3Q8DA

E. coli reco complex with ssb c-terminus
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
231
structure length
231
Chain Sequence
EGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of RecO recruitment to DNA by single-stranded DNA binding protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords DNA repair protein recO
total genus 67
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02565 RecO_C Recombination protein O C terminal
A PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3q8dA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3q8dA01
1I50H 4DR6L 2QA4A 3JAMc 3K7UC 1A0IA 1CUKA 3PUVA 3UDGA 4WJ4A 3ULJA 4KHPL 1BBUA 3I4MG 3H3VH 1SLJA 4BXXH 4XIGS 1Q1BA 3L0OA 1G291 2CWPA 3K7AH 3ICEA 3PIOA 4KI0A 1HJPA 1VQPA 1EFWA 4H02A 4IPDA 3WWVA 3G6EA 2R92H 3HOWH 4DAYB 2OCEA 3PUZA 4A3EH 2K4KA 4AYBE 1N36Q 3UDIA 1JJCB 5M3FG 3T1YQ 1JB7A 4BY7H 4IFDI 4DK3C 5J3BA 3KF6B 3JAMi 1VQEA 3TS2A 4PMWA 1JJGA 3I4NH 3HKZE 4IJHA 3CCRA 1K0RA 5C3EH 4QGUA 3EBEA 3F2DA 5M3MH 4R4QA 3M9BA 5M5WH 3KJOA 3T1HQ 1IBMQ 4QQBX 4HIMA 4GLAC 1XMQL 1CKMA 1Y1VH 1QVGA 2UXCQ 4DK6C 3PUWA 4P74A 5IP7G 5FJ8G 1HR0L 3U4VA 4DUZL 1WI5A 4IPHA 4DAMA 5M3MG 1I5FA 4GN4B 2HIXA 3Q8DA 2PI2A 3W1GA 2LXJA 5ELNA 4IO9A 4RG1A 3RZOH 2UXCL 1BBWA 2QGQA 3TREA 3FP9A 3H0GH 5IP7H 5C4JH 1IBLQ 1IL2A 4B3RQ 1M90C 4UY8C 3H3VI 3STBC 2OTLA 1X65A 2Q2HA 3KJPA 4DV4L 1N32Q 2UXDQ 2CCZA 3PO2G 2V1CC 2WAQE 1UWVA 4GNXC 1KRTA 3BZCA 1TWFH 2NZOA 4EQ5A 1HR0Q 1FVIA 2YTYA 5IYBG 1QZHA 1XJVA 2E2IH 2OTJA 1I94L 2BH8A 1GKHA 2PNHA 1SFOH 3DLLA 1VQMA 1J5EQ 1Q12A 4K0KL 3K8AA 1GO3E 2PI2E 3CAMA 4B3MQ 1MKHA 2VL6A 3GDEA 1V1QA 2DUDA 2K5VA 4MZ9A 4DR1L 4JI4L 4UPAA 1I6HH 2AMCB 2CWAA 3UE0A 1Q81C 1J5EL 2B63H 2F3IA 3GTOH 3S1QH 4JI3Q 4JCVE 4LF6L 