3Q8DA

E. coli reco complex with ssb c-terminus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
231
Chain Sequence
EGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords DNA repair protein recO
total genus 67
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3q8dA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3q8dA01
3PUXA 1LTLA 1QZGA 3CW2C 3S1QH 4Y7NH 2NVXH 3S17H 2E5LL 1L1OC 2AMCB 2KHJA 1RIPA 2HT1A 5IYDH 3UDXA 4AYBE 3T1HL 1Y1WG 1PH3A 3PGZA 4QIWE 3RLOA 1VQ7A 1KL9A 4DV6L 2ZTDA 1JB7A 2Q2TA 4JBKA 4GLAC 1K9MC 5IWAQ 2Q2HA 4JI5Q 4RMFA 1YBYA 4QGUA 1BKBA 1QVCA 2IT1A 3W1GA 1SFOH 4K0KQ 1XTDA 2VS1A 4HJ9A 3RLNA 1N36Q 4DV1Q 3F8TA 4LF9Q 3M4PA 4LUVA 3KF8B 4GN4B 3S1NH 2N8NA 4P73A 4MZ9A 3RN5A 4P71A 5GAHC 2OWOA 4KHPQ 2AWNA 2F3IA 3M4OH 5LMUQ 4BBSG 5IYBG 1IBLL 2BH8A 4HIOA 5M5XH 2YU9H 3I56A 1FVIA 2UUAL 3I55A 1IL2A 3RZOH 4X65Q 5IT9c 1TXYA 3L0OA 4PZ8A 1EQQA 3A5ZB 4LFCL 4YY3Q 1SE8A 3CPFA 1HNXQ 4DR5Q 2MFIA 1GM5A 3HKSA 4KHZA 1L0WA 1X9NA 3PF4A 2N49A 4R4TA 1HZBA 2E2HH 3TRZA 1X54A 4LW1A 2HHHL 2NN6G 3CCMA 5EAYA 1H95A 1J5EL 2CCZA 1C0AA 1TWAH 1CSQA 1VQAA 4KI0A 4LWCA 1K3RA 3J81j 3F2BA 1IBLQ 3HOUG 1AH9A 1QUQA 5ELNA 4AIMA 1VQMA 2DGYA 5C44H 3PIPA 5LMUL 2JA5H 4UP8A 4KHPL 4ME3A 3I2ZA 1M90C 2D0OA 3GTOH 3M3YH 3KDFA 2JA9A 3JAMc 4DK3C 3AYHB 5M3FG 1UE1A 1CKNA 1I94Q 4IPHA 4R4QA 3FKIH 2VNUD 2IY5B 2JEBI 4X66L 1KXLA 2PI2E 3K81C 1E3PA 4NXNL 1YEZA 3S2DH 5LMNL 4AH6A 2BA1A 5AJ3Q 1A0IA 1VQLA 4X64Q 1HZ9A 1NTGA 3CCJA 1YJWA 1GO3E 5E7NA 1B70B 4POGA 4H02A 4QL5A 3CCUA 1N32Q 1GD7A 2R92G 4JI2L 3KJPA 2VZAA 4LF8L 3S15H 2HIVA 3KF6B 4A3DH 4A93G 4A76A 2UXDQ 1XPOA 2QA4A 3GTLH 3J7A5 4B3RQ 4DR6L 1Y1VG 1FJGQ 5H1SE 4LF4Q 4IFDG 4NB3A 2JA6H 4DR3L 3ER0A 5FLXc 4B3SQ 3H3VI 4JYAQ 2JA8H 4WJ4A 3I4OA 1LM0A 1EOVA 3DM3A 1WJJA 4JI0L 3OW2A 4EX5A 2Z6KC 3J81i 2ES2A 2ALYB 2KCMA 1EIYB 1FL0A 4DAMA 2JA5G 1XNRL 4IOAA 3CC2A 2VQEL 4DUYL 4LF5Q 3HOZH 4C3IH 1TWGH 4DV5Q 1CKOA 1NBWA 2C35B 3W5OA 1YHAA 4B3SL 5M3MH 3JAMi 2WFWA 1Q1BA 3PCOB 5AJ3L 1I94L 3MXNB 4DV7Q 1JJCB 1Y1WH 4B3RL 4JI6Q 4A3FH 1SMXA 4LUOA 1YJNA 4BY7G 4IPGA 2Y0SG 3I4NG 2R7FA 3CP0A 4L5QA 4YWMA 4DV4Q 1EYGA 3RZDH 3A74A 4OWTB 3RNUA 4JI7Q 1CKNB 3CCLA 1Q12A 4C3JH 1X6OA 2AHOB 4DR7L 4A3KH 2F52A 2YYZA 1I5FA 3UE1A 5IP9H 2OTLA 2ASBA 4X65L 5C0XJ 1J6QA 1SROA 5JJIA 4XIGS 4LFAL 4PG3A 3HOWH 1PYBA 3LGJA 3UE0A 2ZJRA 5LMNQ 1QVGA 1JMCA 1VQ8A 1MJEA 3NBHB 2Z6KA 2JJQA 5C0XI 4ALPA 4LF6L 2XTIA 4JI3L 3CCSA 3OYYA 1IZ6A 2MQHA 2E8GA 4HIKA 2OCEA 2EXDA 4DV3L 3M4QA 1CKMA 1UE5A 1GKHA 2JA6G 2E2IH 4DUZL 3IRBA 4GKJQ 4A3MG 1UE7A 2VQFQ 1XMQQ 3S1RH 4OO1I 4A3LG 1JE5A 2WB1G 4JI5L 3M7NA 4BBRG 5IWAL 4LUZA 1QUQB 2RHQB 4LF6Q 5C44G 1SRUA 3H15A 2NVTH 5IYBH 3PO3H 2YTYA 2QEXA 4LFAQ 2ATWA 1S3OA 1XPUA 2K5NA 2UUBL 3TQYA 3GDEA 4MTNA 3J81c 4YCVA 3ULLA 4YCWA 3HOXH 4DR1L 4GOPC 3T1HQ 1J5EQ 3I4MH 3TS2A 4A3LH 4GKJL 1Y14B 2BH2A 1KRSA 2K14A 1OXUA 1KIXA 3CC4A 1VQBA 5GAEC 3KJOA 4DR5L 3HOZG 1RL2A 3SGIA 3G6EA 4P74A 4R1JA 1Q1EA 4YHHQ 5IYCG 2B63H 2UUAQ 3I4NH 1FGUA 3HFZB 3K0XA 5HY6A 5DLQE 2KENA 2NZHA 2ZM6L 2OQKA 3CF5A 2H5XA 5C3EG 3J7ZC 4LFBL 2HHHQ 1Z9FA 4BY1H 1HZCA 3J80i 3H3VH 1L1OA 4JCVE 2K52A 4JBJA 1N33L 2R93G 3FKIG 2CQOA 2K75A 1AE2A 1IBKL 4L5RC 1YHQA 5JJKA 4UPAA 1DGSA 2UXCQ 1B7YB 1SLJA 4MNOA 1K8AC 1XNRQ 3HOWG 3PUWA 3CMEA 3PO2H 3S24A 4J15A 1VQ6A 4DV6Q 3KLWA 1YIJA 4FDBA 1N8RC 3AQQA 5ELOA 5M5YH 2VUMH 5BR8Q 4UP9A 1OXTA 1OXXK 1Y1VH 4JI1L 4YWKA 4HJ5A 1PH9A 4A3BG 4LF4L 3GTGH 4IOCA 3PF5A 1N9WA 4WJ3M 4O0AA 3H0GH 2PNHA 4OWWB 1MKHA 3TREA 1XPRA 4LF5L 3GTMH 3ULPA 4OX9Q 3GO5A 1LYLA 1VCIA 1YI2A 5JEAJ 1MIUA 1U0LA 2UXCL 1KHIA 5FLMH 2UU9L 4HJ7A 4QJFA 1VQHA 4PZ7A 3HOVH 2PI2A 2F4VQ 3HOUH 4R4IA 3CCEA 3RR5A 4DR4Q 1A62A 4AQYL 1VQ4A 1Q82C 2ZTCA 3HOXG 2F4VL 2UXDL 4X64L 2UU9Q 1CSPA 5IYCH 1QVFA 3EBEA 1VQOA 2B63G 3GTKH 1KAWA 1G6PA 1E1TA 3M9BA 1CUKA 2B3GA 4OX9L 1A63A 1G51A 1OXVA 1PA6A 1QZHA 1K0RA 4A3EH 4P72A 4OXPA 1XMOQ 5M3MG 3K7AH 4XTCS 4NPSA 4GN5A 3KYHC 4RG1A 5C3EH 4IFDI 2YTXA 4A3JG 2R93H 3HOYH 3PUYA 4DKAC 3PO2G 2K4KA 1JJGA 4PMWA 2MO0A 1YHBA 1PH7A 1N34Q 1EFWA 4KLKA 3K8AA 2VQFL 2XGTA 1XJVA 1Q81C 4TQUS 4DUZQ 1KC8C 2CFMA 4IPCA 1K8GA 4LNQA 4A3BH 1TWFH 3A5UA 1O7IA 2CWPA 4DV3Q 2MNAA 4A3KG 4YCUA 2AWOA 1PV4A 2A8VA 4DNIA 4LFBQ 3NENA 4YY3L 3T1YL 4HJAA 4A3IH 2PQAB 5IE8A 3UDGA 4B3MQ 1M1KC 4A93H 3S16H 1EWIA 5C4XG 2WP8J 1X3GA 5JJLA 3KDFB 4YHHL 1PH6A 2AKWB 3T1YQ 2JE6I 3TS0A 4GLXA 3E9IA 1ASZA 4POFA 3GTJH 2JK8A 2WAQG 3F2CA 2LSSA 1LUZA 5FLMG 2D0PA 1E22A 3RN2A 1S72A 1HNXL 4L5TA 4DR1Q 2RCNA 5M3FH 4DV0Q 2D62A 4GNXA 4EQ5A 4X62Q 3OTOL 1SR3A 1I3QH 2Y0SE 1C7YA 1K83H 4JBWA 1OXSC 5HGQA 4JI8L 1E24A 2KCTA 4A3FG 1HH2P 3W1BA 4BA2I 3EN2A 3STBD 4BXXG 3E0EA 3CCRA 3PUVA 2LXJA 3CPWA 4DV7L 4R4CA 1L1OB 3EIVA 3CC7A 1L2FA 1N36L 5IYDG 1N33Q 4A3CH 1X65A 3L7ZC 1I6HH 1XMOL 2OQ0A 1VQ5A 1WFQA 1HR0L 3BZCA 4JI3Q 2EIFA 2JQOA 4X6AH 4DPGA 4HJ8A 1I50H 2NN6I 4JOIA 2L15A 1VQEA 3ICEA 5FJ8G 1X3FA 4GS3A 1V9PA 1PH8A 3CXCA 3CAMA 4P75A 4A3JH 4OWXB 2R7ZH 4DR3Q 1PFSA 5GROA 1YITA 2PMZE 4DR2Q 1IBML 3A0JA 4IPDA 1KRTA 1KD1C 1P8LA 2QGQA 2ZJPA 4DR7Q 2K5HA 3H0GG 1UWVA 1WOCA 4DK6C 4YWLA 3TEHB 1PH2A 1HR0W 2R7ZG 4UY8C 3ZJYC 4BBSH 4DV4L 4B3TL 1HNWQ 4R4OA 4A3MH 2JA8G 2CWAA 3PSIA 2N3SA 3ERSX 4JI2Q 3CCQA 4LF7Q 1EQRA 4A3GG 4JG2A 1GVPA 2VW9A 4BBRH 4GNXC 1YNXA 1C9OA 2GVBA 2MO1A 1JJ2A 2IX0A 1WCMH 3BZKA 1Q46A 4IO9A 5BR8L 3NELA 4JI4L 4JV5L 4DV5L 3ULJA 3F2DA 4OONA 4A3GH 4HIMA 4QQBX 2VQEQ 4DUYQ 2YTVA 2Q2UA 1X56A 3FP9A 1YVCA 2FXQA 4GOPB 2Z0SA 3GD7A 3BU2A 1U5KA 1VQDA 4GN3B 1VQNA 1HR0Q 1Q7YC 3AEVA 1BBUA 2V1CC 1IBKQ 2UUCQ 4IJHA 4BXXH 4DAYB 3HKZE 4X66Q 3UDIA 2IHFA 4DV2Q 2ID0A 3HKZG 5IP7H 1YJ9A 2JA7H 1IYJB 1VQJA 4JOIC 3G71A 4PZ6A 2E2JH 1NMGA 4IJLA 2GVAA 4LF7L 3HOYG 1AE3A 2ZM6Q 1KQSA 5C0XG 1SN8A 5J3BA 1VQFA 2NVQH 5IP7G 2JA7G 2HIXA 4JC0A 3CQZH 4LF8Q 3DLLA 1TWCH 2I5LX 5C4JH 3U50C 4BY7H 4BA1I 2KHIA 2I5MX 3M85A 1N32L 1HNZQ 1VQPA 5JEAG 1PH5A 3STBC 1NMFA 4LFCQ 1S40A 2ZTEA 4NXML 3S2HH 2VUMG 1Q8KA 1XNQQ 1MJCA 3K80C 3GTPH 4B3ML 5C4XH 4A4IA 1Q86C 4A75A 4GOPA 2RF4A 2R92H 2GN5A 5IP9G 1VS0A 2WB1E 2I0QA 4NXNQ 1BBWA 3U4VA 3F1ZA 4GKKL 1XMQL 4APVA 1UEBA 2A19A 4DV1L 4LF9L 3S14H 5M5WH 1VQ9A 3D31A 1D7QA 1OTCA 4C2MH 4GKKQ 3U58A 2UUBQ 3I4MG 1HZAA 1N34L 4JI8Q 2EQSA 1VQGA 1PH1A 1JT8A 4X62L 3OTOQ 1PH4A 4JBMA 2KBNA 2K50A 1XNQL 1E7ZA 4DV0L 1VQKA 3K7UC 2LXKA 1PYSB 1VQCA 3WWVA 2HQLA 3AFQA 1HNZL 3PO3G 5GQOA 2ZJQA 1WYDA 1B8AA 2DUDA 3AFPA 5GAGC 1X55A 3VDYA 4BY1G 4GNXB 2IX1A 2R6GA 1NY4A 1EUJA 5GADC 2CKZB 3UDFA 1WI5A 4JI7L 1E1OA 4OO1G 2JEAI 2R7DA 4O2DA 2A1AA 3CCVA 5K36G 4NXMQ 2OTJA 4QY7A 1NE3A 3FHWA 4GLVB 1V1QA 1NJIC 4AQYQ 3BJUA 4DR4L 1HJPA 1V43A 4A3CG 1T9HA 2Q2IA 4DV2L 4L5SA 4K0KL 1D8LA 1W2BA 3PIOA 3RLFA 3E9HA 3U4ZA 3KF6A 3L2PA 1PHJA 1BVSA 1VQIA 2VY3A 1ASYA 3I7FA 3Q8DA 4A3DG 1YZ6A 5FJ8H 2RHSB 3CD6A 2PQAA 2BA0A 4JI0Q 4JI6L 4JI4Q 2N78A 4A3IG 1G291 4AYBG 2NZOA 1WCMG 4JI1Q 5IY0A 2UUCL 4IFDJ 4HIDA 2E5LQ 3D0FA 1EIFA 1X3EA 4Y52H 5LMNW 1TWHH 1PVOA 1R9TH 4B3TQ 1HNWL 3NEMA 3MEFA 4C3HH 3B6YA 3KFUA 1K73C 2UXBQ 4JV5Q 2B29A 2NVYH 3G4SA 4A3EG 3GTQH 4JYAL 3J80c 1Z47A 1FJGL 2YV5A 3PV0A 2VL6A 2WAQE 1IXRA 3KOJA 2IHEA 4TVAB 2K5VA 3CMAA 1P16A 4DR6Q 1IBMQ 4DR2L 2I5HA 1W3SA 1UE6A 3HOVG 2UXBL 3G48A 1A8VA 3S1MH 4UP7A 3PUZA 3JC66
chains in the Genus database with same CATH superfamily
1LT4D 1LTLA 1ML0D 1PRTF 4PL5A 2A2DA 2E5LL 1L1OC 2KHJA 1RIPA 2P5ZX 1RODA 1RTNA 1XXGA 5G3LF 5C44B 5IGDA 3H09A 1J8IA 2WINB 2ZTDA 2Q2TA 4JBKA 5IT9L 1RKNA 1B9NA 1QVCA 2IT1A 1SFOH 4K0KQ 1XTDA 2VS1A 2XWJB 1UNSA 3RLNA 3KF8B 2KKMA 3TN2A 3FPPA 2ZW3A 3R93A 2B2TA 2BH8A 4HIOA 2YU9H 1IL2A 3I56A 1FVIA 3TZUA 3V05A 2WKDA 4X65Q 5IT9c 1TXYA 2CH4W 3L0OA 1SEBD 3A5ZB 1HNXQ 1SE8A 4HCEA 3HKSA 4KHZA 1RDPD 2XTQA 4OHJA 4Q9VA 2CQAA 3TRZA 4A3KB 5HURA 2ICIA 1VQAA 4LWCA 3J81j 1SAPA 1SNPA 5C44H 2JA5H 3Q6SA 5C3XA 2D0OA 2F0HA 3JAMc 1U9RA 2WAQB 4RKBA 4IPHA 4R4QA 2OF1A 4X66L 1KXLA 5M3MB 5KNBA 3JAME 1I4XA 4AH6A 2BA1A 1ICWA 5EPKA 1QG7A 1A0IA 3GP7A 2B8GA 1HZ9A 3CCJA 4I65A 2CW0D 3ERQA 1B70B 1BDOA 4H7BA 3MEHA 4H02A 2RSOA 3E0JA 2Q8IB 1N32Q 1K3BC 2DNEA 2VZAA 4A3DH 3B55A 2HUGA 1KLUD 4A76A 2UXDQ 2QA4A 3J7A5 1PZID 4IQZA 4QUCA 4NB3A 5FLXc 4U68A 2JA8H 1B4OA 1WJJA 1HPCA 4KKSA 3OW2A 4DU9A 3HG9A 3J81i 2ES2A 2KCMA 1EIYB 4DAMA 1XNRL 4DUYL 3HOZH 3S1MB 1DOKA 2OEOA 1NBWA 1R9TB 4B3SL 2L1LB 1I94L 4DV7Q 3DA4A 1JJCB 2Z8LA 4B3RL 3A8JE 2A6HD 3I4NG 2R7FA 4YWMA 4DV4Q 5JEAH 3RNUA 2WKCA 5CMDA 3CCLA 4EQPA 4UAIA 3TBIB 4A3KH 1I5FA 2QEJC 2ASBA 4RGOS 1SROA 1X3PA 3E3XA 1M8AA 5JJIA 4XIGS 2K04A 3HOWH 1WTXA 3VYUA 1PYBA 1BQQT 4LF6L 1NUCA 2JJQA 1I6HB 1IZ6A 1DJRD 3I72A 3FVVA 2XWBB 2OCEA 3EA6A 1GKHA 2KEDA 3IRBA 4TRDA 3S1RH 4A3LG 1DD2A 2WB1G 1PTOB 4JI5L 3M7NA 4BBRG 2RHQB 5C44G 3KBGA 5KEEA 4X3TA 1S3OA 3TQYA 1EYGA 4MTNA 2EYPA 4DA2A 4YZDA 4YCWA 4DR1L 3TS2A 4GKJL 1FNWA 1OXUA 1KIXA 5GAEC 3KJOA 1FR3A 4QCLA 5M5WB 2R7ZB 1STGA 1EY4A 4QMGA 1WTQA 5DEHA 1WCMB 4BY1H 1HZCA 2SOBA 3H3VH 2F0PA 4JCVE 4WJWA 2X6GA 3C1EA 1EOTA 5JJKA 4UPAA 2BE5D 2FUG1 3CMEA 3N52A 4J15A 4MHEA 4FDBA 2E76C 1I4QA 3AQQA 2L12A 1IW7C 2A5HA 1Y1VH 1OXXK 1AZQA 2EYHA 2NTSA 3H0GH 4OWWB 1MKHA 3GTMH 1GUOA 4LF5L 3GO5A 1LYLA 5JEAJ 3KK7A 2F4IA 5E4XA 5C4ZA 2UU9L 3HOVH 1EY0A 2PI2A 3C46A 1JWSD 3GV3A 3ND9A 3LNNA 3LJ1A 1A62A 4AQYL 2RIOA 1Q82C 2H4OA 1AFPA 1SYEA 3HOXG 2F4VL 2Y0SB 1PYWD 5JPNC 1QVFA 5IGFA 1I4GA 3H0GB 2B3GA 1G51A 1NR2A 1OXVA 3A55A 1LTSD 5DNFA 4A3EH 3GTJB 3QR8A 1XMOQ 1CM9A 4XTCS 4KHVA 3DM1A 2D9UA 2F0DA 1K8MA 2YTXA 4A3JG 1PZJD 5HGIA 3PUYA 4A3IB 4DKAC 4HEDA 2MO0A 3MZ5A 1N34Q 1F9PA 2WACA 4KLKA 5IGBA 1XJVA 1G2TA 1HQMC 1B2TA 3J80E 1Q81C 4IALA 4TQUS 1TS4A 5CV8A 1KLGD 4YCUA 3X3NA 4RHRA 2RCFA 3NHHA 2PQAB 4B3MQ 2B63B 2HD3A 3S16H 4G76A 2C9OA 1STYA 3KDFB 