3 C;  1OXX K;  3P23 A;  3BZK A;  1V9P A;  2PI2 A;  4IPC A;  3J80 i;  4LF6 Q;  2RCN A;  1P8L A;  2JAE A;  1X65 A;  4BY7 H;  3KFU A;  2UUA Q;  1WI5 A;  3PO3 H;  4JI2 Q;  4DR4 L;  1EIY B;  1V1Q A;  1Z9F A;  2XMX A;  2UXC Q;  2VY3 A;  3H3V I;  4GKJ L;  4R4O A;  1NTG A;  5LNK 1;  3KDF B;  3FP9 A;  4NPS A;  3CCS A;  1EFW A;  3OYY A;  1T9H A;  4IJH A;  1VQE A;  1I6H H;  4QY7 A;  3KF6 B;  5LMU Q;  3HOY G;  4HJ5 A;  2I5M X;  3HOY H;  4IFD G;  4DV5 L;  2ASB A;  1NE3 A;  1TWF H;  4O1P A;  1WCM G;  2NN6 I;  3F1Z A;  3F2B A;  1HNW L;  2DUD A;  1NJI C;  3UE0 A;  1AE3 A;  3DA3 A;  1S72 A;  1SMX A;  4POG A;  4WJ3 M;  3M9B A;  3S24 A;  3I9V 1;  1BVS A;  1X3F A;  2K19 A;  2PQA B;  4JI1 Q;  2CWA A;  3RZD H;  3MEF A;  1WOC A;  2WP8 J;  1EQQ A;  3PO2 G;  3PO2 H;  3BZC A;  1VQL A;  4WJ4 A;  2GN5 A;  4ALP A;  4JI6 Q;  1KD1 C;  4OAU C;  3T1Y L;  4HID A;  3U4V A;  4PMW A;  4A76 A;  1I94 L;  4GOP B;  1S3O A;  1UE1 A;  1PYS B;  1X6O A;  3EBE A;  1YIT A;  2MO1 A;  2I5L X;  1CKN B;  2OTJ A;  5C0X I;  1K73 C;  3LJ1 A;  1M90 C;  3IAM 1;  4GOP C;  4HIO A;  2KCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...