2AKWB 2HIVA 1T9HA 3U50C 3CCEA 2JA5G 1X6OA 2Q2IA 2R7DA 4HJ8A 4DR7L 4A3IH 2A19A 2KHIA 1PV4A 2IX1A 2QEXA 1EQRA 4GN3B 2ZJPA 4DV6Q 1PYSB 3KDFA 4PG3A 2DGYA 4OWWB 1MIUA 4A3DG 4X65L 1N34Q 1PVOA 4OO1I 1KHIA 5FLXc 2VUMG 1HZ9A 4IOAA 2RHQB 4JBMA 4POGA 1EIFA 1YZ6A 4JC0A 4P75A 1K83H 1IYJB 4A3FH 1H95A 1L1OC 4DV1L 1Q82C 3CPFA 2K5HA 1PH7A 3PF5A 4JI2Q 2E2HH 4JI0L 2VUMH 3HOZH 2MO1A 3T1HL 1IBML 3HOXH 1OTCA 2I5HA 1VQFA 3PF4A 5K36G 3CCVA 2MQHA 4A3LG 4LUOA 5GADC 3F2BA 1KL9A 1FJGL 4BBSG 3OTOQ 4LFCQ 4JI5L 5C0XI 1HNXQ 4YWMA 3EN2A 2R7ZG 2ES2A 3KOJA 4DR5L 2JA7H 1S3OA 3I4NG 4B3ML 4RMFA 4LF9Q 4DUZQ 3F1ZA 3RLFA 3I4OA 5GQOA 1KQSA 1JMCA 3AYHB 4C3IH 3CC4A 4PZ7A 4X64Q 4DR3L 3ER0A 2JA6H 1EOVA 1X3EA 1RL2A 4JOIC 1KRSA 2MNAA 4YCVA 3OW2A 4GOPB 4DUYQ 4UP7A 2EIFA 4A93H 2YTXA 4JI8L 4LFBL 1L1OB 5BR8L 2GN5A 1XMOL 1XNRQ 5LMUQ 2K14A 3A5UA 1YBYA 4A3KG 5FLMH 2HQLA 1V43A 3PO3H 1HNWL 4AIMA 3TEHB 3H15A 4HJ9A 3ULPA 1LM0A 4B3TL 4GN5A 3RLNA 2HT1A 3AFQA 4EX5A 3RN2A 1MJEA 1XNQL 2BH2A 2UUAQ 3HKSA 4IPCA 3SGIA 3STBD 4A3MH 2NZHA 5C4XH 1HNXL 3GO5A 4JV5L 2XTIA 3OTOL 1C7YA 4OX9Q 2H5XA 3U4ZA 4GKKQ 4DNIA 1PH3A 2ZTEA 5GAEC 3K81C 4A3BH 3MXNB 4OXPA 5ELOA 5IYCG 4APVA 1YJWA 1U5KA 5JEAG 1HZBA 2VW9A 1B7YB 2Y0SE 4YCWA 1Q46A 3KYHC 1E22A 4GKJL 3PGZA 4A4IA 5JJLA 2A8VA 5C44H 4L5TA 3KDFB 2E5LL 2K5NA 1PH6A 3RZDH 4LW1A 1VQ5A 1NY4A 4A76A 3S17H 2UUCL 4AH6A 4BY1G 4A3GG 5IYDG 2KHJA 1K73C 1EIYB 1HNWQ 2UXDL 1GVPA 2R7FA 3AFPA 4HIDA 4POFA 1VQKA 1VQCA 2KENA 3PIPA 3HOXG 1ASZA 1KAWA 1EYGA 2I0QA 4C2MH 1J6QA 3AEVA 1YIJA 4KHPQ 1C9OA 3L7ZC 2YYZA 3PUYA 2OQKA 3KF6A 1YHBA 1N9WA 2PMZE 3S15H 1SMXA 4GS3A 4C3HH 3GTLH 4UP8A 4FDBA 1P8LA 3CW2C 2VS1A 4DR7Q 4A3JG 3M4OH 2R7ZH 4Y52H 4JBWA 1HR0W 1SN8A 4YY3Q 5GAHC 1OXSC 4KHZA 3HOZG 4AQYL 1XPUA 1UE7A 3UDFA 