1PH6A 2AKWB 2EY1A 5EJWA 4K6DA 2RSNA 4CDCC 4XQNA 3H3VC 1BOSA 5E1FA 3LJ2A 1QNUA 1LUZA 2LSSA 5CORA 5L37A 1HNXL 5KYLA 2XSCA 2RCNA 4GNXA 2JYOA 2Y0SE 1K83B 3G6JB 1K83H 1A3UA 2KCTA 3K58A 2E2IB 4RCOA 3STBD 2QCPX 3BDOA 5IGEA 4R4CA 1U4PA 1I6HH 3MTSA 1XMOL 3OSOA 1QE6A 1PTOF 1RD9D 1E2WA 2EIFA 4PNYA 4HJ8A 1PXUA 1X3FA 3J7YW 2HGKA 1PH8A 4P75A 3PIO3 2R7ZH 2ZXRA 1PFSA 2MP1A 2PMZE 4DR2Q 1IBML 3A0JA 1WVLA 1HUMA 1WOCA 2K19A 1HR0W 4UY8C 1JICA 1C48A 2L9HA 2FHTA 4A3GG 2Q8RE 4AS3A 4NP5A 4IUPA 4BBRH 4OL7A 3NTHA 1PMRA 2MO1A 3V96A 1JJ2A 1WCMH 4FYDA 1Q46A 4IO9A 1KNAA 3QO2A 1YNND 2NN6H 3J81E 3EROA 3HS0C 4DV5L 4A3GH 3NBIA 1STHA 3T16A 4UHVA 2BDOA 1VQDA 2B2UA 4GN3B 3DWPA 1BBUA 4IN3A 5EPLA 4X66Q 2JXMB 1DONA 2V4DA 1E2ZA 5IP7H 2JA7H 1SBBB 4XQQA 1AZPA 2E2DC 1KQSA 1SN8A 1VQFA 2HCCA 5IP7G 3J81L 2JA7G 2HIXA 5IOCA 5J1ZA 3S9WA 3DLLA 5KNCA 5KRUA 3KF8A 1U4RA 4NXML 2EYOA 2K5WA 5BN3A 2VUMG 5C4XH 4C3IB 2EJMA 2GN5A 2XVSA 3MHBA 3VYTA 2L1BA 3U4VA 3OHXC 1UEBA 1EWCA 1VQ9A 3D31A 1D7QA 4C2MH 2PNRC 3U58A 2UUBQ 4HN7A 4QB4A 1HZAA 2K01A 1AP0A 2CHBD 2EQSA 1PH1A 1SNDA 1JT8A 4A3FB 2KBNA 2J4XA 1E7ZA 2B2YA 1T5XD 2L5TA 1VQKA 1EU3A 2PQEA 1PTOH 4LJZC 5ELFA 3BG3A 4HTHA 2A6HC 2ZJQA 1B8AA 2DUDA 3SXHA 5GADC 2A73B 3UDFA 2K32A 2L4NA 4JI7L 2JEAI 2A1AA 3RMHA 3CCVA 2XMXA 4NXMQ 5K36G 2OT2A 2KQ3A 4J1MA 3BJUA 4DR4L 4K8IA 1V43A 1T9HA 1BXTA 2Q2IA 4FNFA 4H0LC 2AUJD 3Q24A 5CGKA 3E9HA 3M4YA 3U4ZA 1BVSA 1ASYA 1T5EA 3Q8DA 2JA8B 1WD1A 1I4RA 1XTCD 2PQAA 2BA0A 3CKIB 4JI4Q 5D65A 4AYBG 3TP7A 2RKSA 1PRTD 1S5BD 3D0FA 1X3EA 4Y52H 1BBXC 1CFMA 2NWGA 1CA5A 1TWHH 3EFXD 4ODGA 3TMEA 1LTAD 3MEFA 4C3HH 5LHY1 4KD4A 2NVYH 3G4SA 4JYAL 2YV5A 2WAQE 1IXRA 1S4ZA 5KYIA 1V1OA 2K5VA 1UE6A 5D3IB 3CRKC 5CV6A 3G48A 1A8VA 3MC0B 5ELDA 3S17H 3S1MH 3HOZB 4F87A 3PUXA 1CK1A 3CW2C 3S1QH 4Y7NH 2NVXH 1HUNA 5CV5A 5I6YA 5IYDH 4AYBE 5K36H 4K2KA 2B8FA 3T53B 3PGZA 3SEBA 4O42A 1EYAA 3HOXB 1D2BA 4XDXA 4UDUC 1K9MC 4TKOB 2Q2HA 1IW7D 4NV2A 4Z9CB 3ONAB 3W1GA 1RTOA 2BDNA 3SDJA 3F8TA 4LUVA 3NQIA 4MZ9A 3RN5A 3NWTA 2OWOA 4KHPQ 2F3IA 2Q8TA 4BBSG 3LWEA 3L3OC 2PMZB 4FO2A 3RZOH 1D5XC 1Y69U 3NBHA 4KN7C 3IAYA 4YY3Q 1G2SA 1TKWB 2MFIA 4DR5Q 1L0WA 2F0GA 3K5NA 5IT9E 2N49A 4R4TA 1D1IA 1HZBA 4DAYA 4Y7NB 1X54A 2HHHL 3CCMA 4H44C 2A2CA 1ZXTA 5EAYA 3DEPA 1D5ZC 5FLXE 1C0AA 1TWAH 1CSQA 1H95A 1AH9A 1K3RA 2SNSA 2ZXOA 4AIMA 1VQMA 3U9OA 3OWEB 1CZWA 5LMUL 4UP8A 4ME3A 3IAS1 5EKKA 3M3YH 3AYHB 3BS1A 2VNUD 1QCBD 2JEBI 2PI2E 4EGVA 1HQRD 1X3QA 3Q23A 4C3HB 3S17B 1YEZA 1TWHB 3J80L 5LMNL 2F0FA 2QW7A 3TP8A 2YU9B 1VDZA 1PRTB 1YJWA 2WIIB 4BY7B 2RQXA 4QL5A 4ZKBB 3MXPA 3BYYB 4JI2L 4LF8L 3N6RA 2RA4A 1K8OA 4A93G 2F66B 1B50A 1XPOA 5T1GA 3MFGA 2G9DA 2WV6D 3GTLH 4DR6L 5H1SE 4IFDG 4B9XA 1I6VC 1GUWA 1LM0A 3T4AC 4JI0L 4EX5A 1HTLD 1TVXA 3PMFA 2JA5G 1FL0A 2FU2A 2ZT9C 4LF5Q 2VQEL 4C3IH 1TWGH 1KNEA 4DV5Q 3BVZA 3C3LA 5D3DA 4ILWA 1Y1WH 1JQYD 4JI6Q 1SMXA 1EYCA 1JC7A 2K28A 3A7LA 3CP0A 4DN4M 4JI7Q 1CKNB 4OAUC 4HSVA 2FFKB 4K6LA 1X6OA 2AHOB 4DR7L 2F0IA 2F52A 4DWLA 3S1QB 2IWHA 2IJ0A 2HCIA 5C0XJ 1J6QA 1LO5D 2KJXA 2KEEA 1VMPA 3LGJA 3UE0A 3NBHB 4ALPA 2XTIA 5NUCA 2MQHA 3P1HA 1UE5A 4GKJQ 2E2IH 4DUZL 4A3MG 3GV6A 1CZGA 1XMQQ 4R8IA 1NCVA 4AYBB 1XWEA 3VA5A 1QUQB 3J7AF 1SRUA 3PO3H 1HHVA 2QEXA 1XPUA 3WOFA 4RHSA 3MXGA 2B2VA 1KABA 3CU7A 1F9RA 1Y14B 3Q0AA 1KRSA 4KK7A 2DY7A 3CC4A 2FINB 3IKJA 1A3TA 1LTTD 4R1JA 1Q1EA 4HMIA 1PFMA 2QSBA 5IYCG 2UUAQ 2B63H 3FDTA 2A68D 3L0IA 2EE1A 2KENA 3NPPA 2NZHA 4ZUIA 5LNK1 5C3EG 4LFBL 4N8X1 4B08A 1DOMA 4ULLA 3J80i 3BYTB 1L1OA 4JBJA 2IX3A 2CQOA 2K75A 1AE2A 1IBKL 2K05A 3K5MA 2EXZA 2VB2X 4G57A 1DGSA 2UXCQ 1B7YB 3PO2H 1TS5A 3DXJC 3VR6A 4X3UA 4DV6Q 3KLWA 2GSCA 2C5CA 1B1ZA 1EY9A 1I3QB 5ELOA 2O5JC 5BR8Q 1C4QA 2PYKA 3FPUB 4A3BG 2RADA 2B2VC 1F2MA 2PNHA 1STBA 2FJ2A 1RHPA 1L0YB 1MIUA 1U0LA 2Z1CA 1F9SA 1VQHA 2GA4B 4GXTA 4R4IA 4RGNA 3K5OA 3CCEA 4DR4Q 2KCNA 1GXDC 2UXDL 2UU9Q 4DK0A 4CDDC 2AQ2B 1G6PA 1GUTA 1A63A 1GUSA 4I7ZC 1QZHA 1K0RA 3GTGB 1D5MC 1IKLA 4P72A 1ENAA 3CQZB 5M3MG 3AU7A 3K7AB 1WTPA 2R93H 3HOYH 3IFDA 3PO2G 2K4KA 1GHKA 1JJGA 1A3VA 4PMWA 1PH7A 1FYCA 1BNZA 2K5QA 3DUZA 3QOLA 5IIFA 3K8AA 2XGTA 1MHWC 4MTKA 2HDMA 3NP8A 4LNQA 1KC8C 2CFMA 4IPCA 5I6WA 3A5UA 2CWPA 4A3KG 2AWOA 1PTOD 4DNIA 4LFBQ 3NENA 2ENBA 4A3IH 3UDGA 3HOUB 4A93H 2WP8J 1X3GA 5FOBB 4ABNA 1TIID 5K5PA 2JE6I 3TS0A 4GLXA 3E9IA 3GTJH 2JK8A 3SVMA 4ME5A 1L0XB 1E22A 1SJHD 1QB5D 5I9PA 2D62A 1VF7A 1Y1VB 1R4QB 2JN4A 3OTOL 4LK1C 4X3KA 2VXWA 1I3QH 4FF2A 4JBWA 3UI2A 1OXSC 3BVMA 1E24A 4OIKA 1HH2P 4C1NK 3EN2A 4BXXG 3NE5B 4DV7L 4PL3A 2NTTA 1N36L 5ELBA 1X65A 3L7ZC 2JA7B 1MSGA 3BZCA 1O80A 2NN6I 1ESRA 1FD7D 1VQEA 3MA2B 3TZDA 3ICEA 4CKEA 4GS3A 1SYDA 3NTIA 4JW0A 1YITA 4N9PA 1S5DD 1P8LA 2ZJPA 4DR7Q 3H0GG 2KHSA 1TWFB 4DK6C 1JQOA 1IKMA 5CBEE 5DAUA 4BS9A 4DV4L 2FEFA 1O7LA 4B3TL 2JA8G 1ESFA 1EQRA 5I2YA 1U4LA 1C9OA 5DM73 3BZKA 1I4PA 2VB3X 4CHTB 4JV5L 3ULJA 3F2DA 4OONA 1B3QA 4V0BA 2VQEQ 3KLSX 2R61A 2FXQA 3D4WA 3GD7A 1Y8NB 3FNBA 3AEVA 2V1CC 3Q22A 2UUCQ 3UDIA 2IHFA 4DV2Q 2ID0A 2RDHA 1YJ9A 1ILQA 3P7JA 4JOIC 3G71A 1O7ZA 1U4MA 4LF7L 2YFBA 1EY5A 1AE3A 4KY5A 5C3EB 5J3BA 1TY2A 2RVLA 1WTOA 3NQTA 4LF8Q 4DAVA 1B3AA 3RD4A 4BY7H 4HEA1 3EJIA 1N32L 5LL6S 1HNZQ 5JEAG 1PH5A 3UITA 1S40A 2ZTEA 4KY7A 3S2HH 3GTKB 3VA7A 3O13A 3I3CA 4DXGA 5C5MA 1TWGB 4B3ML 4A75A 1IHZA 3NXWA 4G7HC 2RF4A 3SE0A 2R92H 2I0QA 2WB1E 4APVA 1O78A 5A35A 2O2LD 2RBMA 1OTCA 2B2WA 3MVVA 4X3SA 5J39A 3I4MG 5DM63 1N34L 2KUMA 4JI8Q 1SNMA 4X62L 1PH4A 1SXTA 4JBMA 1CQVA 1XNQL 1H9RA 1R4PB 1VQCA 4KKTA 3WWVA 2QDBA 3PO3G 1WYDA 2BOSA 1CI3M 3AFPA 4BY1G 1SNCA 1NY4A 2RLDA 2YFAA 1SYFA 2CKZB 4K5XA 1WI5A 3HEJA 2CH4A 2OTJA 4QY7A 1NE3A 4CGYB 4DK1A 1HJPA 4DFAA 4A3CG 3QOJA 2A69C 4L5SA 4K0KL 1W6JA 4RKLA 3KF6A 1ET6A 3L2PA 1PHJA 4A3DG 4J8QA 2VY3A 1YZ6A 1ICFB 5FJ8H 4JI6L 4Q5VA 2N78A 2F0SA 3KBXA 4IFDJ 2E5LQ 2E2HB 3S15B 2M2LA 5BN5A 1PVOA 4C3JB 1HNWL 2IP6A 3P20A 2IPKD 1C8CA 3GTQH 1TQOA 4KMUC 1LABA 2VL6A 3CMAA 4KY6A 1JORA 1W3SA 2N88A 2HDLA 1EFID 3I90A 2K1BA 4IUNA 1HCZA 1VQ6A 2N55A 3CD6A 3GTLB 4JK1C 3SK8A 1ZKOA 1V8QA 4XT1B 2AMCB 4OGQC 3R3OA 3HGBA 3EVQA 3UDXA 3D4RA 1Y1WG 1DM0B 5JVG3 1KL9A 4DV6L 1JB7A 1PZKD 4KJNA 5JOBA 4IZ8A 3HRZC 5EKIA 1YBYA 4QGUA 1STEA 2JB3A 4FXDA 4JPBW 5FK9C 3S1NH 4GN4B 4HSPA 3R2TA 4P73A 4P71A 1FNUA 3K57A 2P22B 4NMZA 5IYBG 1IBLL 3GTOB 5M5XH 3VR3A 3I55A 2PZTA 1EQQA 2BH2A 4PZ8A 4LFCL 3CPFA 1X9NA 3PF4A 3OOCA 2E2HH 3FKIB 2EY5A 1J5EL 2CCZA 2TMPA 5EQ0A 4EVOA 3HOUG 5ELEA 1IBLQ 3PIPA 4KHPL 3I2ZA 1IL8A 3GTOH 5JVH3 1CKNA 1I94Q 3L9AX 3LX0A 3MXUA 3M4OB 2IY5B 3E6ZX 4YZ9A 3ZYYX 5CR3A 1NR4A 3S2DH 2NZ1D 3DWQA 1WTHA 5AJ3Q 3RZOB 2Z6BA 2XRQD 1SJ8A 1VQLA 2M00A 3I9V1 1EY6A 4X64Q 1O7YA 3BVGA 5E7NA 1Q90A 4ZRZA 4IUQA 5C4JB 1H9KA 4POGA 2V6EA 4IUTA 2R92G 2I46A 4XT3B 3DO9A 2E2JB 1WTVA 2F3WA 2IL8A 1Y1VG 3PIP3 4LF4Q 4CDEC 4DR3L 1JOKA 3DHQA 3IFTA 5M5XB 4LAAA 4JYAQ 3I4OA 1EOVA 3DM3A 1EWHA 3S14B 1F2ZA 2Z6KC 2ALYB 1S5ED 4A3GB 2MGSA 2JB2A 2PPBC 1JWMD 1CKOA 3W5OA 5D14A 1Q1BA 2BE5C 1XYIA 1RF2D 4A3FH 2ICEC 3SK6A 4C3IG 4IPGA 5T1IA 3OMGA 4OWTB 4QUFA 1Q12A 2DNCA 2EPBA 2QILA 2YYZA 2BCOA 4CJ2C 2OTLA 5CV9A 3GTPB 2MUYA 4LFAL 4PG3A 4G4KA 1HRJA 5LMNQ 1JMCA 1VQ8A 2Z6KA 4IURA 3CCSA 2E8GA 1EQVA 4HIKA 1Q3LA 3M4QA 1CKMA 3OIQA 1B9MA 2K03A 5ELCA 2JA6G 2R92B 2VQFQ 1JE5A 2PZWA 2MHVA 3FBVA 1TR5A 2NVTH 3PQIA 4DAPA 2ATWA 4LFAQ 2KCCA 2K5NA 3GDEA 3HOXH 4GOPC 3ULLA 1J5EQ 1DZ1A 4A3LH 3I4MH 5CV7A 2NUCA 4FF1A 1LT3D 3SGIA 2EOTA 2J0TD 5CYUA 3I4NH 4HCSA 5LL6X 2HQEA 2ZM6L 2OQKA 3TDQA 4EQOA 1CTMA 3CF5A 2F0MA 4L63B 2K52A 2PW5A 3FKIG 4C3JG 4L5RC 1DYQA 1SLJA 2PZUA 2Z4IA 1K8AC 3PUWA 1BR9A 4CKBA 2QKIC 1A2TA 1N8RC 5M5YH 2VUMH 4UP9A 1OXTA 4JI1L 4FP5D 4HJ5A 1PH9A 4LF4L 3GTGH 2QDLA 4IOCA 3PF5A 1N9WA 3OWFA 4WJ3M 3VR4A 4O0AA 1XPRA 3TREA 4F7XA 3ULPA 1K0SA 3KLRA 4MIUA 5FLMH 4RFBA 5E3FA 4NV5A 4HJ7A 1XX8A 4PZ7A 2F4VQ 3HOUH 2EJFC 1JCKB 3RR5A 2M9VA 1LTRD 2LY7A 3VYSA 4CBVA 2XIWA 2ZTCA 3T51B 4X64L 1CSPA 5IYCH 2B63G 1CHPD 1VQOA 1TU2B 1E1TA 1CUKA 4OX9L 1QOHA 1PFNA 1SMYD 5JJZA 1SYBA 2A69D 4OXPA 5KGUA 2ETDA 4NPSA 4M8AA 2A74C 2EYLA 4ZKCB 4YZCA 5C3EH 3FMCA 1SNOA 1CA6A 1MBYA 3I73A 1H9MA 1EFWA 1UUPA 3QG1A 2XRSD 1YNNC 1K8GA 4A3BH 4BY1B 4DV3Q 5I2XA 3AB9A 3S16B 2LKVA 4A93B 1SNQA 4YY3L 3T1YL 3DWAA 4HJAA 1FGBD 4RGTA 1M4VA 3T1YQ 5EGTA 4POFA 1LV9A 5IODA 2WAQG 3I4MB 2BL8A 4IUUA 3F2CA 4RA8A 2F03A 3RN2A 4B9WA 1S72A 4L5TA 4FXGC 1YO7A 4DR1Q 5M3FH 2L0CA 2H1EA 1SJED 4X62Q 1SR3A 1BUVT 1C7YA 5HGQA 4JI8L 4A3FG 1SYGA 2EYMA 4A3EB 4A3EG 3CPWA 2LXJA 4YIJA 3EIVA 1HXYD 1L2FA 2OQ0A 3R8BA 1WFQA 3R2IA 4K14A 4X6AH 1I50H 4JOIA 1G91A 2L15A 2AQ3B 3SR1A 5FJ8G 5M9OA 4L6TB 4V190 3CAMA 4IFDI 2A6EC 4OWXB 3I4NB 2R93G 5GROA 1ET9A 3U9SA 3BDCA 2EVBA 3QIAA 1TY0A 2QGQA 3C2PA 2K5HA 4YWLA 3PO2B 2CVRA 4G7OC 2R7ZG 1A2UA 3ZJYC 1JE4A 1TS2A 1HNWQ 4R4OA 2N3SA 4WORA 3CCQA 4BBSB 4LF7Q 1ILPA 1S5CD 4GNXC 4I7AA 1YNXA 3D6CA 2IX0A 4QIWB 3NELA 3EQLC 4DUYQ 2YTVA 3VA9A 1YVCA 4GOPB 2B2WC 5C3WA 1U5KA 1I50B 4BXXH 3HP3A 4DAYB 1EIHA 1F2LA 3URYA 3HKZG 4C56C 1VQJA 1VF5C 2E2JH 1NMGA 2GVAA 3FVQA 3HOYB 3HOYG 2NVTB 5TSSA 5C0XG 4OO1H 1ZYRC 2L11A 4OIJA 2NVQH 3G7LA 5CV4A 4JC0A 4NW2A 2I5LX 4C1NI 5C4JH 4BA1I 1F2YA 2KHIA 5EBCA 3STBC 1NMFA 4LFCQ 5JPMC 1Q8KA 1XNQQ 3KLSA 1MJCA 3K80C 2Z4HA 1EEID 5IP9G 2PCFB 1VS0A 3H94A 4NXNQ 1BBWA 3T13A 2NB0A 4DV1L 4LF9L 1HFNA 2Z9HA 4E6IA 5M5WH 1Y8PB 1STNA 3MFYA 5EPJA 2FMMA 2A68C 1TWAB 3OTOQ 3JSBA 2K50A 4ZQ3A 1AW7A 1J9OA 1HNZL 4WRDA 4JVZA 4DXFA 3VDYA 4F8MA 2IX1A 2R6GA 1EUJA 1E1OA 2R7DA 3K6OA 3MXNA 4AQYQ 2DJGC 3FEWX 3QWNA 4DV2L 1ONLA 3X3MA 2F0OA 1NNXA 1D8LA 3C1FA 3PIOA 3RLFA 3VR5A 2PO4A 4A3DB 1VQIA 3I7FA 1F9QA 3A54A 4DGZA 2RHSB 2B39A 2F0JA 2NYZD 3OIPA 2JA6B 4PV1C 2O5IC 4A3IG 3SDZA 3IL8A 2NZOA 1WCMG 2CW0C 3HZXA 4HIDA 1Y1WB 4ZK9B 1KDCA 5LMNW 4Z7HA 4CKCA 4DNRB 4B3TQ 3S1RB 3NEMA 1GUNA 4O1OA 3B6YA 1K73C 2UXBQ 4JV5Q 4F88A 1LACA 3J80c 3FRPB 1Z47A 3VYRA 3PV0A 4DR6Q 3KUPA 2IHEA 2SEBD 1P16A 2X69A 4R9WA 1IBMQ 4IFDH 4AS2A 2I5HA 2JA5B 1EIFA 1EY7A 3PUZA 1MI2A 1QZGA 5FLXL 5A2QL 4NKLA 2XTRA 2HT1A 1GOZA 1ZEQX 1S5FD 4Z7GA 3BDLA 3T1HL 1PH3A 3OW7A 4QIWE 3RLOA 2QZGA 1VQ7A 3WDNA 1D1KA 1DXMA 3H91A 4GLAC 4RH6A 5IWAQ 3PO3B 2BL7A 4JI5Q 4RMFA 1BKBA 3S1NB 4HJ9A 1N36Q 4DV1Q 4LF9Q 3M4PA 1E2VA 1G8ZD 1H9JA 2EY2A 2N8NA 3VR2A 1QJOA 5GAHC 2AWNA 2F0LA 3M4OH 5LMUQ 3D3RA 5J22A 1HTPA 3A56A 4ZAIA 2UUAL 2L55A 2HHHQ 3WOEA 2D5DA 1GM5A 1B44D 3JAML 3A7AB 4WFN3 3M7GA 1DOLA 1W6KA 2F0VA 4N8FA 1BF4A 1MGSA 4LW1A 2NN6G 2KA7A 4HMJA 4KD3A 4KI0A 3F2BA 3M3YB 2KOLA 1QUQA 5ELNA 2DGYA 2ZXPA 1M90C 4K5VA 3KDFA 2JA9A 4DK3C 3W3AA 5M3FG 1UE1A 4OELB 3FKIH 1UEAB 2OXPA 3AJFA 5KNDA 1D6EC 3K81C 1E3PA 4NXNL 1UAPA 1RJTA 4G7ZC 1EQTA 1NTGA 1GO3E 4G75A 1PTOC 4LMQD 3DA3A 1CQFA 3CCUA 1STAA 4CJ0B 4IUVA 1MSHA 1GD7A 3KJPA 1MD2D 3S15H 3P23A 2HIVA 3KF6B 3CHBD 4S3SA 2PW7A 2XN9C 4B3RQ 3K5LA 3I8ZA 1FJGQ 4HR7B 2JA6H 3ER0A 2JSOA 4B3SQ 4M1UB 3H3VI 2R3ZA 1Z6HA 4XQJA 4WJ4A 2NVXB 5C6AA 1SDFA 4IOAA 1GJXA 1EU4A 1G6ZA 5FO9B 3CC2A 4KV6A 2C35B 2FMCA 1QNKA 1KDBA 1YHAA 4PMBA 4R8NA 5M3MH 3JAMi 2EZVA 2WFWA 5AJ3L 3PCOB 3MXNB 4XXEA 1EL0A 1GUGA 4LUOA 1YJNA 4BY7G 2Y0SG 2A8VA 4L5QA 3RZDH 3A74A 4HAEA 3E5SA 4C3JH 4ZYSA 2K33A 1OO9B 2JAEA 4XYOA 4A3JB 2DJFC 3W2DA 3UE1A 5IP9H 5ISRA 1TS3A 4X65L 3SHLA 5FO7B 3LWUA 3V2TA 1SSOA 2ZJRA 1QVGA 3CRLC 3NWSA 1MJEA 5C0XI 1EYDA 4MN3A 4JI3L 1X32A 3BZDB 3OYYA 1IYVA 4J6HA 4H13C 3I4LA 2EXDA 2NVYB 1QILA 4DV3L 1VMCA 5G3LD 1UE7A 1LT5D 1LLRD 4OO1I 3I70A 5IWAL 1ENFA 4LUZA 4BBRB 4LF6Q 5HGTA 3H15A 5IYBH 2YTYA 2UUBL 3J81c 4O1PA 4YCVA 3NUCA 3T1HQ 1JB3A 2K14A 1VQBA 1QWYA 4DR5L 3HOZG 1RL2A 3G6EA 1EIGA 4P74A 4YHHQ 1FGUA 4QF4A 3HFZB 3K0XA 1LTGD 5HY6A 5DLQE 2K7VA 1JR0D 2H5XA 3J7ZC 1Z9FA 2EJGC 3KP9A 1N33L 4ZLTF 1KAAA 1II3A 1YHQA 2F0KA 3OPOA 4MNOA 1XNRQ 3HOWG 2G5DA 2D2CC 3S24A 1Y8OB 4DF7A 2B2UC 1YIJA 2NVQB 3NSWA 4RAUC 4TSSA 3S2HB 4KN4C 4YWKA 4OAVB 3D6WA 1Q8IA 1H9SB 2F0TA 1TWCB 2QF7A 4K2LA 4OX9Q 2SDFA 1VCIA 1YI2A 3SK5A 4C2MB 2UXCL 1KHIA 3NK9A 4QJFA 4DNTB 2J7ZA 2B2TC 5IGCA 4PMCA 1PRTC 1VQ4A 3RUZA 4BWGB 1H9SA 3GTKH 3EBEA 1KAWA 2AQ1B 1SMYC 3M9BA 4A3MB 4FVMA 2MJFB 1PA6A 2MPMA 1A6XA 3F2UA 3K59A 3K7AH 2R93B 4GN5A 3HKZB 3KYHC 4RG1A 4GZYC 3ITPA 2JB1A 3MAQA 4ZCKA 1YNJC 4PL4A 4HFVA 1YHBA 1SE2A 1SE3A 4KJOA 2VQFL 2B2YC 4DUZQ 1Z7TA 1TWFH 2LS01 1O7IA 2K5DA 1PDQA 3QB3A 3DMUA 2MNAA 5A2QE 1PV4A 1WTRA 1IYUA 1BO0A 5IE8A 1AN8A 1M1KC 2ZRRA 1EWIA 5C4XG 5JJLA 5C4XB 2EYJA 4YHHL 4KTAA 1ASZA 1HFGA 5M3FB 1WD0A 5FLMG 2D0PA 2F0UA 5FKAC 4DV0Q 4EQ5A 5FO8B 4Q0FA 1ZYRD 4FF4A 3ND8A 5C4HA 4RWSC 3W1BA 4BA2I 3E0EA 1BCPC 3PUVA 3CCRA 1HA6A 1L1OB 3CC7A 3H6MA 2E74C 1BCPD 5IYDG 4A3CH 1VQ5A 2F0WA 1I4HA 1HR0L 2JQOA 4JI3Q 2EY6A 2F3VA 4DPGA 3HOWB 1SYCA 1K28A 1PLFA 4K8JA 5JAVA 1A15A 4XYQA 2A6ED 2F0EA 1V9PA 3CXCA 4A3JH 1DCZA 2LFNA 4DR3Q 3A8IE 4IPDA 1KRTA 1EEFD 1KD1C 2X6LA 4A3BB 1UWVA 3TEHB 1PH2A 1LTID 4BBSH 1E0BA 1NAPA 4C3HG 3GTMB 3TP6A 4A3MH 2CWAA 3PSIA 5COYA 3ERSX 4ZUJA 2RDGA 5C5LA 2CAZB 4JI2Q 4JG2A 3SK4A 1BCPB 1GVPA 2VW9A 2VUMB 5M5YB 3DEOA 2GVBA 3T56B 2EYFA 3P75A 5KIXA 5BR8L 4JI4L 2KVMA 3K0YA 4QQBX 4K5WA 4HIMA 2Q2UA 2G9HD 1X56A 2E75C 3FP9A 3TP5A 2Z0SA 2JP1A 1JOOA 3BU2A 5CC4A 1VQNA 1HR0Q 1Q7YC 1KDAA 1IBKQ 4IJHA 3HKZE 3I91A 4NDXA 2QGMA 1IYJB 4PZ6A 1LT6D 4IJLA 3QJYA 2I07B 4PQXA 2ZM6Q 3HOVB 1NSNS 3F4MA 1V1PB 1GHJA 3CQZH 2EDGA 1TWCH 4EQNA 3U50C 2I5MX 3M85A 1VQPA 3IAM1 1B53A 1F77A 2DN8A 3OMCA 5EBDA 5EKLA 3GTPH 1EZ8A 4A4IA 5IGGA 1Q86C 2F1MA 4GOPA 4U6RA 4GKKL 3F1ZA 1XMQL 1EZ6A 2A19A 3S14H 1EY8A 3TSSA 5I4DA 1JOQA 1PFBA 4O1NA 4GKKQ 4U673 4P2CB 5BN4A 1VQGA 1RCVD 1TT2A 2F0NA 1BCPF 3GQBA 2KECA 2F0QA 4DV0L 3K7UC 2K6AA 5I9OA 2LXKA 1PYSB 3D8GA 2HQLA 5CBAE 3AFQA 1FNVA 5GQOA 3D4DA 5GAGC 1X55A 3AMUA 4GNXB 2NBFA 4RCNA 1AEXA 5C0XH 4OO1G 2WB1B 4O2DA 2O4XA 1LTBD 2SNMA 3FHWA 4GLVB 3S2DB 1V1QA 1NJIC 4FF3A 4FXKC 1SFOB 1ENCA 3NTKA 1W2BA 2AUKA 1YNJD 1V1PA 3J7AV 3A8KE 5AFWA 4ID6A 4L8JA 3RZDB 4JI0Q 4RGMA 2JBWA 1G291 2MJ8A 4JI1Q 2F6MB 5IY0A 5F2DA 2UUCL 1TDPA 3MWYW 4KKUA 4CJ1B 2IW3A 2RDFA 2DY8A 1R9TH 1CHQD 3KFUA 1JWUD 2LMCB 2B29A 2XNAC 4CDFC 1KTKA 1FJGL 2TSSA 1N33Q 3KOJA 4TVAB 1CT1D 3GTQB 3LJ0A 4OEMB 4DR2L 3HOVG 5E4WC 1HA5A 2UXBL 4N9TA 1WTWA 1SE4A 4UP7A 4I1TA 3JC66
chains in the Genus database with same CATH topology
3PUXA 1LTLA 1QZGA 3CW2C 3S1QH 4Y7NH 2NVXH 3G48A 3S17H 4PL5A 2XTRA 2A2DA 2E5LL 1L1OC 2AMCB 2KHJA 1RIPA 2HT1A 5IYDH 4Z7GA 3UDXA 4AYBE 3T1HL 1Y1WG 1PH3A 3PGZA 4QIWE 3RLOA 1VQ7A 1KL9A 4DV6L 2ZTDA 1JB7A 2Q2TA 4JBKA 4GLAC 1K9MC 5IWAQ 2Q2HA 4JI5Q 4NV2A 4RMFA 1YBYA 4QGUA 1BKBA 1QVCA 2JB3A 2IT1A 3W1GA 1SFOH 4K0KQ 1XTDA 2VS1A 4HJ9A 3RLNA 1N36Q 3SDJA 4DV1Q 3F8TA 4LF9Q 3M4PA 4LUVA 3KF8B 4GN4B 3S1NH 2N8NA 2KKMA 4P73A 4MZ9A 3RN5A 4P71A 5GAHC 2OWOA 4KHPQ 2AWNA 2F3IA 3M4OH 5LMUQ 2P22B 4BBSG 5IYBG 1IBLL 2BH8A 4HIOA 5M5XH 2YU9H 3I56A 1FVIA 2UUAL 3I55A 1IL2A 3RZOH 4X65Q 5IT9c 1TXYA 3L0OA 4PZ8A 1EQQA 3A5ZB 4LFCL 4YY3Q 1SE8A 3CPFA 1HNXQ 4DR5Q 2MFIA 1GM5A 3HKSA 4KHZA 1L0WA 1X9NA 3PF4A 2N49A 2XTQA 4R4TA 1HZBA 4Q9VA 2E2HH 3TRZA 1X54A 4LW1A 2HHHL 2NN6G 3CCMA 5EAYA 2A2CA 1H95A 1J5EL 2CCZA 1C0AA 1TWAH 1CSQA 1VQAA 4KI0A 4LWCA 1K3RA 3J81j 3F2BA 1IBLQ 3HOUG 1AH9A 1QUQA 5ELNA 4AIMA 1VQMA 2DGYA 5C44H 3PIPA 5LMUL 2JA5H 4UP8A 4KHPL 4ME3A 3I2ZA 1M90C 3IAS1 2D0OA 3GTOH 3KDFA 3M3YH 2JA9A 3JAMc 4DK3C 3AYHB 5M3FG 1UE1A 1CKNA 1I94Q 4IPHA 4R4QA 3FKIH 2VNUD 2IY5B 2JEBI 4X66L 4YZ9A 1KXLA 2PI2E 3AJFA 3K81C 1E3PA 4NXNL 1YEZA 3S2DH 5LMNL 4AH6A 2BA1A 5AJ3Q 1A0IA 1SJ8A 1VQLA 3I9V1 4X64Q 1HZ9A 1NTGA 3CCJA 1YJWA 1GO3E 4G75A 5E7NA 1B70B 4POGA 4H02A 2V6EA 3DA3A 4QL5A 3CCUA 1N32Q 1GD7A 2R92G 4JI2L 3KJPA 2VZAA 4LF8L 3S15H 3P23A 2HIVA 3KF6B 3DO9A 4A3DH 4A93G 2F66B 4A76A 2UXDQ 1XPOA 2QA4A 3GTLH 3J7A5 4B3RQ 4DR6L 1Y1VG 1FJGQ 5H1SE 4LF4Q 4IFDG 4NB3A 2JA6H 4DR3L 3ER0A 5FLXc 4B3SQ 3H3VI 4JYAQ 2JA8H 4WJ4A 3I4OA 1LM0A 1EOVA 3DM3A 1WJJA 4JI0L 3OW2A 4EX5A 2Z6KC 3J81i 2ES2A 2KCMA 2ALYB 1EIYB 1FL0A 4DAMA 2JA5G 2JB2A 1XNRL 3CC2A 2VQEL 4DUYL 4LF5Q 3HOZH 4C3IH 1TWGH 4DV5Q 1CKOA 1NBWA 2C35B 3W5OA 1YHAA 4B3SL 5M3MH 2L1LB 3JAMi 1Q1BA 2WFWA 3PCOB 5AJ3L 1I94L 3MXNB 4DV7Q 3DA4A 1JJCB 1Y1WH 4B3RL 4JI6Q 4A3FH 1SMXA 4LUOA 1YJNA 4BY7G 4IPGA 2Y0SG 3I4NG 2R7FA 3CP0A 4L5QA 4YWMA 4DV4Q 1EYGA 3RZDH 3A74A 4OWTB 3RNUA 4JI7Q 1CKNB 4OAUC 3CCLA 1Q12A 4C3JH 1X6OA 2JAEA 2AHOB 4DR7L 4A3KH 2F52A 4DWLA 2YYZA 1I5FA 3UE1A 5IP9H 2OTLA 2ASBA 4X65L 5C0XJ 1J6QA 1SROA 5JJIA 4XIGS 4LFAL 4PG3A 3HOWH 1PYBA 3LGJA 3UE0A 2ZJRA 5LMNQ 1QVGA 1JMCA 1VQ8A 1MJEA 3NBHB 2Z6KA 2JJQA 5C0XI 4ALPA 4LF6L 2XTIA 4JI3L 3CCSA 3OYYA 1IZ6A 2MQHA 2E8GA 4HIKA 2OCEA 2EXDA 4DV3L 3M4QA 1CKMA 1UE5A 1GKHA 2JA6G 2E2IH 4DUZL 3IRBA 4GKJQ 4A3MG 1UE7A 2VQFQ 4GOPC 3S1RH 1XMQQ 4OO1I 4A3LG 1JE5A 2WB1G 4JI5L 3M7NA 4BBRG 5IWAL 3FBVA 4LUZA 1QUQB 2RHQB 4LF6Q 5C44G 1SRUA 3H15A 2NVTH 5IYBH 3PO3H 2YTYA 2QEXA 4LFAQ 2ATWA 1S3OA 1XPUA 2K5NA 2UUBL 3TQYA 4O1PA 3GDEA 4MTNA 4YCVA 4YZDA 4YCWA 3ULLA 3J81c 3HOXH 4DR1L 3T1HQ 1J5EQ 3I4MH 3TS2A 4GKJL 4A3LH 1Y14B 2BH2A 1KRSA 2K14A 1OXUA 1KIXA 3CC4A 1VQBA 5GAEC 3KJOA 4DR5L 3HOZG 1RL2A 3SGIA 3G6EA 4P74A 4R1JA 1Q1EA 4YHHQ 5IYCG 2B63H 2UUAQ 3I4NH 1FGUA 3HFZB 3K0XA 5HY6A 5DLQE 3L0IA 2KENA 2NZHA 2ZM6L 2OQKA 3CF5A 5LNK1 2H5XA 5C3EG 3J7ZC 4LFBL 2HHHQ 1Z9FA 4BY1H 1HZCA 3J80i 3H3VH 1L1OA 4JCVE 3KP9A 2K52A 4JBJA 1N33L 2R93G 3FKIG 2CQOA 2K75A 1AE2A 1IBKL 4L5RC 1YHQA 5JJKA 4UPAA 1DGSA 2UXCQ 1B7YB 1SLJA 4MNOA 1K8AC 1XNRQ 3HOWG 2FUG1 3PUWA 3CMEA 3PO2H 3S24A 4J15A 1VQ6A 4DV6Q 3KLWA 1YIJA 4FDBA 1N8RC 3AQQA 5ELOA 5M5YH 2VUMH 5BR8Q 4UP9A 1OXTA 1OXXK 1Y1VH 4JI1L 4YWKA 4OAVB 4HJ5A 1PH9A 4A3BG 4LF4L 3GTGH 4IOCA 3PF5A 1N9WA 4WJ3M 4O0AA 3H0GH 2PNHA 4OWWB 1MKHA 3TREA 1XPRA 4LF5L 3GTMH 3ULPA 4OX9Q 3GO5A 1LYLA 1VCIA 1YI2A 5JEAJ 1MIUA 1U0LA 2UXCL 1KHIA 5FLMH 2UU9L 4NV5A 4QJFA 4HJ7A 1VQHA 4PZ7A 4GXTA 3HOVH 2PI2A 2F4VQ 3HOUH 4R4IA 3CCEA 3LJ1A 3RR5A 4DR4Q 1A62A 4AQYL 2RIOA 1VQ4A 1Q82C 2ZTCA 3HOXG 2F4VL 2UXDL 4X64L 2UU9Q 1CSPA 5IYCH 1QVFA 3EBEA 1VQOA 2B63G 3GTKH 1KAWA 1G6PA 1E1TA 3M9BA 1CUKA 2B3GA 4OX9L 1A63A 2MJFB 1G51A 1OXVA 1PA6A 1QZHA 1K0RA 4A3EH 4P72A 4OXPA 1XMOQ 5M3MG 3K7AH 4XTCS 4NPSA 4GN5A 3KYHC 4YZCA 4RG1A 5C3EH 4IFDI 2YTXA 4A3JG 2R93H 2JB1A 3HOYH 5HGIA 3PUYA 4DKAC 3PO2G 2K4KA 4PL4A 1JJGA 4PMWA 4HFVA 1YHBA 2MO0A 1PH7A 1N34Q 1EFWA 4KLKA 3K8AA 2VQFL 2XGTA 1XJVA 1Q81C 4TQUS 4DUZQ 1KC8C 2CFMA 4IPCA 1K8GA 4LNQA 4A3BH 1TWFH 3A5UA 1O7IA 2CWPA 4DV3Q 2MNAA 4A3KG 4YCUA 2AWOA 1PV4A 2A8VA 4DNIA 4LFBQ 3NENA 4YY3L 3T1YL 4HJAA 4A3IH 2PQAB 5IE8A 3UDGA 4B3MQ 1M1KC 2ZRRA 4A93H 3S16H 4G76A 1EWIA 5C4XG 2WP8J 1X3GA 5JJLA 3KDFB 4YHHL 1PH6A 2AKWB 3T1YQ 2JE6I 3TS0A 4GLXA 3E9IA 1ASZA 4POFA 3GTJH 2JK8A 2WAQG 3LJ2A 3F2CA 2LSSA 1LUZA 5FLMG 2D0PA 1E22A 3RN2A 1S72A 1HNXL 4L5TA 1YO7A 4DR1Q 2RCNA 5M3FH 4DV0Q 2D62A 4GNXA 4EQ5A 4X62Q 3OTOL 1SR3A 1I3QH 2Y0SE 1C7YA 1K83H 4JBWA 1OXSC 5HGQA 4JI8L 1E24A 2KCTA 4A3FG 1HH2P 3W1BA 4BA2I 3EN2A 3STBD 4BXXG 3E0EA 3CCRA 3PUVA 2LXJA 4PL3A 3CPWA 4R4CA 1L1OB 3EIVA 3CC7A 1L2FA 1N36L 5IYDG 1N33Q 4A3CH 1X65A 3L7ZC 1I6HH 1XMOL 2OQ0A 1VQ5A 1WFQA 1HR0L 3BZCA 4JI3Q 2EIFA 2JQOA 4X6AH 4DPGA 4HJ8A 1I50H 2NN6I 4JOIA 2L15A 1VQEA 3ICEA 5FJ8G 1X3FA 4GS3A 1V9PA 1PH8A 3CXCA 3CAMA 4P75A 4A3JH 4OWXB 2R7ZH 4DR3Q 1PFSA 5GROA 1YITA 2PMZE 4DR2Q 1IBML 3A0JA 4IPDA 1KRTA 1KD1C 1P8LA 2QGQA 2ZJPA 4DR7Q 2K5HA 3H0GG 1UWVA 1WOCA 4DK6C 4YWLA 2K19A 3TEHB 4DV7L 1PH2A 1HR0W 4UY8C 3ZJYC 2R7ZG 4BBSH 4DV4L 4B3TL 1HNWQ 4R4OA 4A3MH 2JA8G 2CWAA 3PSIA 2N3SA 3ERSX 4JI2Q 3CCQA 