1EQQA 4GLXA 2Y0SG 3S2HH 2AHOB 1FGUA 1KD1C 1UE6A 3UE1A 5C0XJ 1VQIA 4DR1Q 2FXQA 4GLVB 3AQQA 1WYDA 1R9TH 1N8RC 4DR6Q 1HZAA 5IWAQ 2LXKA 4YHHQ 3JC66 1PYBA 1LUZA 1Q8KA 4LWCA 3FHWA 1B8AA 1TWGH 2JA9A 1I94Q 4LF7Q 2UUBQ 1VQBA 2JA7G 4A3KH 3GTJH 3PO2H 4LNQA 4DV0Q 1KIXA 4JBKA 2IHEA 4L5RC 2ZTCA 2ALYB 3TS0A 3HOUG 3H0GG 3I7FA 4IPGA 2VQFL 2JEAI 3A5ZB 1L0WA 1N33L 3S16H 1Y1WG 1IBKL 2PQAA 3BZKA 1HNZQ 1YHQA 3PSIA 4A3MG 2UU9L 4DV3L 1PH9A 2ZJQA 1MJCA 2ZTDA 4LF5L 4B3RL 4HIOA 5IP9H 1YHAA 3HKZG 1X55A 2CQOA 3KLWA 5AJ3Q 1VQOA 4NXNL 1K9MC 3CC2A 2B63G 3U58A 4A93G 4DR2L 2N78A 1Z47A 2JA8G 5EAYA 2WB1E 3D0FA 3KF8B 1VQDA 4NXNQ 5IP9G 4LF8L 1WFQA 2WAQG 2UUBL 1SE8A 2OWOA 4LUVA 3HOVH 2YV5A 2RCNA 4GNXB 3CCMA 4BA1I 1NBWA 4TVAB 4X66L 2D62A 3ZJYC 2F4VL 1W3SA 2ZM6Q 5IWAL 4OWXB 4B3SL 2VQFQ 1NMGA 3LGJA 5DLQE 1HZCA 1VQGA 3MEFA 1C0AA 1QUQA 1TWCH 1AH9A 2NN6I 3S1NH 2N3SA 5M5XH 4LF4L 4DV0L 2UXBL 4L5SA 3IRBA 2GVBA 2JEBI 3GTKH 4OWTB 2WFWA 3HOYH 1B70B 3E0EA 4JI6L 1YJNA 2C35B 4JBJA 4YWLA 2E2JH 4X62Q 4LF9L 2R6GA 4A3GH 2I5MX 3CCSA 2ZM6L 4OO1G 4JI8Q 2I5LX 3CMEA 1PH5A 1N32L 4X66Q 1D8LA 4J15A 1CKNB 3W5OA 3G71A 4JI1Q 4ME3A 3CCQA 4LF4Q 3M4PA 3GTMH 3TRZA 1UEBA 2JE6I 1VQ4A 3KFUA 2VNUD 1G6PA 3ERSX 3PV0A 4IFDG 1G51A 5HGQA 3PCOB 4A3DH 1VQNA 3NENA 4DR4L 4AYBG 3GTPH 1X9NA 1CSPA 3I4MH 3M7NA 1D7QA 5E7NA 1PH8A 1XNQQ 4MNOA 4MTNA 4BXXG 3J80i 2JA5H 4QL5A 4UP9A 4P72A 3BU2A 1E24A 2VQEQ 2KCMA 4A3IG 1V9PA 4QIWE 4QJFA 4LFAQ 1OXXK 3GTQH 1XMQQ 1PFSA 4A3EG 4NXMQ 1X3GA 1W2BA 2B3GA 2ATWA 4R4TA 4L5QA 3CXCA 3G4SA 2R93H 1JT8A 1Y1VG 5AJ3L 3A74A 3UDXA 1X3FA 4JI1L 4DPGA 4LF5Q 4LF8Q 2R92G 3HOWG 4DV7Q 3T1YL 2K50A 4LF7L 2L15A 4IOCA 4A3FG 2JA6G 5M3FH 4JYAL 1QUQB 2A1AA 5IYBH 4GKJQ 1K8GA 1Y14B 3S1RH 2Q2UA 3J7ZC 4DV7L 5LMNQ 4LUZA 5JEAJ 2BA0A 