4LF7Q 2CAZB 1EQRA 4A3GG 4JG2A 4AS3A 1GVPA 2VW9A 4BBRH 4GNXC 1YNXA 1C9OA 2GVBA 2MO1A 1JJ2A 2IX0A 1WCMH 3BZKA 1Q46A 4IO9A 5BR8L 3NELA 4JI4L 4JV5L 4DV5L 3ULJA 3F2DA 4OONA 4A3GH 4HIMA 4QQBX 2VQEQ 4DUYQ 2YTVA 2Q2UA 3VA9A 1X56A 1YVCA 3FP9A 2FXQA 4GOPB 2Z0SA 3GD7A 3BU2A 1U5KA 1VQDA 4GN3B 1VQNA 1HR0Q 1Q7YC 3AEVA 1BBUA 2V1CC 1IBKQ 2UUCQ 4IJHA 4BXXH 4DAYB 3HKZE 4X66Q 3UDIA 2IHFA 4DV2Q 2ID0A 3HKZG 5IP7H 1YJ9A 2JA7H 1IYJB 1VQJA 4JOIC 3G71A 4PZ6A 2E2JH 1NMGA 4IJLA 2GVAA 4LF7L 2YFBA 3HOYG 1AE3A 2ZM6Q 1KQSA 5C0XG 1SN8A 5J3BA 1VQFA 2NVQH 5IP7G 2JA7G 2HIXA 3F4MA 4JC0A 3CQZH 4LF8Q 3DLLA 1TWCH 2I5LX 5C4JH 3U50C 4BY7H 4HEA1 4BA1I 2KHIA 2I5MX 3M85A 1N32L 1HNZQ 1VQPA 3IAM1 5JEAG 3STBC 1NMFA 1PH5A 4LFCQ 3UITA 1S40A 2ZTEA 4NXML 3S2HH 2VUMG 1Q8KA 1XNQQ 1MJCA 3K80C 3GTPH 4B3ML 5C4XH 4A4IA 1Q86C 4A75A 4GOPA 4U6RA 2RF4A 2R92H 2GN5A 5IP9G 1VS0A 2WB1E 2I0QA 4NXNQ 1BBWA 3U4VA 3F1ZA 4GKKL 1XMQL 4APVA 1UEBA 2A19A 4DV1L 4LF9L 3S14H 5M5WH 1VQ9A 3D31A 1D7QA 1OTCA 4C2MH 4GKKQ 3U58A 2UUBQ 3I4MG 1HZAA 1N34L 4JI8Q 2EQSA 1VQGA 1PH1A 1JT8A 4X62L 3OTOQ 1PH4A 3JSBA 4JBMA 2KBNA 2K50A 1XNQL 1E7ZA 4DV0L 1VQKA 3K7UC 2LXKA 1PYSB 1VQCA 3WWVA 2HQLA 3AFQA 1HNZL 3PO3G 5GQOA 2ZJQA 1WYDA 1B8AA 2DUDA 3AFPA 5GAGC 1X55A 3VDYA 4BY1G 4GNXB 2IX1A 2R6GA 1NY4A 4IOAA 1EUJA 5GADC 2YFAA 2CKZB 3UDFA 1WI5A 4JI7L 1E1OA 4OO1G 2JEAI 2R7DA 4O2DA 2A1AA 3CCVA 2XMXA 4NXMQ 5K36G 2OTJA 4QY7A 1NE3A 3FHWA 4GLVB 1V1QA 1NJIC 4AQYQ 3BJUA 4DR4L 1HJPA 1V43A 4A3CG 1T9HA 2Q2IA 4DV2L 4L5SA 4K0KL 1D8LA 1W2BA 3PIOA 3RLFA 3E9HA 3U4ZA 3KF6A 3L2PA 1PHJA 1BVSA 1VQIA 2VY3A 1ASYA 3I7FA 3Q8DA 4A3DG 1YZ6A 5FJ8H 2RHSB 3CD6A 2PQAA 2BA0A 4JI0Q 4JI6L 4JI4Q 2N78A 4A3IG 1G291 4AYBG 2NZOA 1WCMG 4JI1Q 2F6MB 5IY0A 2UUCL 4IFDJ 4HIDA 2E5LQ 3D0FA 1X3EA 4Y52H 5LMNW 4Z7HA 1TWHH 1PVOA 1R9TH 4B3TQ 1HNWL 3NEMA 4O1OA 3MEFA 2IP6A 3B6YA 4C3HH 3KFUA 1K73C 2UXBQ 4JV5Q 2B29A 2NVYH 3G4SA 4A3EG 3GTQH 4JYAL 3J80c 1Z47A 1FJGL 2YV5A 3PV0A 2VL6A 2WAQE 1IXRA 3KOJA 2IHEA 4TVAB 2K5VA 3CMAA 1P16A 4DR6Q 1IBMQ 3LJ0A 4AS2A 4DR2L 2I5HA 1W3SA 1UE6A 3HOVG 2UXBL 1EIFA 1A8VA 3S1MH 4UP7A 3PUZA 4I1TA 3JC66
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUX A;  1LTL A;  1QZG A;  3CW2 C;  3S1Q H;  4Y7N H;  2NVX H;  3S17 H;  2E5L L;  1L1O C;  2AMC B;  2KHJ A;  1RIP A;  2HT1 A;  5IYD H;  3UDX A;  4AYB E;  3T1H L;  1Y1W G;  1PH3 A;  3PGZ A;  4QIW E;  3RLO A;  1VQ7 A;  1KL9 A;  4DV6 L;  2ZTD A;  1JB7 A;  2Q2T A;  4JBK A;  4GLA C;  1K9M C;  5IWA Q;  2Q2H A;  4JI5 Q;  4RMF A;  1YBY A;  4QGU A;  1BKB A;  1QVC A;  2IT1 A;  3W1G A;  1SFO H;  4K0K Q;  1XTD A;  2VS1 A;  4HJ9 A;  3RLN A;  1N36 Q;  4DV1 Q;  3F8T A;  4LF9 Q;  3M4P A;  4LUV A;  3KF8 B;  4GN4 B;  3S1N H;  2N8N A;  4P73 A;  4MZ9 A;  3RN5 A;  4P71 A;  5GAH C;  2OWO A;  4KHP Q;  2AWN A;  2F3I A;  3M4O H;  5LMU Q;  4BBS G;  5IYB G;  1IBL L;  2BH8 A;  4HIO A;  5M5X H;  2YU9 H;  3I56 A;  1FVI A;  2UUA L;  3I55 A;  1IL2 A;  3RZO H;  4X65 Q;  5IT9 c;  1TXY A;  3L0O A;  4PZ8 A;  1EQQ A;  3A5Z B;  4LFC L;  4YY3 Q;  1SE8 A;  3CPF A;  1HNX Q;  4DR5 Q;  2MFI A;  1GM5 A;  3HKS A;  4KHZ A;  1L0W A;  1X9N A;  3PF4 A;  2N49 A;  4R4T A;  1HZB A;  2E2H H;  3TRZ A;  1X54 A;  4LW1 A;  2HHH L;  2NN6 G;  3CCM A;  5EAY A;  1H95 A;  1J5E L;  2CCZ A;  1C0A A;  1TWA H;  1CSQ A;  1VQA A;  4KI0 A;  4LWC A;  1K3R A;  3J81 j;  3F2B A;  1IBL Q;  3HOU G;  1AH9 A;  1QUQ A;  5ELN A;  4AIM A;  1VQM A;  2DGY A;  5C44 H;  3PIP A;  5LMU L;  2JA5 H;  4UP8 A;  4KHP L;  4ME3 A;  3I2Z A;  1M90 C;  2D0O A;  3GTO H;  3M3Y H;  3KDF A;  2JA9 A;  3JAM c;  4DK3 C;  3AYH B;  5M3F G;  1UE1 A;  1CKN A;  1I94 Q;  4IPH A;  4R4Q A;  3FKI H;  2VNU D;  2IY5 B;  2JEB I;  4X66 L;  1KXL A;  2PI2 E;  3K81 C;  1E3P A;  4NXN L;  1YEZ A;  3S2D H;  5LMN L;  4AH6 A;  2BA1 A;  5AJ3 Q;  1A0I A;  1VQL A;  4X64 Q;  1HZ9 A;  1NTG A;  3CCJ A;  1YJW A;  1GO3 E;  5E7N A;  1B70 B;  4POG A;  4H02 A;  4QL5 A;  3CCU A;  1N32 Q;  1GD7 A;  2R92 G;  4JI2 L;  3KJP A;  2VZA A;  4LF8 L;  3S15 H;  2HIV A;  3KF6 B;  4A3D H;  4A93 G;  4A76 A;  2UXD Q;  1XPO A;  2QA4 A;  3GTL H;  3J7A 5;  4B3R Q;  4DR6 L;  1Y1V G;  1FJG Q;  5H1S E;  4LF4 Q;  4IFD G;  4NB3 A;  2JA6 H;  4DR3 L;  3ER0 A;  5FLX c;  4B3S Q;  3H3V I;  4JYA Q;  2JA8 H;  4WJ4 A;  3I4O A;  1LM0 A;  1EOV A;  3DM3 A;  1WJJ A;  4JI0 L;  3OW2 A;  4EX5 A;  2Z6K C;  3J81 i;  2ES2 A;  2ALY B;  2KCM A;  1EIY B;  1FL0 A;  4DAM A;  2JA5 G;  1XNR L;  4IOA A;  3CC2 A;  2VQE L;  4DUY L;  4LF5 Q;  3HOZ H;  4C3I H;  1TWG H;  4DV5 Q;  1CKO A;  1NBW A;  2C35 B;  3W5O A;  1YHA A;  4B3S L;  5M3M H;  3JAM i;  2WFW A;  1Q1B A;  3PCO B;  5AJ3 L;  1I94 L;  3MXN B;  4DV7 Q;  1JJC B;  1Y1W H;  4B3R L;  4JI6 Q;  4A3F H;  1SMX A;  4LUO A;  1YJN A;  4BY7 G;  4IPG A;  2Y0S G;  3I4N G;  2R7F A;  3CP0 A;  4L5Q A;  4YWM A;  4DV4 Q;  1EYG A;  3RZD H;  3A74 A;  4OWT B;  3RNU A;  4JI7 Q;  1CKN B;  3CCL A;  1Q12 A;  4C3J H;  1X6O A;  2AHO B;  4DR7 L;  4A3K H;  2F52 A;  2YYZ A;  1I5F A;  3UE1 A;  5IP9 H;  2OTL A;  2ASB A;  4X65 L;  5C0X J;  1J6Q A;  1SRO A;  5JJI A;  4XIG S;  4LFA L;  4PG3 A;  3HOW H;  1PYB A;  3LGJ A;  3UE0 A;  2ZJR A;  5LMN Q;  1QVG A;  1JMC A;  1VQ8 A;  1MJE A;  3NBH B;  2Z6K A;  2JJQ A;  5C0X I;  4ALP A;  4LF6 L;  2XTI A;  4JI3 L;  3CCS A;  3OYY A;  1IZ6 A;  2MQH A;  2E8G A;  4HIK A;  2OCE A;  2EXD A;  4DV3 L;  3M4Q A;  1CKM A;  1UE5 A;  1GKH A;  2JA6 G;  2E2I H;  4DUZ L;  3IRB A;  4GKJ Q;  4A3M G;  1UE7 A;  2VQF Q;  1XMQ Q;  3S1R H;  4OO1 I;  4A3L G;  1JE5 A;  2WB1 G;  4JI5 L;  3M7N A;  4BBR G;  5IWA L;  4LUZ A;  1QUQ B;  2RHQ B;  4LF6 Q;  5C44 G;  1SRU A;  3H15 A;  2NVT H;  5IYB H;  3PO3 H;  2YTY A;  2QEX A;  4LFA Q;  2ATW A;  1S3O A;  1XPU A;  2K5N A;  2UUB L;  3TQY A;  3GDE A;  4MTN A;  3J81 c;  4YCV A;  3ULL A;  4YCW A;  3HOX H;  4DR1 L;  4GOP C;  3T1H Q;  1J5E Q;  3I4M H;  3TS2 A;  4A3L H;  4GKJ L;  1Y14 B;  2BH2 A;  1KRS A;  2K14 A;  1OXU A;  1KIX A;  3CC4 A;  1VQB A;  5GAE C;  3KJO A;  4DR5 L;  3HOZ G;  1RL2 A;  3SGI A;  3G6E A;  4P74 A;  4R1J A;  1Q1E A;  4YHH Q;  5IYC G;  2B63 H;  2UUA Q;  3I4N H;  1FGU A;  3HFZ B;  3K0X A;  5HY6 A;  5DLQ E;  2KEN A;  2NZH A;  2ZM6 L;  2OQK A;  3CF5 A;  2H5X A;  5C3E G;  3J7Z C;  4LFB L;  2HHH Q;  1Z9F A;  4BY1 H;  1HZC A;  3J80 i;  3H3V H;  1L1O A;  4JCV E;  2K52 A;  4JBJ A;  1N33 L;  2R93 G;  3FKI G;  2CQO A;  2K75 A;  1AE2 A;  1IBK L;  4L5R C;  1YHQ A;  5JJK A;  4UPA A;  1DGS A;  2UXC Q;  1B7Y B;  1SLJ A;  4MNO A;  1K8A C;  1XNR Q;  3HOW G;  3PUW A;  3CME A;  3PO2 H;  3S24 A;  4J15 A;  1VQ6 A;  4DV6 Q;  3KLW A;  1YIJ A;  4FDB A;  1N8R C;  3AQQ A;  5ELO A;  5M5Y H;  2VUM H;  5BR8 Q;  4UP9 A;  1OXT A;  1OXX K;  1Y1V H;  4JI1 L;  4YWK A;  4HJ5 A;  1PH9 A;  4A3B G;  4LF4 L;  3GTG H;  4IOC A;  3PF5 A;  1N9W A;  4WJ3 M;  4O0A A;  3H0G H;  2PNH A;  4OWW B;  1MKH A;  3TRE A;  1XPR A;  4LF5 L;  3GTM H;  3ULP A;  4OX9 Q;  3GO5 A;  1LYL A;  1VCI A;  1YI2 A;  5JEA J;  1MIU A;  1U0L A;  2UXC L;  1KHI A;  5FLM H;  2UU9 L;  4HJ7 A;  4QJF A;  1VQH A;  4PZ7 A;  3HOV H;  2PI2 A;  2F4V Q;  3HOU H;  4R4I A;  3CCE A;  3RR5 A;  4DR4 Q;  1A62 A;  4AQY L;  1VQ4 A;  1Q82 C;  2ZTC A;  3HOX G;  2F4V L;  2UXD L;  4X64 L;  2UU9 Q;  1CSP A;  5IYC H;  1QVF A;  3EBE A;  1VQO A;  2B63 G;  3GTK H;  1KAW A;  1G6P A;  1E1T A;  3M9B A;  1CUK A;  2B3G A;  4OX9 L;  1A63 A;  1G51 A;  1OXV A;  1PA6 A;  1QZH A;  1K0R A;  4A3E H;  4P72 A;  4OXP A;  1XMO Q;  5M3M G;  3K7A H;  4XTC S;  4NPS A;  4GN5 A;  3KYH C;  4RG1 A;  5C3E H;  4IFD I;  2YTX A;  4A3J G;  2R93 H;  3HOY H;  3PUY A;  4DKA C;  3PO2 G;  2K4K A;  1JJG A;  4PMW A;  2MO0 A;  1YHB A;  1PH7 A;  1N34 Q;  1EFW A;  4KLK A;  3K8A A;  2VQF L;  2XGT A;  1XJV A;  1Q81 C;  4TQU S;  4DUZ Q;  1KC8 C;  2CFM A;  4IPC A;  1K8G A;  4LNQ A;  4A3B H;  1TWF H;  3A5U A;  1O7I A;  2CWP A;  4DV3 Q;  2MNA A;  4A3K G;  4YCU A;  2AWO A;  1PV4 A;  2A8V A;  4DNI A;  4LFB Q;  3NEN A;  4YY3 L;  3T1Y L;  4HJA A;  4A3I H;  2PQA B;  5IE8 A;  3UDG A;  4B3M Q;  1M1K C;  4A93 H;  3S16 H;  1EWI A;  5C4X G;  2WP8 J;  1X3G A;  5JJL A;  3KDF B;  4YHH L;  1PH6 A;  2AKW B;  3T1Y Q;  2JE6 I;  3TS0 A;  4GLX A;  3E9I A;  1ASZ A;  4POF A;  3GTJ H;  2JK8 A;  2WAQ G;  3F2C A;  2LSS A;  1LUZ A;  5FLM G;  2D0P A;  1E22 A;  3RN2 A;  1S72 A;  1HNX L;  4L5T A;  4DR1 Q;  2RCN A;  5M3F H;  4DV0 Q;  2D62 A;  4GNX A;  4EQ5 A;  4X62 Q;  3OTO L;  1SR3 A;  1I3Q H;  2Y0S E;  1C7Y A;  1K83 H;  4JBW A;  1OXS C;  5HGQ A;  4JI8 L;  1E24 A;  2KCT A;  4A3F G;  1HH2 P;  3W1B A;  4BA2 I;  3EN2 A;  3STB D;  4BXX G;  3E0E A;  3CCR A;  3PUV A;  2LXJ A;  3CPW A;  4DV7 L;  4R4C A;  1L1O B;  3EIV A;  3CC7 A;  1L2F A;  1N36 L;  5IYD G;  1N33 Q;  4A3C H;  1X65 A;  3L7Z C;  1I6H H;  1XMO L;  2OQ0 A;  1VQ5 A;  1WFQ A;  1HR0 L;  3BZC A;  4JI3 Q;  2EIF A;  2JQO A;  4X6A H;  4DPG A;  4HJ8 A;  1I50 H;  2NN6 I;  4JOI A;  2L15 A;  1VQE A;  3ICE A;  5FJ8 G;  1X3F A;  4GS3 A;  1V9P A;  1PH8 A;  3CXC A;  3CAM A;  4P75 A;  4A3J H;  4OWX B;  2R7Z H;  4DR3 Q;  1PFS A;  5GRO A;  1YIT A;  2PMZ E;  4DR2 Q;  1IBM L;  3A0J A;  4IPD A;  1KRT A;  1KD1 C;  1P8L A;  2QGQ A;  2ZJP A;  4DR7 Q;  2K5H A;  3H0G G;  1UWV A;  1WOC A;  4DK6 C;  4YWL A;  3TEH B;  1PH2 A;  1HR0 W;  2R7Z G;  4UY8 C;  3ZJY C;  4BBS H;  4DV4 L;  4B3T L;  1HNW Q;  4R4O A;  4A3M H;  2JA8 G;  2CWA A;  3PSI A;  2N3S A;  3ERS X;  4JI2 Q;  3CCQ A;  4LF7 Q;  1EQR A;  4A3G G;  4JG2 A;  1GVP A;  2VW9 A;  4BBR H;  4GNX C;  1YNX A;  1C9O A;  2GVB A;  2MO1 A;  1JJ2 A;  2IX0 A;  1WCM H;  3BZK A;  1Q46 A;  4IO9 A;  5BR8 L;  3NEL A;  4JI4 L;  4JV5 L;  4DV5 L;  3ULJ A;  3F2D A;  4OON A;  4A3G H;  4HIM A;  4QQB X;  2VQE Q;  4DUY Q;  2YTV A;  2Q2U A;  1X56 A;  3FP9 A;  1YVC A;  2FXQ A;  4GOP B;  2Z0S A;  3GD7 A;  3BU2 A;  1U5K A;  1VQD A;  4GN3 B;  1VQN A;  1HR0 Q;  1Q7Y C;  3AEV A;  1BBU A;  2V1C C;  1IBK Q;  2UUC Q;  4IJH A;  4BXX H;  4DAY B;  3HKZ E;  4X66 Q;  3UDI A;  2IHF A;  4DV2 Q;  2ID0 A;  3HKZ G;  5IP7 H;  1YJ9 A;  2JA7 H;  1IYJ B;  1VQJ A;  4JOI C;  3G71 A;  4PZ6 A;  2E2J H;  1NMG A;  4IJL A;  2GVA A;  4LF7 L;  3HOY G;  1AE3 A;  2ZM6 Q;  1KQS A;  5C0X G;  1SN8 A;  5J3B A;  1VQF A;  2NVQ H;  5IP7 G;  2JA7 G;  2HIX A;  4JC0 A;  3CQZ H;  4LF8 Q;  3DLL A;  1TWC H;  2I5L X;  5C4J H;  3U50 C;  4BY7 H;  4BA1 I;  2KHI A;  2I5M X;  3M85 A;  1N32 L;  1HNZ Q;  1VQP A;  5JEA G;  1PH5 A;  3STB C;  1NMF A;  4LFC Q;  1S40 A;  2ZTE A;  4NXM L;  3S2H H;  2VUM G;  1Q8K A;  1XNQ Q;  1MJC A;  3K80 C;  3GTP H;  4B3M L;  5C4X H;  4A4I A;  1Q86 C;  4A75 A;  4GOP A;  2RF4 A;  2R92 H;  2GN5 A;  5IP9 G;  1VS0 A;  2WB1 E;  2I0Q A;  4NXN Q;  1BBW A;  3U4V A;  3F1Z A;  4GKK L;  1XMQ L;  4APV A;  1UEB A;  2A19 A;  4DV1 L;  4LF9 L;  3S14 H;  5M5W H;  1VQ9 A;  3D31 A;  1D7Q A;  1OTC A;  4C2M H;  4GKK Q;  3U58 A;  2UUB Q;  3I4M G;  1HZA A;  1N34 L;  4JI8 Q;  2EQS A;  1VQG A;  1PH1 A;  1JT8 A;  4X62 L;  3OTO Q;  1PH4 A;  4JBM A;  2KBN A;  2K50 A;  1XNQ L;  1E7Z A;  4DV0 L;  1VQK A;  3K7U C;  2LXK A;  1PYS B;  1VQC A;  3WWV A;  2HQL A;  3AFQ A;  1HNZ L;  3PO3 G;  5GQO A;  2ZJQ A;  1WYD A;  1B8A A;  2DUD A;  3AFP A;  5GAG C;  1X55 A;  3VDY A;  4BY1 G;  4GNX B;  2IX1 A;  2R6G A;  1NY4 A;  1EUJ A;  5GAD C;  2CKZ B;  3UDF A;  1WI5 A;  4JI7 L;  1E1O A;  4OO1 G;  2JEA I;  2R7D A;  4O2D A;  2A1A A;  3CCV A;  5K36 G;  4NXM Q;  2OTJ A;  4QY7 A;  1NE3 A;  3FHW A;  4GLV B;  1V1Q A;  1NJI C;  4AQY Q;  3BJU A;  4DR4 L;  1HJP A;  1V43 A;  4A3C G;  1T9H A;  2Q2I A;  4DV2 L;  4L5S A;  4K0K L;  1D8L A;  1W2B A;  3PIO A;  3RLF A;  3E9H A;  3U4Z A;  3KF6 A;  3L2P A;  1PHJ A;  1BVS A;  1VQI A;  2VY3 A;  1ASY A;  3I7F A;  3Q8D A;  4A3D G;  1YZ6 A;  5FJ8 H;  2RHS B;  3CD6 A;  2PQA A;  2BA0 A;  4JI0 Q;  4JI6 L;  4JI4 Q;  2N78 A;  4A3I G;  1G29 1;  4AYB G;  2NZO A;  1WCM G;  4JI1 Q;  5IY0 A;  2UUC L;  4IFD J;  4HID A;  2E5L Q;  3D0F A;  1EIF A;  1X3E A;  4Y52 H;  5LMN W;  1TWH H;  1PVO A;  1R9T H;  4B3T Q;  1HNW L;  3NEM A;  3MEF A;  4C3H H;  3B6Y A;  3KFU A;  1K73 C;  2UXB Q;  4JV5 Q;  2B29 A;  2NVY H;  3G4S A;  4A3E G;  3GTQ H;  4JYA L;  3J80 c;  1Z47 A;  1FJG L;  2YV5 A;  3PV0 A;  2VL6 A;  2WAQ E;  1IXR A;  3KOJ A;  2IHE A;  4TVA B;  2K5V A;  3CMA A;  1P16 A;  4DR6 Q;  1IBM Q;  4DR2 L;  2I5H A;  1W3S A;  1UE6 A;  3HOV G;  2UXB L;  3G48 A;  1A8V A;  3S1M H;  4UP7 A;  3PUZ A;  3JC6 6; 
#chains in the Genus database with same CATH topology
 1LT4 D;  1LTL A;  1ML0 D;  1PRT F;  4PL5 A;  2A2D A;  2E5L L;  1L1O C;  2KHJ A;  1RIP A;  2P5Z X;  1ROD A;  1RTN A;  1XXG A;  5G3L F;  5C44 B;  5IGD A;  3H09 A;  1J8I A;  2WIN B;  2ZTD A;  2Q2T A;  4JBK A;  5IT9 L;  1RKN A;  1B9N A;  1QVC A;  2IT1 A;  1SFO H;  4K0K Q;  1XTD A;  2VS1 A;  2XWJ B;  1UNS A;  3RLN A;  3KF8 B;  2KKM A;  3TN2 A;  3FPP A;  2ZW3 A;  3R93 A;  2B2T A;  2BH8 A;  4HIO A;  2YU9 H;  1IL2 A;  3I56 A;  1FVI A;  3TZU A;  3V05 A;  2WKD A;  4X65 Q;  5IT9 c;  1TXY A;  2CH4 W;  3L0O A;  1SEB D;  3A5Z B;  1HNX Q;  1SE8 A;  4HCE A;  3HKS A;  4KHZ A;  1RDP D;  2XTQ A;  4OHJ A;  4Q9V A;  2CQA A;  3TRZ A;  4A3K B;  5HUR A;  2ICI A;  1VQA A;  4LWC A;  3J81 j;  1SAP A;  1SNP A;  5C44 H;  2JA5 H;  3Q6S A;  5C3X A;  2D0O A;  2F0H A;  3JAM c;  1U9R A;  2WAQ B;  4RKB A;  4IPH A;  4R4Q A;  2OF1 A;  4X66 L;  1KXL A;  5M3M B;  5KNB A;  3JAM E;  1I4X A;  4AH6 A;  2BA1 A;  1ICW A;  5EPK A;  1QG7 A;  1A0I A;  3GP7 A;  2B8G A;  1HZ9 A;  3CCJ A;  4I65 A;  2CW0 D;  3ERQ A;  1B70 B;  1BDO A;  4H7B A;  3MEH A;  4H02 A;  2RSO A;  3E0J A;  2Q8I B;  1N32 Q;  1K3B C;  2DNE A;  2VZA A;  4A3D H;  3B55 A;  2HUG A;  1KLU D;  4A76 A;  2UXD Q;  2QA4 A;  3J7A 5;  1PZI D;  4IQZ A;  4QUC A;  4NB3 A;  5FLX c;  4U68 A;  2JA8 H;  1B4O A;  1WJJ A;  1HPC A;  4KKS A;  3OW2 A;  4DU9 A;  3HG9 A;  3J81 i;  2ES2 A;  2KCM A;  1EIY B;  4DAM A;  1XNR L;  4DUY L;  3HOZ H;  3S1M B;  1DOK A;  2OEO A;  1NBW A;  1R9T B;  4B3S L;  2L1L B;  1I94 L;  4DV7 Q;  3DA4 A;  1JJC B;  2Z8L A;  4B3R L;  3A8J E;  2A6H D;  3I4N G;  2R7F A;  4YWM A;  4DV4 Q;  5JEA H;  3RNU A;  2WKC A;  5CMD A;  3CCL A;  4EQP A;  4UAI A;  3TBI B;  4A3K H;  1I5F A;  2QEJ C;  2ASB A;  4RGO S;  1SRO A;  1X3P A;  3E3X A;  1M8A A;  5JJI A;  4XIG S;  2K04 A;  3HOW H;  1WTX A;  3VYU A;  1PYB A;  1BQQ T;  4LF6 L;  1NUC A;  2JJQ A;  1I6H B;  1IZ6 A;  1DJR D;  3I72 A;  3FVV A;  2XWB B;  2OCE A;  3EA6 A;  1GKH A;  2KED A;  3IRB A;  4TRD A;  3S1R H;  4A3L G;  1DD2 A;  2WB1 G;  1PTO B;  4JI5 L;  3M7N A;  4BBR G;  2RHQ B;  5C44 G;  3KBG A;  5KEE A;  4X3T A;  1S3O A;  3TQY A;  1EYG A;  4MTN A;  2EYP A;  4DA2 A;  4YZD A;  4YCW A;  4DR1 L;  3TS2 A;  4GKJ L;  1FNW A;  1OXU A;  1KIX A;  5GAE C;  3KJO A;  1FR3 A;  4QCL A;  5M5W B;  2R7Z B;  1STG A;  1EY4 A;  4QMG A;  1WTQ A;  5DEH A;  1WCM B;  4BY1 H;  1HZC A;  2SOB A;  3H3V H;  2F0P A;  4JCV E;  4WJW A;  2X6G A;  3C1E A;  1EOT A;  5JJK A;  4UPA A;  2BE5 D;  2FUG 1;  3CME A;  3N52 A;  4J15 A;  4MHE A;  4FDB A;  2E76 C;  1I4Q A;  3AQQ A;  2L12 A;  1IW7 C;  2A5H A;  1Y1V H;  1OXX K;  1AZQ A;  2EYH A;  2NTS A;  3H0G H;  4OWW B;  1MKH A;  3GTM H;  1GUO A;  4LF5 L;  3GO5 A;  1LYL A;  5JEA J;  3KK7 A;  2F4I A;  5E4X A;  5C4Z A;  2UU9 L;  3HOV H;  1EY0 A;  2PI2 A;  3C46 A;  1JWS D;  3GV3 A;  3ND9 A;  3LNN A;  3LJ1 A;  1A62 A;  4AQY L;  2RIO A;  1Q82 C;  2H4O A;  1AFP A;  1SYE A;  3HOX G;  2F4V L;  2Y0S B;  1PYW D;  5JPN C;  1QVF A;  5IGF A;  1I4G A;  3H0G B;  2B3G A;  1G51 A;  1NR2 A;  1OXV A;  3A55 A;  1LTS D;  5DNF A;  4A3E H;  3GTJ B;  3QR8 A;  1XMO Q;  1CM9 A;  4XTC S;  4KHV A;  3DM1 A;  2D9U A;  2F0D A;  1K8M A;  2YTX A;  4A3J G;  1PZJ D;  5HGI A;  3PUY A;  4A3I B;  4DKA C;  4HED A;  2MO0 A;  3MZ5 A;  1N34 Q;  1F9P A;  2WAC A;  4KLK A;  5IGB A;  1XJV A;  1G2T A;  1HQM C;  1B2T A;  3J80 E;  1Q81 C;  4IAL A;  4TQU S;  1TS4 A;  5CV8 A;  1KLG D;  4YCU A;  3X3N A;  4RHR A;  2RCF A;  3NHH A;  2PQA B;  4B3M Q;  2B63 B;  2HD3 A;  3S16 H;  4G76 A;  2C9O A;  1STY A;  3KDF B;  1PH6 A;  2AKW B;  2EY1 A;  5EJW A;  4K6D A;  2RSN A;  4CDC C;  4XQN A;  3H3V C;  1BOS A;  5E1F A;  3LJ2 A;  1QNU A;  1LUZ A;  2LSS A;  5COR A;  5L37 A;  1HNX L;  5KYL A;  2XSC A;  2RCN A;  4GNX A;  2JYO A;  2Y0S E;  1K83 B;  3G6J B;  1K83 H;  1A3U A;  2KCT A;  3K58 A;  2E2I B;  4RCO A;  3STB D;  2QCP X;  3BDO A;  5IGE A;  4R4C A;  1U4P A;  1I6H H;  3MTS A;  1XMO L;  3OSO A;  1QE6 A;  1PTO F;  1RD9 D;  1E2W A;  2EIF A;  4PNY A;  4HJ8 A;  1PXU A;  1X3F A;  3J7Y W;  2HGK A;  1PH8 A;  4P75 A;  3PIO 3;  2R7Z H;  2ZXR A;  1PFS A;  2MP1 A;  2PMZ E;  4DR2 Q;  1IBM L;  3A0J A;  1WVL A;  1HUM A;  1WOC A;  2K19 A;  1HR0 W;  4UY8 C;  1JIC A;  1C48 A;  2L9H A;  2FHT A;  4A3G G;  2Q8R E;  4AS3 A;  4NP5 A;  4IUP A;  4BBR H;  4OL7 A;  3NTH A;  1PMR A;  2MO1 A;  3V96 A;  1JJ2 A;  1WCM H;  4FYD A;  1Q46 A;  4IO9 A;  1KNA A;  3QO2 A;  1YNN D;  2NN6 H;  3J81 E;  3ERO A;  3HS0 C;  4DV5 L;  4A3G H;  3NBI A;  1STH A;  3T16 A;  4UHV A;  2BDO A;  1VQD A;  2B2U A;  4GN3 B;  3DWP A;  1BBU A;  4IN3 A;  5EPL A;  4X66 Q;  2JXM B;  1DON A;  2V4D A;  1E2Z A;  5IP7 H;  2JA7 H;  1SBB B;  4XQQ A;  1AZP A;  2E2D C;  1KQS A;  1SN8 A;  1VQF A;  2HCC A;  5IP7 G;  3J81 L;  2JA7 G;  2HIX A;  5IOC A;  5J1Z A;  3S9W A;  3DLL A;  5KNC A;  5KRU A;  3KF8 A;  1U4R A;  4NXM L;  2EYO A;  2K5W A;  5BN3 A;  2VUM G;  5C4X H;  4C3I B;  2EJM A;  2GN5 A;  2XVS A;  3MHB A;  3VYT A;  2L1B A;  3U4V A;  3OHX C;  1UEB A;  1EWC A;  1VQ9 A;  3D31 A;  1D7Q A;  4C2M H;  2PNR C;  3U58 A;  2UUB Q;  4HN7 A;  4QB4 A;  1HZA A;  2K01 A;  1AP0 A;  2CHB D;  2EQS A;  1PH1 A;  1SND A;  1JT8 A;  4A3F B;  2KBN A;  2J4X A;  1E7Z A;  2B2Y A;  1T5X D;  2L5T A;  1VQK A;  1EU3 A;  2PQE A;  1PTO H;  4LJZ C;  5ELF A;  3BG3 A;  4HTH A;  2A6H C;  2ZJQ A;  1B8A A;  2DUD A;  3SXH A;  5GAD C;  2A73 B;  3UDF A;  2K32 A;  2L4N A;  4JI7 L;  2JEA I;  2A1A A;  3RMH A;  3CCV A;  2XMX A;  4NXM Q;  5K36 G;  2OT2 A;  2KQ3 A;  4J1M A;  3BJU A;  4DR4 L;  4K8I A;  1V43 A;  1T9H A;  1BXT A;  2Q2I A;  4FNF A;  4H0L C;  2AUJ D;  3Q24 A;  5CGK A;  3E9H A;  3M4Y A;  3U4Z A;  1BVS A;  1ASY A;  1T5E A;  3Q8D A;  2JA8 B;  1WD1 A;  1I4R A;  1XTC D;  2PQA A;  2BA0 A;  3CKI B;  4JI4 Q;  5D65 A;  4AYB G;  3TP7 A;  2RKS A;  1PRT D;  1S5B D;  3D0F A;  1X3E A;  4Y52 H;  1BBX C;  1CFM A;  2NWG A;  1CA5 A;  1TWH H;  3EFX D;  4ODG A;  3TME A;  1LTA D;  3MEF A;  4C3H H;  5LHY 1;  4KD4 A;  2NVY H;  3G4S A;  4JYA L;  2YV5 A;  2WAQ E;  1IXR A;  1S4Z A;  5KYI A;  1V1O A;  2K5V A;  1UE6 A;  5D3I B;  3CRK C;  5CV6 A;  3G48 A;  1A8V A;  3MC0 B;  5ELD A;  3S17 H;  3S1M H;  3HOZ B;  4F87 A;  3PUX A;  1CK1 A;  3CW2 C;  3S1Q H;  4Y7N H;  2NVX H;  1HUN A;  5CV5 A;  5I6Y A;  5IYD H;  4AYB E;  5K36 H;  4K2K A;  2B8F A;  3T53 B;  3PGZ A;  3SEB A;  4O42 A;  1EYA A;  3HOX B;  1D2B A;  4XDX A;  4UDU C;  1K9M C;  4TKO B;  2Q2H A;  1IW7 D;  4NV2 A;  4Z9C B;  3ONA B;  3W1G A;  1RTO A;  2BDN A;  3SDJ A;  3F8T A;  4LUV A;  3NQI A;  4MZ9 A;  3RN5 A;  3NWT A;  2OWO A;  4KHP Q;  2F3I A;  2Q8T A;  4BBS G;  3LWE A;  3L3O C;  2PMZ B;  4FO2 A;  3RZO H;  1D5X C;  1Y69 U;  3NBH A;  4KN7 C;  3IAY A;  4YY3 Q;  1G2S A;  1TKW B;  2MFI A;  