4HJAA 1WJJA 3HOUH 1K3RA 5C3EG 4B3TQ 5C0XG 4HJ7A 1LTLA 2Z6KA 2IY5B 1IZ6A 1EWIA 1OXUA 4P73A 5IY0A 1XPRA 3M3YH 4A3CG 2NVYH 1YNXA 4R1JA 3J80c 1L2FA 4DV3Q 4A3LH 4R4OA 2AWOA 1IBKQ 1HNZL 3OYYA 4O0AA 1KXLA 2ID0A 5BR8Q 1Q1EA 3S1MH 4JOIA 1SR3A 3RLOA 1NE3A 5FJ8H 4LFAL 4K0KQ 2VQEL 1Y1WH 1VQAA 2VZAA 4A3CH 4LF6Q 2RHSB 2WP8J 1X54A 2JJQA 1YI2A 2Z0SA 3M4QA 1Z9FA 4JI3L 4BA2I 5C4XG 4Y7NH 2Q2TA 2IT1A 4YY3L 3HOYG 1PH1A 3DM3A 5HY6A 3I55A 1BVSA 1EUJA 1E1TA 1QZGA 1JJ2A 5IE8A 2CKZB 5IYDH 4YWKA 1PA6A 1VQHA 4DV5Q 4WJ3M 1A62A 1K8AC 3I2ZA 1WCMG 3CQZH 3NBHB 2NVXH 1SRUA 5LMNL 4ALPA 4X6AH 1PHJA 3VDYA 5IYCH 4DKAC 1S72A 2LSSA 1UE1A 1P16A 3CCJA 4NXML 1U0LA 4JYAQ 2K52A 1X56A 3CPWA 2B29A 1YJ9A 1L1OA 3CP0A 2ZJRA 3S14H 1OXTA 1XPOA 2D0PA 1VQ6A 4OONA 3F2CA 4HIKA 3CCUA 1FJGQ 3M85A 3D31A 1Q86C 3J81c 1QVFA 2GVAA 1A63A 1A8VA 2EXDA 2N8NA 1GD7A 4IJLA 3NEMA 4B3SQ 3GD7A 1N33Q 5JJIA 2F4VQ 4JI7Q 3TQYA 1VS0A 1TWHH 4BBSH 5GAGC 3CD6A 1FL0A 2YU9H 2KBNA 3E9HA 1WOCA 1OXVA 1CSQA 4GNXA 2NVTH 3J7A5 5GROA 1SROA 4R4CA 4OX9L 2IX0A 4DV6L 3K0XA 3PUXA 4X64L 1VCIA 4A75A 4DR3Q 2E5LQ 1S40A 4JV5Q 5H1SE 3ULLA 2NVQH 2OQ0A 4X62L 4PZ6A 1I3QH 3NELA 4R4IA 1XMOQ 4XTCS 3RN5A 2Z6KC 4A3JH 1TXYA 3J81i 2MO0A 5IT9c 2MFIA 4O2DA 3L2PA 4DUYL 1VQLA 2R93G 2UU9Q 5LMUL 1QVCA 1N36L 1YEZA 2VY3A 4JI4Q 3G48A 3F8TA 3EIVA 1DGSA 1ASYA 1VQ9A 4GOPA 5LMNW 3A0JA 4JI6Q 1M1KC 1CKNA 3GTGH 3B6YA 1E7ZA 2WB1G 4JI0Q 4JI2L 4BY7G 1TWAH 4IFDJ 3CCLA 1JE5A 3CMAA 2IHFA 2UXBQ 5JJKA 3CC7A 3FKIH 1XNRL 4DR2Q 4TQUS 3S2DH 4PZ8A 4YHHL 4LFBQ 1E1OA 1PH2A 1O7IA 4DV4Q 4JI7L 3HOVG 1N34L 2RF4A 4JI5Q 4C3JH 2BA1A 2JQOA 1AE2A 1YVCA 4GOPC 4BBRH 1IBLL 4P71A 4NPSA 2UUCQ 3S24A 4DV2Q 2HHHQ 1RIPA 2JA8H 3FKIG 4GKKL 3HFZB 2N49A 2YTVA 1YITA 3BJUA 4DV1Q 2EQSA 1WCMH 1Q7YC 2XGTA 1AE3A 2ASBA 