4DR5 Q;  1L0W A;  2F0G A;  3K5N A;  5IT9 E;  2N49 A;  4R4T A;  1D1I A;  1HZB A;  4DAY A;  4Y7N B;  1X54 A;  2HHH L;  3CCM A;  4H44 C;  2A2C A;  1ZXT A;  5EAY A;  3DEP A;  1D5Z C;  5FLX E;  1C0A A;  1TWA H;  1CSQ A;  1H95 A;  1AH9 A;  1K3R A;  2SNS A;  2ZXO A;  4AIM A;  1VQM A;  3U9O A;  3OWE B;  1CZW A;  5LMU L;  4UP8 A;  4ME3 A;  3IAS 1;  5EKK A;  3M3Y H;  3AYH B;  3BS1 A;  2VNU D;  1QCB D;  2JEB I;  2PI2 E;  4EGV A;  1HQR D;  1X3Q A;  3Q23 A;  4C3H B;  3S17 B;  1YEZ A;  1TWH B;  3J80 L;  5LMN L;  2F0F A;  2QW7 A;  3TP8 A;  2YU9 B;  1VDZ A;  1PRT B;  1YJW A;  2WII B;  4BY7 B;  2RQX A;  4QL5 A;  4ZKB B;  3MXP A;  3BYY B;  4JI2 L;  4LF8 L;  3N6R A;  2RA4 A;  1K8O A;  4A93 G;  2F66 B;  1B50 A;  1XPO A;  5T1G A;  3MFG A;  2G9D A;  2WV6 D;  3GTL H;  4DR6 L;  5H1S E;  4IFD G;  4B9X A;  1I6V C;  1GUW A;  1LM0 A;  3T4A C;  4JI0 L;  4EX5 A;  1HTL D;  1TVX A;  3PMF A;  2JA5 G;  1FL0 A;  2FU2 A;  2ZT9 C;  4LF5 Q;  2VQE L;  4C3I H;  1TWG H;  1KNE A;  4DV5 Q;  3BVZ A;  3C3L A;  5D3D A;  4ILW A;  1Y1W H;  1JQY D;  4JI6 Q;  1SMX A;  1EYC A;  1JC7 A;  2K28 A;  3A7L A;  3CP0 A;  4DN4 M;  4JI7 Q;  1CKN B;  4OAU C;  4HSV A;  2FFK B;  4K6L A;  1X6O A;  2AHO B;  4DR7 L;  2F0I A;  2F52 A;  4DWL A;  3S1Q B;  2IWH A;  2IJ0 A;  2HCI A;  5C0X J;  1J6Q A;  1LO5 D;  2KJX A;  2KEE A;  1VMP A;  3LGJ A;  3UE0 A;  3NBH B;  4ALP A;  2XTI A;  5NUC A;  2MQH A;  3P1H A;  1UE5 A;  4GKJ Q;  2E2I H;  4DUZ L;  4A3M G;  3GV6 A;  1CZG A;  1XMQ Q;  4R8I A;  1NCV A;  4AYB B;  1XWE A;  3VA5 A;  1QUQ B;  3J7A F;  1SRU A;  3PO3 H;  1HHV A;  2QEX A;  1XPU A;  3WOF A;  4RHS A;  3MXG A;  2B2V A;  1KAB A;  3CU7 A;  1F9R A;  1Y14 B;  3Q0A A;  1KRS A;  4KK7 A;  2DY7 A;  3CC4 A;  2FIN B;  3IKJ A;  1A3T A;  1LTT D;  4R1J A;  1Q1E A;  4HMI A;  1PFM A;  2QSB A;  5IYC G;  2UUA Q;  2B63 H;  3FDT A;  2A68 D;  3L0I A;  2EE1 A;  2KEN A;  3NPP A;  2NZH A;  4ZUI A;  5LNK 1;  5C3E G;  4LFB L;  4N8X 1;  4B08 A;  1DOM A;  4ULL A;  3J80 i;  3BYT B;  1L1O A;  4JBJ A;  2IX3 A;  2CQO A;  2K75 A;  1AE2 A;  1IBK L;  2K05 A;  3K5M A;  2EXZ A;  2VB2 X;  4G57 A;  1DGS A;  2UXC Q;  1B7Y B;  3PO2 H;  1TS5 A;  3DXJ C;  3VR6 A;  4X3U A;  4DV6 Q;  3KLW A;  2GSC A;  2C5C A;  1B1Z A;  1EY9 A;  1I3Q B;  5ELO A;  2O5J C;  5BR8 Q;  1C4Q A;  2PYK A;  3FPU B;  4A3B G;  2RAD A;  2B2V C;  1F2M A;  2PNH A;  1STB A;  2FJ2 A;  1RHP A;  1L0Y B;  1MIU A;  1U0L A;  2Z1C A;  1F9S A;  1VQH A;  2GA4 B;  4GXT A;  4R4I A;  4RGN A;  3K5O A;  3CCE A;  4DR4 Q;  2KCN A;  1GXD C;  2UXD L;  2UU9 Q;  4DK0 A;  4CDD C;  2AQ2 B;  1G6P A;  1GUT A;  1A63 A;  1GUS A;  4I7Z C;  1QZH A;  1K0R A;  3GTG B;  1D5M C;  1IKL A;  4P72 A;  1ENA A;  3CQZ B;  5M3M G;  3AU7 A;  3K7A B;  1WTP A;  2R93 H;  3HOY H;  3IFD A;  3PO2 G;  2K4K A;  1GHK A;  1JJG A;  1A3V A;  4PMW A;  1PH7 A;  1FYC A;  1BNZ A;  2K5Q A;  3DUZ A;  3QOL A;  5IIF A;  3K8A A;  2XGT A;  1MHW C;  4MTK A;  2HDM A;  3NP8 A;  4LNQ A;  1KC8 C;  2CFM A;  4IPC A;  5I6W A;  3A5U A;  2CWP A;  4A3K G;  2AWO A;  1PTO D;  4DNI A;  4LFB Q;  3NEN A;  2ENB A;  4A3I H;  3UDG A;  3HOU B;  4A93 H;  2WP8 J;  1X3G A;  5FOB B;  4ABN A;  1TII D;  5K5P A;  2JE6 I;  3TS0 A;  4GLX A;  3E9I A;  3GTJ H;  2JK8 A;  3SVM A;  4ME5 A;  1L0X B;  1E22 A;  1SJH D;  1QB5 D;  5I9P A;  2D62 A;  1VF7 A;  1Y1V B;  1R4Q B;  2JN4 A;  3OTO L;  4LK1 C;  4X3K A;  2VXW A;  1I3Q H;  4FF2 A;  4JBW A;  3UI2 A;  1OXS C;  3BVM A;  1E24 A;  4OIK A;  1HH2 P;  4C1N K;  3EN2 A;  4BXX G;  3NE5 B;  4DV7 L;  4PL3 A;  2NTT A;  1N36 L;  5ELB A;  1X65 A;  3L7Z C;  2JA7 B;  1MSG A;  3BZC A;  1O80 A;  2NN6 I;  1ESR A;  1FD7 D;  1VQE A;  3MA2 B;  3TZD A;  3ICE A;  4CKE A;  4GS3 A;  1SYD A;  3NTI A;  4JW0 A;  1YIT A;  4N9P A;  1S5D D;  1P8L A;  2ZJP A;  4DR7 Q;  3H0G G;  2KHS A;  1TWF B;  4DK6 C;  1JQO A;  1IKM A;  5CBE E;  5DAU A;  4BS9 A;  4DV4 L;  2FEF A;  1O7L A;  4B3T L;  2JA8 G;  1ESF A;  1EQR A;  5I2Y A;  1U4L A;  1C9O A;  5DM7 3;  3BZK A;  1I4P A;  2VB3 X;  4CHT B;  4JV5 L;  3ULJ A;  3F2D A;  4OON A;  1B3Q A;  4V0B A;  2VQE Q;  3KLS X;  2R61 A;  2FXQ A;  3D4W A;  3GD7 A;  1Y8N B;  3FNB A;  3AEV A;  2V1C C;  3Q22 A;  2UUC Q;  3UDI A;  2IHF A;  4DV2 Q;  2ID0 A;  2RDH A;  1YJ9 A;  1ILQ A;  3P7J A;  4JOI C;  3G71 A;  1O7Z A;  1U4M A;  4LF7 L;  2YFB A;  1EY5 A;  1AE3 A;  4KY5 A;  5C3E B;  5J3B A;  1TY2 A;  2RVL A;  1WTO A;  3NQT A;  4LF8 Q;  4DAV A;  1B3A A;  3RD4 A;  4BY7 H;  4HEA 1;  3EJI A;  1N32 L;  5LL6 S;  1HNZ Q;  5JEA G;  1PH5 A;  3UIT A;  1S40 A;  2ZTE A;  4KY7 A;  3S2H H;  3GTK B;  3VA7 A;  3O13 A;  3I3C A;  4DXG A;  5C5M A;  1TWG B;  4B3M L;  4A75 A;  1IHZ A;  3NXW A;  4G7H C;  2RF4 A;  3SE0 A;  2R92 H;  2I0Q A;  2WB1 E;  4APV A;  1O78 A;  5A35 A;  2O2L D;  2RBM A;  1OTC A;  2B2W A;  3MVV A;  4X3S A;  5J39 A;  3I4M G;  5DM6 3;  1N34 L;  2KUM A;  4JI8 Q;  1SNM A;  4X62 L;  1PH4 A;  1SXT A;  4JBM A;  1CQV A;  1XNQ L;  1H9R A;  1R4P B;  1VQC A;  4KKT A;  3WWV A;  2QDB A;  3PO3 G;  1WYD A;  2BOS A;  1CI3 M;  3AFP A;  4BY1 G;  1SNC A;  1NY4 A;  2RLD A;  2YFA A;  1SYF A;  2CKZ B;  4K5X A;  1WI5 A;  3HEJ A;  2CH4 A;  2OTJ A;  4QY7 A;  1NE3 A;  4CGY B;  4DK1 A;  1HJP A;  4DFA A;  4A3C G;  3QOJ A;  2A69 C;  4L5S A;  4K0K L;  1W6J A;  4RKL A;  3KF6 A;  1ET6 A;  3L2P A;  1PHJ A;  4A3D G;  4J8Q A;  2VY3 A;  1YZ6 A;  1ICF B;  5FJ8 H;  4JI6 L;  4Q5V A;  2N78 A;  2F0S A;  3KBX A;  4IFD J;  2E5L Q;  2E2H B;  3S15 B;  2M2L A;  5BN5 A;  1PVO A;  4C3J B;  1HNW L;  2IP6 A;  3P20 A;  2IPK D;  1C8C A;  3GTQ H;  1TQO A;  4KMU C;  1LAB A;  2VL6 A;  3CMA A;  4KY6 A;  1JOR A;  1W3S A;  2N88 A;  2HDL A;  1EFI D;  3I90 A;  2K1B A;  4IUN A;  1HCZ A;  1VQ6 A;  2N55 A;  3CD6 A;  3GTL B;  4JK1 C;  3SK8 A;  1ZKO A;  1V8Q A;  4XT1 B;  2AMC B;  4OGQ C;  3R3O A;  3HGB A;  3EVQ A;  3UDX A;  3D4R A;  1Y1W G;  1DM0 B;  5JVG 3;  1KL9 A;  4DV6 L;  1JB7 A;  1PZK D;  4KJN A;  5JOB A;  4IZ8 A;  3HRZ C;  5EKI A;  1YBY A;  4QGU A;  1STE A;  2JB3 A;  4FXD A;  4JPB W;  5FK9 C;  3S1N H;  4GN4 B;  4HSP A;  3R2T A;  4P73 A;  4P71 A;  1FNU A;  3K57 A;  2P22 B;  4NMZ A;  5IYB G;  1IBL L;  3GTO B;  5M5X H;  3VR3 A;  3I55 A;  2PZT A;  1EQQ A;  2BH2 A;  4PZ8 A;  4LFC L;  3CPF A;  1X9N A;  3PF4 A;  3OOC A;  2E2H H;  3FKI B;  2EY5 A;  1J5E L;  2CCZ A;  2TMP A;  5EQ0 A;  4EVO A;  3HOU G;  5ELE A;  1IBL Q;  3PIP A;  4KHP L;  3I2Z A;  1IL8 A;  3GTO H;  5JVH 3;  1CKN A;  1I94 Q;  3L9A X;  3LX0 A;  3MXU A;  3M4O B;  2IY5 B;  3E6Z X;  4YZ9 A;  3ZYY X;  5CR3 A;  1NR4 A;  3S2D H;  2NZ1 D;  3DWQ A;  1WTH A;  5AJ3 Q;  3RZO B;  2Z6B A;  2XRQ D;  1SJ8 A;  1VQL A;  2M00 A;  3I9V 1;  1EY6 A;  4X64 Q;  1O7Y A;  3BVG A;  5E7N A;  1Q90 A;  4ZRZ A;  4IUQ A;  5C4J B;  1H9K A;  4POG A;  2V6E A;  4IUT A;  2R92 G;  2I46 A;  4XT3 B;  3DO9 A;  2E2J B;  1WTV A;  2F3W A;  2IL8 A;  1Y1V G;  3PIP 3;  4LF4 Q;  4CDE C;  4DR3 L;  1JOK A;  3DHQ A;  3IFT A;  5M5X B;  4LAA A;  4JYA Q;  3I4O A;  1EOV A;  3DM3 A;  1EWH A;  3S14 B;  1F2Z A;  2Z6K C;  2ALY B;  1S5E D;  4A3G B;  2MGS A;  2JB2 A;  2PPB C;  1JWM D;  1CKO A;  3W5O A;  5D14 A;  1Q1B A;  2BE5 C;  1XYI A;  1RF2 D;  4A3F H;  2ICE C;  3SK6 A;  4C3I G;  4IPG A;  5T1I A;  3OMG A;  4OWT B;  4QUF A;  1Q12 A;  2DNC A;  2EPB A;  2QIL A;  2YYZ A;  2BCO A;  4CJ2 C;  2OTL A;  5CV9 A;  3GTP B;  2MUY A;  4LFA L;  4PG3 A;  4G4K A;  1HRJ A;  5LMN Q;  1JMC A;  1VQ8 A;  2Z6K A;  4IUR A;  3CCS A;  2E8G A;  1EQV A;  4HIK A;  1Q3L A;  3M4Q A;  1CKM A;  3OIQ A;  1B9M A;  2K03 A;  5ELC A;  2JA6 G;  2R92 B;  2VQF Q;  1JE5 A;  2PZW A;  2MHV A;  3FBV A;  1TR5 A;  2NVT H;  3PQI A;  4DAP A;  2ATW A;  4LFA Q;  2KCC A;  2K5N A;  3GDE A;  3HOX H;  4GOP C;  3ULL A;  1J5E Q;  1DZ1 A;  4A3L H;  3I4M H;  5CV7 A;  2NUC A;  4FF1 A;  1LT3 D;  3SGI A;  2EOT A;  2J0T D;  5CYU A;  3I4N H;  4HCS A;  5LL6 X;  2HQE A;  2ZM6 L;  2OQK A;  3TDQ A;  4EQO A;  1CTM A;  3CF5 A;  2F0M A;  4L63 B;  2K52 A;  2PW5 A;  3FKI G;  4C3J G;  4L5R C;  1DYQ A;  1SLJ A;  2PZU A;  2Z4I A;  1K8A C;  3PUW A;  1BR9 A;  4CKB A;  2QKI C;  1A2T A;  1N8R C;  5M5Y H;  2VUM H;  4UP9 A;  1OXT A;  4JI1 L;  4FP5 D;  4HJ5 A;  1PH9 A;  4LF4 L;  3GTG H;  2QDL A;  4IOC A;  3PF5 A;  1N9W A;  3OWF A;  4WJ3 M;  3VR4 A;  4O0A A;  1XPR A;  3TRE A;  4F7X A;  3ULP A;  1K0S A;  3KLR A;  4MIU A;  5FLM H;  4RFB A;  5E3F A;  4NV5 A;  4HJ7 A;  1XX8 A;  4PZ7 A;  2F4V Q;  3HOU H;  2EJF C;  1JCK B;  3RR5 A;  2M9V A;  1LTR D;  2LY7 A;  3VYS A;  4CBV A;  2XIW A;  2ZTC A;  3T51 B;  4X64 L;  1CSP A;  5IYC H;  2B63 G;  1CHP D;  1VQO A;  1TU2 B;  1E1T A;  1CUK A;  4OX9 L;  1QOH A;  1PFN A;  1SMY D;  5JJZ A;  1SYB A;  2A69 D;  4OXP A;  5KGU A;  2ETD A;  4NPS A;  4M8A A;  2A74 C;  2EYL A;  4ZKC B;  4YZC A;  5C3E H;  3FMC A;  1SNO A;  1CA6 A;  1MBY A;  3I73 A;  1H9M A;  1EFW A;  1UUP A;  3QG1 A;  2XRS D;  1YNN C;  1K8G A;  4A3B H;  4BY1 B;  4DV3 Q;  5I2X A;  3AB9 A;  3S16 B;  2LKV A;  4A93 B;  1SNQ A;  4YY3 L;  3T1Y L;  3DWA A;  4HJA A;  1FGB D;  4RGT A;  1M4V A;  3T1Y Q;  5EGT A;  4POF A;  1LV9 A;  5IOD A;  2WAQ G;  3I4M B;  2BL8 A;  4IUU A;  3F2C A;  4RA8 A;  2F03 A;  3RN2 A;  4B9W A;  1S72 A;  4L5T A;  4FXG C;  1YO7 A;  4DR1 Q;  5M3F H;  2L0C A;  2H1E A;  1SJE D;  4X62 Q;  1SR3 A;  1BUV T;  1C7Y A;  5HGQ A;  4JI8 L;  4A3F G;  1SYG A;  2EYM A;  4A3E B;  4A3E G;  3CPW A;  2LXJ A;  4YIJ A;  3EIV A;  1HXY D;  1L2F A;  2OQ0 A;  3R8B A;  1WFQ A;  3R2I A;  4K14 A;  4X6A H;  1I50 H;  4JOI A;  1G91 A;  2L15 A;  2AQ3 B;  3SR1 A;  5FJ8 G;  5M9O A;  4L6T B;  4V19 0;  3CAM A;  4IFD I;  2A6E C;  4OWX B;  3I4N B;  2R93 G;  5GRO A;  1ET9 A;  3U9S A;  3BDC A;  2EVB A;  3QIA A;  1TY0 A;  2QGQ A;  3C2P A;  2K5H A;  4YWL A;  3PO2 B;  2CVR A;  4G7O C;  2R7Z G;  1A2U A;  3ZJY C;  1JE4 A;  1TS2 A;  1HNW Q;  4R4O A;  2N3S A;  4WOR A;  3CCQ A;  4BBS B;  4LF7 Q;  1ILP A;  1S5C D;  4GNX C;  4I7A A;  1YNX A;  3D6C A;  2IX0 A;  4QIW B;  3NEL A;  3EQL C;  4DUY Q;  2YTV A;  3VA9 A;  1YVC A;  4GOP B;  2B2W C;  5C3W A;  1U5K A;  1I50 B;  4BXX H;  3HP3 A;  4DAY B;  1EIH A;  1F2L A;  3URY A;  3HKZ G;  4C56 C;  1VQJ A;  1VF5 C;  2E2J H;  1NMG A;  2GVA A;  3FVQ A;  3HOY B;  3HOY G;  2NVT B;  5TSS A;  5C0X G;  4OO1 H;  1ZYR C;  2L11 A;  4OIJ A;  2NVQ H;  3G7L A;  5CV4 A;  4JC0 A;  4NW2 A;  2I5L X;  4C1N I;  5C4J H;  4BA1 I;  1F2Y A;  2KHI A;  5EBC A;  3STB C;  1NMF A;  4LFC Q;  5JPM C;  1Q8K A;  1XNQ Q;  3KLS A;  1MJC A;  3K80 C;  2Z4H A;  1EEI D;  5IP9 G;  2PCF B;  1VS0 A;  3H94 A;  4NXN Q;  1BBW A;  3T13 A;  2NB0 A;  4DV1 L;  4LF9 L;  1HFN A;  2Z9H A;  4E6I A;  5M5W H;  1Y8P B;  1STN A;  3MFY A;  5EPJ A;  2FMM A;  2A68 C;  1TWA B;  3OTO Q;  3JSB A;  2K50 A;  4ZQ3 A;  1AW7 A;  1J9O A;  1HNZ L;  4WRD A;  4JVZ A;  4DXF A;  3VDY A;  4F8M A;  2IX1 A;  2R6G A;  1EUJ A;  1E1O A;  2R7D A;  3K6O A;  3MXN A;  4AQY Q;  2DJG C;  3FEW X;  3QWN A;  4DV2 L;  1ONL A;  3X3M A;  2F0O A;  1NNX A;  1D8L A;  3C1F A;  3PIO A;  3RLF A;  3VR5 A;  2PO4 A;  4A3D B;  1VQI A;  3I7F A;  1F9Q A;  3A54 A;  4DGZ A;  2RHS B;  2B39 A;  2F0J A;  2NYZ D;  3OIP A;  2JA6 B;  4PV1 C;  2O5I C;  4A3I G;  3SDZ A;  3IL8 A;  2NZO A;  1WCM G;  2CW0 C;  3HZX A;  4HID A;  1Y1W B;  4ZK9 B;  1KDC A;  5LMN W;  4Z7H A;  4CKC A;  4DNR B;  4B3T Q;  3S1R B;  3NEM A;  1GUN A;  4O1O A;  3B6Y A;  1K73 C;  2UXB Q;  4JV5 Q;  4F88 A;  1LAC A;  3J80 c;  3FRP B;  1Z47 A;  3VYR A;  3PV0 A;  4DR6 Q;  3KUP A;  2IHE A;  2SEB D;  1P16 A;  2X69 A;  4R9W A;  1IBM Q;  4IFD H;  4AS2 A;  2I5H A;  2JA5 B;  1EIF A;  1EY7 A;  3PUZ A;  1MI2 A;  1QZG A;  5FLX L;  5A2Q L;  4NKL A;  2XTR A;  2HT1 A;  1GOZ A;  1ZEQ X;  1S5F D;  4Z7G A;  3BDL A;  3T1H L;  1PH3 A;  3OW7 A;  4QIW E;  3RLO A;  2QZG A;  1VQ7 A;  3WDN A;  1D1K A;  1DXM A;  3H91 A;  4GLA C;  4RH6 A;  5IWA Q;  3PO3 B;  2BL7 A;  4JI5 Q;  4RMF A;  1BKB A;  3S1N B;  4HJ9 A;  1N36 Q;  4DV1 Q;  4LF9 Q;  3M4P A;  1E2V A;  1G8Z D;  1H9J A;  2EY2 A;  2N8N A;  3VR2 A;  1QJO A;  5GAH C;  2AWN A;  2F0L A;  3M4O H;  5LMU Q;  3D3R A;  5J22 A;  1HTP A;  3A56 A;  4ZAI A;  2UUA L;  2L55 A;  2HHH Q;  3WOE A;  2D5D A;  1GM5 A;  1B44 D;  3JAM L;  3A7A B;  4WFN 3;  3M7G A;  1DOL A;  1W6K A;  2F0V A;  4N8F A;  1BF4 A;  1MGS A;  4LW1 A;  2NN6 G;  2KA7 A;  4HMJ A;  4KD3 A;  4KI0 A;  3F2B A;  3M3Y B;  2KOL A;  1QUQ A;  5ELN A;  2DGY A;  2ZXP A;  1M90 C;  4K5V A;  3KDF A;  2JA9 A;  4DK3 C;  3W3A A;  5M3F G;  1UE1 A;  4OEL B;  3FKI H;  1UEA B;  2OXP A;  3AJF A;  5KND A;  1D6E C;  3K81 C;  1E3P A;  4NXN L;  1UAP A;  1RJT A;  4G7Z C;  1EQT A;  1NTG A;  1GO3 E;  4G75 A;  1PTO C;  4LMQ D;  3DA3 A;  1CQF A;  3CCU A;  1STA A;  4CJ0 B;  4IUV A;  1MSH A;  1GD7 A;  3KJP A;  1MD2 D;  3S15 H;  3P23 A;  2HIV A;  3KF6 B;  3CHB D;  4S3S A;  2PW7 A;  2XN9 C;  4B3R Q;  3K5L A;  3I8Z A;  1FJG Q;  4HR7 B;  2JA6 H;  3ER0 A;  2JSO A;  4B3S Q;  4M1U B;  3H3V I;  2R3Z A;  1Z6H A;  4XQJ A;  4WJ4 A;  2NVX B;  5C6A A;  1SDF A;  4IOA A;  1GJX A;  1EU4 A;  1G6Z A;  5FO9 B;  3CC2 A;  4KV6 A;  2C35 B;  2FMC A;  1QNK A;  1KDB A;  1YHA A;  4PMB A;  4R8N A;  5M3M H;  3JAM i;  2EZV A;  2WFW A;  5AJ3 L;  3PCO B;  3MXN B;  4XXE A;  1EL0 A;  1GUG A;  4LUO A;  1YJN A;  4BY7 G;  2Y0S G;  2A8V A;  4L5Q A;  3RZD H;  3A74 A;  4HAE A;  3E5S A;  4C3J H;  4ZYS A;  2K33 A;  1OO9 B;  2JAE A;  4XYO A;  4A3J B;  2DJF C;  3W2D A;  3UE1 A;  5IP9 H;  5ISR A;  1TS3 A;  4X65 L;  3SHL A;  5FO7 B;  3LWU A;  3V2T A;  1SSO A;  2ZJR A;  1QVG A;  3CRL C;  3NWS A;  1MJE A;  5C0X I;  1EYD A;  4MN3 A;  4JI3 L;  1X32 A;  3BZD B;  3OYY A;  1IYV A;  4J6H A;  4H13 C;  3I4L A;  2EXD A;  2NVY B;  1QIL A;  4DV3 L;  1VMC A;  5G3L D;  1UE7 A;  1LT5 D;  1LLR D;  4OO1 I;  3I70 A;  5IWA L;  1ENF A;  4LUZ A;  4BBR B;  4LF6 Q;  5HGT A;  3H15 A;  5IYB H;  2YTY A;  2UUB L;  3J81 c;  4O1P A;  4YCV A;  3NUC A;  3T1H Q;  1JB3 A;  2K14 A;  1VQB A;  1QWY A;  4DR5 L;  3HOZ G;  1RL2 A;  3G6E A;  1EIG A;  4P74 A;  4YHH Q;  1FGU A;  4QF4 A;  3HFZ B;  3K0X A;  1LTG D;  5HY6 A;  5DLQ E;  2K7V A;  1JR0 D;  2H5X A;  3J7Z C;  1Z9F A;  2EJG C;  3KP9 A;  1N33 L;  4ZLT F;  1KAA A;  1II3 A;  1YHQ A;  2F0K A;  3OPO A;  4MNO A;  1XNR Q;  3HOW G;  2G5D A;  2D2C C;  3S24 A;  1Y8O B;  4DF7 A;  2B2U C;  1YIJ A;  2NVQ B;  3NSW A;  4RAU C;  4TSS A;  3S2H B;  4KN4 C;  4YWK A;  4OAV B;  3D6W A;  1Q8I A;  1H9S B;  2F0T A;  1TWC B;  2QF7 A;  4K2L A;  4OX9 Q;  2SDF A;  1VCI A;  1YI2 A;  3SK5 A;  4C2M B;  2UXC L;  1KHI A;  3NK9 A;  4QJF A;  4DNT B;  2J7Z A;  2B2T C;  5IGC A;  4PMC A;  1PRT C;  1VQ4 A;  3RUZ A;  4BWG B;  1H9S A;  3GTK H;  3EBE A;  1KAW A;  2AQ1 B;  1SMY C;  3M9B A;  4A3M B;  4FVM A;  2MJF B;  1PA6 A;  2MPM A;  1A6X A;  3F2U A;  3K59 A;  3K7A H;  2R93 B;  4GN5 A;  3HKZ B;  3KYH C;  4RG1 A;  4GZY C;  3ITP A;  2JB1 A;  3MAQ A;  4ZCK A;  1YNJ C;  4PL4 A;  4HFV A;  1YHB A;  1SE2 A;  1SE3 A;  4KJO A;  2VQF L;  2B2Y C;  4DUZ Q;  1Z7T A;  1TWF H;  2LS0 1;  1O7I A;  2K5D A;  1PDQ A;  3QB3 A;  3DMU A;  2MNA A;  5A2Q E;  1PV4 A;  1WTR A;  1IYU A;  1BO0 A;  5IE8 A;  1AN8 A;  1M1K C;  2ZRR A;  1EWI A;  5C4X G;  5JJL A;  5C4X B;  2EYJ A;  4YHH L;  4KTA A;  1ASZ A;  1HFG A;  5M3F B;  1WD0 A;  5FLM G;  2D0P A;  2F0U A;  5FKA C;  4DV0 Q;  4EQ5 A;  5FO8 B;  4Q0F A;  1ZYR D;  4FF4 A;  3ND8 A;  5C4H A;  4RWS C;  3W1B A;  4BA2 I;  3E0E A;  1BCP C;  3PUV A;  3CCR A;  1HA6 A;  1L1O B;  3CC7 A;  3H6M A;  2E74 C;  1BCP D;  5IYD G;  4A3C H;  1VQ5 A;  2F0W A;  1I4H A;  1HR0 L;  2JQO A;  4JI3 Q;  2EY6 A;  2F3V A;  4DPG A;  3HOW B;  1SYC A;  1K28 A;  1PLF A;  4K8J A;  5JAV A;  1A15 A;  4XYQ A;  2A6E D;  2F0E A;  1V9P A;  3CXC A;  4A3J H;  1DCZ A;  2LFN A;  4DR3 Q;  3A8I E;  4IPD A;  1KRT A;  1EEF D;  1KD1 C;  2X6L A;  4A3B B;  1UWV A;  3TEH B;  1PH2 A;  1LTI D;  4BBS H;  1E0B A;  1NAP A;  4C3H G;  3GTM B;  3TP6 A;  4A3M H;  2CWA A;  3PSI A;  5COY A;  3ERS X;  4ZUJ A;  2RDG A;  5C5L A;  2CAZ B;  4JI2 Q;  4JG2 A;  3SK4 A;  1BCP B;  1GVP A;  2VW9 A;  2VUM B;  5M5Y B;  3DEO A;  2GVB A;  3T56 B;  2EYF A;  3P75 A;  5KIX A;  5BR8 L;  4JI4 L;  2KVM A;  3K0Y A;  4QQB X;  4K5W A;  4HIM A;  2Q2U A;  2G9H D;  1X56 A;  2E75 C;  3FP9 A;  3TP5 A;  2Z0S A;  2JP1 A;  1JOO A;  3BU2 A;  5CC4 A;  1VQN A;  1HR0 Q;  1Q7Y C;  1KDA A;  1IBK Q;  4IJH A;  3HKZ E;  3I91 A;  4NDX A;  2QGM A;  1IYJ B;  4PZ6 A;  1LT6 D;  4IJL A;  3QJY A;  2I07 B;  4PQX A;  2ZM6 Q;  3HOV B;  1NSN S;  3F4M A;  1V1P B;  1GHJ A;  3CQZ H;  2EDG A;  1TWC H;  4EQN A;  3U50 C;  2I5M X;  3M85 A;  1VQP A;  3IAM 1;  1B53 A;  1F77 A;  2DN8 A;  3OMC A;  5EBD A;  5EKL A;  3GTP H;  1EZ8 A;  4A4I A;  5IGG A;  1Q86 C;  2F1M A;  4GOP A;  4U6R A;  4GKK L;  3F1Z A;  1XMQ L;  1EZ6 A;  2A19 A;  3S14 H;  1EY8 A;  3TSS A;  5I4D A;  1JOQ A;  1PFB A;  4O1N A;  4GKK Q;  4U67 3;  4P2C B;  5BN4 A;  1VQG A;  1RCV D;  1TT2 A;  2F0N A;  1BCP F;  3GQB A;  2KEC A;  2F0Q A;  4DV0 L;  3K7U C;  2K6A A;  5I9O A;  2LXK A;  1PYS B;  3D8G A;  2HQL A;  5CBA E;  3AFQ A;  1FNV A;  5GQO A;  3D4D A;  5GAG C;  1X55 A;  3AMU A;  4GNX B;  2NBF A;  4RCN A;  1AEX A;  5C0X H;  4OO1 G;  2WB1 B;  4O2D A;  2O4X A;  1LTB D;  2SNM A;  3FHW A;  4GLV B;  3S2D B;  1V1Q A;  1NJI C;  4FF3 A;  4FXK C;  1SFO B;  1ENC A;  3NTK A;  1W2B A;  2AUK A;  1YNJ D;  1V1P A;  3J7A V;  3A8K E;  5AFW A;  4ID6 A;  4L8J A;  3RZD B;  4JI0 Q;  4RGM A;  2JBW A;  1G29 1;  2MJ8 A;  4JI1 Q;  2F6M B;  5IY0 A;  5F2D A;  2UUC L;  1TDP A;  3MWY W;  4KKU A;  4CJ1 B;  2IW3 A;  2RDF A;  2DY8 A;  1R9T H;  1CHQ D;  3KFU A;  1JWU D;  2LMC B;  2B29 A;  2XNA C;  4CDF C;  1KTK A;  1FJG L;  2TSS A;  1N33 Q;  3KOJ A;  4TVA B;  1CT1 D;  3GTQ B;  3LJ0 A;  4OEM B;  4DR2 L;  3HOV G;  5E4W C;  1HA5 A;  2UXB L;  4N9T A;  1WTW A;  1SE4 A;  4UP7 A;  4I1T A;  3JC6 6; 
#chains in the Genus database with same CATH homology