1E3PA 4KLKA 3PO3G 2UUAL 4DR5Q 1BKBA 2CFMA 1VQ8A 1GM5A 1LYLA 2KCTA 4BY1H 1VQ7A 4BBRG 2F52A 4LFCL 1NMFA 3E9IA 2JK8A 4DV5L 2D0OA 5FLMG 3I56A 2AWNA 5M5YH 4X65Q 5C44G 1KC8C 2E8GA 2K75A 4A3BG 1VQJA 1NJIC 1HH2P 3RNUA 1XTDA 2PQAB 3RR5A 4JG2A 4NB3A 1NTGA 4AQYQ 1IXRA 1PH4A 4DV2L 2HHHL 3K80C 3J81j 4DR4Q 4HJ5A 1UE5A 3CF5A 3W1BA 1CKOA 4QY7A 2NN6G 4YCUA
chains in the Genus database with same CATH superfamily
2M00A 1CFMA 1MBYA 1A0IA 1CUKA 3K5NA 3PUVA 3UDGA 2AQ1B 1NNXA 2XTQA 1BBUA 2K28A 3I4MG 3NUCA 3H3VH 4CKEA 4BBSB 1O80A 3ICEA 4KI0A 1HJPA 3WWVA 3HOWH 3QO2A 4P2CB 4A3EH 2K4KA 2PQEA 3UDIA 4IFDI 5ISRA 3J81E 4EQOA 5IOCA 4FXDA 4PMWA 1IKMA 3F2DA 3M9BA 5M5WH 4QQBX 3VR6A 4HIMA 2O5IC 1Y1VH 1IKLA 1DYQA 2BOSA 4KN7C 3U4VA 4DUZL 4IPHA 2XSCA 1STGA 2DY7A 5M3MG 2L11A 2HIXA 2PI2A 1ENCA 3TMEA 3K0YA 5ELNA 2P5ZX 5IP7H 3S17B 1SDFA 2FINB 2M9VA 4UY8C 2GSCA 1BDOA 1AFPA 5C44B 5C4ZA 3PO2G 2KCCA 2WB1B 1RD9D 2IL8A 1U9RA 2F0NA 4PL5A 5LHY1 1HR0Q 2YTYA 5IYBG 1XJVA 1I94L 2BH8A 1QJOA 2LKVA 1SXTA 4AYBB 1VQMA 1Q12A 4B3MQ 3TP6A 4DA2A 3I70A 3GDEA 1V1QA 2DUDA 4MZ9A 5DM73 1QB5D 3FPPA 4JK1C 1HPCA 4JI3Q 1SYBA 2YFBA 1CTMA 1CHQD 2V4DA 3FVVA 3CCEA 4B9WA 5KIXA 2Q2IA 2R7DA 4HJ8A 2CVRA 1MGSA 3MTSA 3Q22A 4DV6Q 5FKAC 4YZDA 4I7AA 4A3DG 4X65L 3MWYW 3U9OA 4OO1I 1KHIA 4JBMA 4POGA 3W3AA 2A69C 5EKLA 1EIFA 5J1ZA 1QILA 1L1OC 2HCCA 3NTHA 2EE1A 1KDBA 1WTRA 1I4RA 5CR3A 4ZQ3A 4JI0L 2VUMH 2MO1A 1OTCA 3HOXB 2I5HA 1VQFA 5K36G 5DM63 4LUOA 3F2BA 1KL9A 5ELDA 3J7AV 4TKOB 4LFCQ 5C0XI 4H0LC 3EN2A 4NMZA 2R7ZG 4FXKC 1TWCB 3KOJA 4DR5L 4U673 5I2XA 4DUZQ 3F1ZA 1PXUA 2L12A 1KQSA 3CC4A 2B2WC 2F0VA 4PZ7A 1I4GA 3HOVB 4JOIC 2FU2A 1KRSA 2B39A 1GUTA 4YCVA 4DUYQ 4A93H 1EZ8A 5BR8L 1XNRQ 4CDDC 1T5XD 2HQLA 1V43A 4HEA1 2XWBB 3ITPA 3TEHB 4AIMA 1L0YB 