 3PUX A;  1LTL A;  1QZG A;  3CW2 C;  3S1Q H;  4Y7N H;  2NVX H;  3G48 A;  3S17 H;  4PL5 A;  2XTR A;  2A2D A;  2E5L L;  1L1O C;  2AMC B;  2KHJ A;  1RIP A;  2HT1 A;  5IYD H;  4Z7G A;  3UDX A;  4AYB E;  3T1H L;  1Y1W G;  1PH3 A;  3PGZ A;  4QIW E;  3RLO A;  1VQ7 A;  1KL9 A;  4DV6 L;  2ZTD A;  1JB7 A;  2Q2T A;  4JBK A;  4GLA C;  1K9M C;  5IWA Q;  2Q2H A;  4JI5 Q;  4NV2 A;  4RMF A;  1YBY A;  4QGU A;  1BKB A;  1QVC A;  2JB3 A;  2IT1 A;  3W1G A;  1SFO H;  4K0K Q;  1XTD A;  2VS1 A;  4HJ9 A;  3RLN A;  1N36 Q;  3SDJ A;  4DV1 Q;  3F8T A;  4LF9 Q;  3M4P A;  4LUV A;  3KF8 B;  4GN4 B;  3S1N H;  2N8N A;  2KKM A;  4P73 A;  4MZ9 A;  3RN5 A;  4P71 A;  5GAH C;  2OWO A;  4KHP Q;  2AWN A;  2F3I A;  3M4O H;  5LMU Q;  2P22 B;  4BBS G;  5IYB G;  1IBL L;  2BH8 A;  4HIO A;  5M5X H;  2YU9 H;  3I56 A;  1FVI A;  2UUA L;  3I55 A;  1IL2 A;  3RZO H;  4X65 Q;  5IT9 c;  1TXY A;  3L0O A;  4PZ8 A;  1EQQ A;  3A5Z B;  4LFC L;  4YY3 Q;  1SE8 A;  3CPF A;  1HNX Q;  4DR5 Q;  2MFI A;  1GM5 A;  3HKS A;  4KHZ A;  1L0W A;  1X9N A;  3PF4 A;  2N49 A;  2XTQ A;  4R4T A;  1HZB A;  4Q9V A;  2E2H H;  3TRZ A;  1X54 A;  4LW1 A;  2HHH L;  2NN6 G;  3CCM A;  5EAY A;  2A2C A;  1H95 A;  1J5E L;  2CCZ A;  1C0A A;  1TWA H;  1CSQ A;  1VQA A;  4KI0 A;  4LWC A;  1K3R A;  3J81 j;  3F2B A;  1IBL Q;  3HOU G;  1AH9 A;  1QUQ A;  5ELN A;  4AIM A;  1VQM A;  2DGY A;  5C44 H;  3PIP A;  5LMU L;  2JA5 H;  4UP8 A;  4KHP L;  4ME3 A;  3I2Z A;  1M90 C;  3IAS 1;  2D0O A;  3GTO H;  3KDF A;  3M3Y H;  2JA9 A;  3JAM c;  4DK3 C;  3AYH B;  5M3F G;  1UE1 A;  1CKN A;  1I94 Q;  4IPH A;  4R4Q A;  3FKI H;  2VNU D;  2IY5 B;  2JEB I;  4X66 L;  4YZ9 A;  1KXL A;  2PI2 E;  3AJF A;  3K81 C;  1E3P A;  4NXN L;  1YEZ A;  3S2D H;  5LMN L;  4AH6 A;  2BA1 A;  5AJ3 Q;  1A0I A;  1SJ8 A;  1VQL A;  3I9V 1;  4X64 Q;  1HZ9 A;  1NTG A;  3CCJ A;  1YJW A;  1GO3 E;  4G75 A;  5E7N A;  1B70 B;  4POG A;  4H02 A;  2V6E A;  3DA3 A;  4QL5 A;  3CCU A;  1N32 Q;  1GD7 A;  2R92 G;  4JI2 L;  3KJP A;  2VZA A;  4LF8 L;  3S15 H;  3P23 A;  2HIV A;  3KF6 B;  3DO9 A;  4A3D H;  4A93 G;  2F66 B;  4A76 A;  2UXD Q;  1XPO A;  2QA4 A;  3GTL H;  3J7A 5;  4B3R Q;  4DR6 L;  1Y1V G;  1FJG Q;  5H1S E;  4LF4 Q;  4IFD G;  4NB3 A;  2JA6 H;  4DR3 L;  3ER0 A;  5FLX c;  4B3S Q;  3H3V I;  4JYA Q;  2JA8 H;  4WJ4 A;  3I4O A;  1LM0 A;  1EOV A;  3DM3 A;  1WJJ A;  4JI0 L;  3OW2 A;  4EX5 A;  2Z6K C;  3J81 i;  2ES2 A;  2KCM A;  2ALY B;  1EIY B;  1FL0 A;  4DAM A;  2JA5 G;  2JB2 A;  1XNR L;  3CC2 A;  2VQE L;  4DUY L;  4LF5 Q;  3HOZ H;  4C3I H;  1TWG H;  4DV5 Q;  1CKO A;  1NBW A;  2C35 B;  3W5O A;  1YHA A;  4B3S L;  5M3M H;  2L1L B;  3JAM i;  1Q1B A;  2WFW A;  3PCO B;  5AJ3 L;  1I94 L;  3MXN B;  4DV7 Q;  3DA4 A;  1JJC B;  1Y1W H;  4B3R L;  4JI6 Q;  4A3F H;  1SMX A;  4LUO A;  1YJN A;  4BY7 G;  4IPG A;  2Y0S G;  3I4N G;  2R7F A;  3CP0 A;  4L5Q A;  4YWM A;  4DV4 Q;  1EYG A;  3RZD H;  3A74 A;  4OWT B;  3RNU A;  4JI7 Q;  1CKN B;  4OAU C;  3CCL A;  1Q12 A;  4C3J H;  1X6O A;  2JAE A;  2AHO B;  4DR7 L;  4A3K H;  2F52 A;  4DWL A;  2YYZ A;  1I5F A;  3UE1 A;  5IP9 H;  2OTL A;  2ASB A;  4X65 L;  5C0X J;  1J6Q A;  1SRO A;  5JJI A;  4XIG S;  4LFA L;  4PG3 A;  3HOW H;  1PYB A;  3LGJ A;  3UE0 A;  2ZJR A;  5LMN Q;  1QVG A;  1JMC A;  1VQ8 A;  1MJE A;  3NBH B;  2Z6K A;  2JJQ A;  5C0X I;  4ALP A;  4LF6 L;  2XTI A;  4JI3 L;  3CCS A;  3OYY A;  1IZ6 A;  2MQH A;  2E8G A;  4HIK A;  2OCE A;  2EXD A;  4DV3 L;  3M4Q A;  1CKM A;  1UE5 A;  1GKH A;  2JA6 G;  2E2I H;  4DUZ L;  3IRB A;  4GKJ Q;  4A3M G;  1UE7 A;  2VQF Q;  4GOP C;  3S1R H;  1XMQ Q;  4OO1 I;  4A3L G;  1JE5 A;  2WB1 G;  4JI5 L;  3M7N A;  4BBR G;  5IWA L;  3FBV A;  4LUZ A;  1QUQ B;  2RHQ B;  4LF6 Q;  5C44 G;  1SRU A;  3H15 A;  2NVT H;  5IYB H;  3PO3 H;  2YTY A;  2QEX A;  4LFA Q;  2ATW A;  1S3O A;  1XPU A;  2K5N A;  2UUB L;  3TQY A;  4O1P A;  3GDE A;  4MTN A;  4YCV A;  4YZD A;  4YCW A;  3ULL A;  3J81 c;  3HOX H;  4DR1 L;  3T1H Q;  1J5E Q;  3I4M H;  3TS2 A;  4GKJ L;  4A3L H;  1Y14 B;  2BH2 A;  1KRS A;  2K14 A;  1OXU A;  1KIX A;  3CC4 A;  1VQB A;  5GAE C;  3KJO A;  4DR5 L;  3HOZ G;  1RL2 A;  3SGI A;  3G6E A;  4P74 A;  4R1J A;  1Q1E A;  4YHH Q;  5IYC G;  2B63 H;  2UUA Q;  3I4N H;  1FGU A;  3HFZ B;  3K0X A;  5HY6 A;  5DLQ E;  3L0I A;  2KEN A;  2NZH A;  2ZM6 L;  2OQK A;  3CF5 A;  5LNK 1;  2H5X A;  5C3E G;  3J7Z C;  4LFB L;  2HHH Q;  1Z9F A;  4BY1 H;  1HZC A;  3J80 i;  3H3V H;  1L1O A;  4JCV E;  3KP9 A;  2K52 A;  4JBJ A;  1N33 L;  2R93 G;  3FKI G;  2CQO A;  2K75 A;  1AE2 A;  1IBK L;  4L5R C;  1YHQ A;  5JJK A;  4UPA A;  1DGS A;  2UXC Q;  1B7Y B;  1SLJ A;  4MNO A;  1K8A C;  1XNR Q;  3HOW G;  2FUG 1;  3PUW A;  3CME A;  3PO2 H;  3S24 A;  4J15 A;  1VQ6 A;  4DV6 Q;  3KLW A;  1YIJ A;  4FDB A;  1N8R C;  3AQQ A;  5ELO A;  5M5Y H;  2VUM H;  5BR8 Q;  4UP9 A;  1OXT A;  1OXX K;  1Y1V H;  4JI1 L;  4YWK A;  4OAV B;  4HJ5 A;  1PH9 A;  4A3B G;  4LF4 L;  3GTG H;  4IOC A;  3PF5 A;  1N9W A;  4WJ3 M;  4O0A A;  3H0G H;  2PNH A;  4OWW B;  1MKH A;  3TRE A;  1XPR A;  4LF5 L;  3GTM H;  3ULP A;  4OX9 Q;  3GO5 A;  1LYL A;  1VCI A;  1YI2 A;  5JEA J;  1MIU A;  1U0L A;  2UXC L;  1KHI A;  5FLM H;  2UU9 L;  4NV5 A;  4QJF A;  4HJ7 A;  1VQH A;  4PZ7 A;  4GXT A;  3HOV H;  2PI2 A;  2F4V Q;  3HOU H;  4R4I A;  3CCE A;  3LJ1 A;  3RR5 A;  4DR4 Q;  1A62 A;  4AQY L;  2RIO A;  1VQ4 A;  1Q82 C;  2ZTC A;  3HOX G;  2F4V L;  2UXD L;  4X64 L;  2UU9 Q;  1CSP A;  5IYC H;  1QVF A;  3EBE A;  1VQO A;  2B63 G;  3GTK H;  1KAW A;  1G6P A;  1E1T A;  3M9B A;  1CUK A;  2B3G A;  4OX9 L;  1A63 A;  2MJF B;  1G51 A;  1OXV A;  1PA6 A;  1QZH A;  1K0R A;  4A3E H;  4P72 A;  4OXP A;  1XMO Q;  5M3M G;  3K7A H;  4XTC S;  4NPS A;  4GN5 A;  3KYH C;  4YZC A;  4RG1 A;  5C3E H;  4IFD I;  2YTX A;  4A3J G;  2R93 H;  2JB1 A;  3HOY H;  5HGI A;  3PUY A;  4DKA C;  3PO2 G;  2K4K A;  4PL4 A;  1JJG A;  4PMW A;  4HFV A;  1YHB A;  2MO0 A;  1PH7 A;  1N34 Q;  1EFW A;  4KLK A;  3K8A A;  2VQF L;  2XGT A;  1XJV A;  1Q81 C;  4TQU S;  4DUZ Q;  1KC8 C;  2CFM A;  4IPC A;  1K8G A;  4LNQ A;  4A3B H;  1TWF H;  3A5U A;  1O7I A;  2CWP A;  4DV3 Q;  2MNA A;  4A3K G;  4YCU A;  2AWO A;  1PV4 A;  2A8V A;  4DNI A;  4LFB Q;  3NEN A;  4YY3 L;  3T1Y L;  4HJA A;  4A3I H;  2PQA B;  5IE8 A;  3UDG A;  4B3M Q;  1M1K C;  2ZRR A;  4A93 H;  3S16 H;  4G76 A;  1EWI A;  5C4X G;  2WP8 J;  1X3G A;  5JJL A;  3KDF B;  4YHH L;  1PH6 A;  2AKW B;  3T1Y Q;  2JE6 I;  3TS0 A;  4GLX A;  3E9I A;  1ASZ A;  4POF A;  3GTJ H;  2JK8 A;  2WAQ G;  3LJ2 A;  3F2C A;  2LSS A;  1LUZ A;  5FLM G;  2D0P A;  1E22 A;  3RN2 A;  1S72 A;  1HNX L;  4L5T A;  1YO7 A;  4DR1 Q;  2RCN A;  5M3F H;  4DV0 Q;  2D62 A;  4GNX A;  4EQ5 A;  4X62 Q;  3OTO L;  1SR3 A;  1I3Q H;  2Y0S E;  1C7Y A;  1K83 H;  4JBW A;  1OXS C;  5HGQ A;  4JI8 L;  1E24 A;  2KCT A;  4A3F G;  1HH2 P;  3W1B A;  4BA2 I;  3EN2 A;  3STB D;  4BXX G;  3E0E A;  3CCR A;  3PUV A;  2LXJ A;  4PL3 A;  3CPW A;  4R4C A;  1L1O B;  3EIV A;  3CC7 A;  1L2F A;  1N36 L;  5IYD G;  1N33 Q;  4A3C H;  1X65 A;  3L7Z C;  1I6H H;  1XMO L;  2OQ0 A;  1VQ5 A;  1WFQ A;  1HR0 L;  3BZC A;  4JI3 Q;  2EIF A;  2JQO A;  4X6A H;  4DPG A;  4HJ8 A;  1I50 H;  2NN6 I;  4JOI A;  2L15 A;  1VQE A;  3ICE A;  5FJ8 G;  1X3F A;  4GS3 A;  1V9P A;  1PH8 A;  3CXC A;  3CAM A;  4P75 A;  4A3J H;  4OWX B;  2R7Z H;  4DR3 Q;  1PFS A;  5GRO A;  1YIT A;  2PMZ E;  4DR2 Q;  1IBM L;  3A0J A;  4IPD A;  1KRT A;  1KD1 C;  1P8L A;  2QGQ A;  2ZJP A;  4DR7 Q;  2K5H A;  3H0G G;  1UWV A;  1WOC A;  4DK6 C;  4YWL A;  2K19 A;  3TEH B;  4DV7 L;  1PH2 A;  1HR0 W;  4UY8 C;  3ZJY C;  2R7Z G;  4BBS H;  4DV4 L;  4B3T L;  1HNW Q;  4R4O A;  4A3M H;  2JA8 G;  2CWA A;  3PSI A;  2N3S A;  3ERS X;  4JI2 Q;  3CCQ A;  4LF7 Q;  2CAZ B;  1EQR A;  4A3G G;  4JG2 A;  4AS3 A;  1GVP A;  2VW9 A;  4BBR H;  4GNX C;  1YNX A;  1C9O A;  2GVB A;  2MO1 A;  1JJ2 A;  2IX0 A;  1WCM H;  3BZK A;  1Q46 A;  4IO9 A;  5BR8 L;  3NEL A;  4JI4 L;  4JV5 L;  4DV5 L;  3ULJ A;  3F2D A;  4OON A;  4A3G H;  4HIM A;  4QQB X;  2VQE Q;  4DUY Q;  2YTV A;  2Q2U A;  3VA9 A;  1X56 A;  1YVC A;  3FP9 A;  2FXQ A;  4GOP B;  2Z0S A;  3GD7 A;  3BU2 A;  1U5K A;  1VQD A;  4GN3 B;  1VQN A;  1HR0 Q;  1Q7Y C;  3AEV A;  1BBU A;  2V1C C;  1IBK Q;  2UUC Q;  4IJH A;  4BXX H;  4DAY B;  3HKZ E;  4X66 Q;  3UDI A;  2IHF A;  4DV2 Q;  2ID0 A;  3HKZ G;  5IP7 H;  1YJ9 A;  2JA7 H;  1IYJ B;  1VQJ A;  4JOI C;  3G71 A;  4PZ6 A;  2E2J H;  1NMG A;  4IJL A;  2GVA A;  4LF7 L;  2YFB A;  3HOY G;  1AE3 A;  2ZM6 Q;  1KQS A;  5C0X G;  1SN8 A;  5J3B A;  1VQF A;  2NVQ H;  5IP7 G;  2JA7 G;  2HIX A;  3F4M A;  4JC0 A;  3CQZ H;  4LF8 Q;  3DLL A;  1TWC H;  2I5L X;  5C4J H;  3U50 C;  4BY7 H;  4HEA 1;  4BA1 I;  2KHI A;  2I5M X;  3M85 A;  1N32 L;  1HNZ Q;  1VQP A;  3IAM 1;  5JEA G;  3STB C;  1NMF A;  1PH5 A;  4LFC Q;  3UIT A;  1S40 A;  2ZTE A;  4NXM L;  3S2H H;  2VUM G;  1Q8K A;  1XNQ Q;  1MJC A;  3K80 C;  3GTP H;  4B3M L;  5C4X H;  4A4I A;  1Q86 C;  4A75 A;  4GOP A;  4U6R A;  2RF4 A;  2R92 H;  2GN5 A;  5IP9 G;  1VS0 A;  2WB1 E;  2I0Q A;  4NXN Q;  1BBW A;  3U4V A;  3F1Z A;  4GKK L;  1XMQ L;  4APV A;  1UEB A;  2A19 A;  4DV1 L;  4LF9 L;  3S14 H;  5M5W H;  1VQ9 A;  3D31 A;  1D7Q A;  1OTC A;  4C2M H;  4GKK Q;  3U58 A;  2UUB Q;  3I4M G;  1HZA A;  1N34 L;  4JI8 Q;  2EQS A;  1VQG A;  1PH1 A;  1JT8 A;  4X62 L;  3OTO Q;  1PH4 A;  3JSB A;  4JBM A;  2KBN A;  2K50 A;  1XNQ L;  1E7Z A;  4DV0 L;  1VQK A;  3K7U C;  2LXK A;  1PYS B;  1VQC A;  3WWV A;  2HQL A;  3AFQ A;  1HNZ L;  3PO3 G;  5GQO A;  2ZJQ A;  1WYD A;  1B8A A;  2DUD A;  3AFP A;  5GAG C;  1X55 A;  3VDY A;  4BY1 G;  4GNX B;  2IX1 A;  2R6G A;  1NY4 A;  4IOA A;  1EUJ A;  5GAD C;  2YFA A;  2CKZ B;  3UDF A;  1WI5 A;  4JI7 L;  1E1O A;  4OO1 G;  2JEA I;  2R7D A;  4O2D A;  2A1A A;  3CCV A;  2XMX A;  4NXM Q;  5K36 G;  2OTJ A;  4QY7 A;  1NE3 A;  3FHW A;  4GLV B;  1V1Q A;  1NJI C;  4AQY Q;  3BJU A;  4DR4 L;  1HJP A;  1V43 A;  4A3C G;  1T9H A;  2Q2I A;  4DV2 L;  4L5S A;  4K0K L;  1D8L A;  1W2B A;  3PIO A;  3RLF A;  3E9H A;  3U4Z A;  3KF6 A;  3L2P A;  1PHJ A;  1BVS A;  1VQI A;  2VY3 A;  1ASY A;  3I7F A;  3Q8D A;  4A3D G;  1YZ6 A;  5FJ8 H;  2RHS B;  3CD6 A;  2PQA A;  2BA0 A;  4JI0 Q;  4JI6 L;  4JI4 Q;  2N78 A;  4A3I G;  1G29 1;  4AYB G;  2NZO A;  1WCM G;  4JI1 Q;  2F6M B;  5IY0 A;  2UUC L;  4IFD J;  4HID A;  2E5L Q;  3D0F A;  1X3E A;  4Y52 H;  5LMN W;  4Z7H A;  1TWH H;  1PVO A;  1R9T H;  4B3T Q;  1HNW L;  3NEM A;  4O1O A;  3MEF A;  2IP6 A;  3B6Y A;  4C3H H;  3KFU A;  1K73 C;  2UXB Q;  4JV5 Q;  2B29 A;  2NVY H;  3G4S A;  4A3E G;  3GTQ H;  4JYA L;  3J80 c;  1Z47 A;  1FJG L;  2YV5 A;  3PV0 A;  2VL6 A;  2WAQ E;  1IXR A;  3KOJ A;  2IHE A;  4TVA B;  2K5V A;  3CMA A;  1P16 A;  4DR6 Q;  1IBM Q;  3LJ0 A;  4AS2 A;  4DR2 L;  2I5H A;  1W3S A;  1UE6 A;  3HOV G;  2UXB L;  1EIF A;  1A8V A;  3S1M H;  4UP7 A;  3PUZ A;  4I1T A;  3JC6 6; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...