5FLMH 4K2LA 4B3TL 2WACA 4WORA 3C1EA 2HT1A 4NDXA 4RWSC 5KNDA 1XNQL 4H44C 3SGIA 4A3MH 2RDFA 3KLSX 4JV5L 2HCIA 3LWEA 4DNIA 2F0JA 3PO2B 5C5LA 3WOEA 1WTVA 4OXPA 1A2UA 1K0SA 1EL0A 1S4ZA 5CV8A 3VYTA 1E22A 1W6JA 1F2YA 1PFBA 1PMRA 2EYLA 2K5NA 3L9AX 3QB3A 3MXNA 4A76A 3NTIA 4BY1G 3OWFA 1EIYB 1HNWQ 1GVPA 1AP0A 3AFPA 4FVMA 1GXDC 4HIDA 3M4OB 2BE5C 5IT9L 1SJ8A 1TS3A 2E76C 2Z4HA 4C56C 4KHPQ 2PMZE 4KN4C 3S15H 4TSSA 4BBRB 5DNFA 3WOFA 4UP8A 1P8LA 4FXGC 4DR7Q 3SDZA 1YO7A 4Y52H 1LTSD 1MSGA 3FKIB 1OXSC 2Q8RE 1EQQA 3I8ZA 2F0MA 2Y0SG 1LLRD 2AHOB 4Q5VA 4IUNA 5C4HA 2O4XA 2LXKA 3DUZA 1PYBA 5D14A 4HMJA 5I9PA 2JB1A 3HG9A 3FHWA 4A3KH 4M8AA 1KIXA 4JBKA 2IHEA 2ZTCA 3Q0AA 1O78A 5JJZA 2DNEA 4ZLTF 3PSIA 3IAS1 3P23A 3V96A 3A8IE 4J8QA 2CQOA 2KQ3A 2B63G 2F0HA 3K59A 3OIQA 4UHVA 3U58A 1FGBD 3TZDA 3KF8B 5IP9G 4LF8L 3NQTA 1SE8A 1NBWA 1Y8NB 1Y8PB 4CJ2C 2D62A 1W3SA 2ZM6Q 4ZKBB 1SYDA 4OWXB 2VQFQ 4RKLA 5J22A 4B3SL 3BS1A 3M7GA 3S1NH 2N3SA 2UXBL 1ENAA 3GTKH 1B70B 3E0EA 3EVQA 3KBGA 5EBDA 2XIWA 2KEDA 4XYOA 2I5MX 4G57A 3CCSA 1EZ6A 2B8GA 4JI8Q 4YIJA 1N32L 2UXDL 3QWNA 4ME3A 3GTMH 1G6PA 1UEBA 3GV3A 3KFUA 1IW7C 1Z6HA 3ERSX 3TN2A 2HDMA 1VF5C 3IAM1 1EEID 4A3DH 3NENA 4DR4L 3URYA 3F2UA 4RHRA 1CK1A 4TRDA 4BXXG 2KVMA 5KNCA 2F0OA 2JA5H 4QL5A 4UP9A 1PTOD 4LK1C 1V9PA 4QIWE 4QJFA 4LFAQ 1OXXK 2CH4W 1PFSA 1X3GA 4L5QA 3CXCA 4E6IA 3G4SA 2A74C 5M3FB 2CQAA 3I4LA 2EYOA 1X3FA 4LF5Q 2NVTB 4HAEA 4DV7Q 3T1YL 1A3VA 3HKZB 4IOCA 4A3FG 3MXPA 5M3FH 1LV9A 2F0KA 2A1AA 5IYBH 1U4PA 1K8GA 4M1UB 3VYRA 3J7ZC 1WJJA 1ILPA 1K3RA 5C3EG 1LTLA 1HRJA 1IZ6A 2NBFA 3R93A 2EPBA 2JA5B 1WD0A 1HXYD 1HTPA 1IBKQ 2D2CC 1QG7A 4XQQA 3E5SA 2L4NA 2ID0A 3S1MH 1EY0A 1G2SA 1RF2D 1EIHA 1NE3A 4AS3A 5EBCA 1PRTB 4LF6Q 2XTRA 3K5MA 2M2LA 2WP8J 2JJQA 2Z0SA 1NSNS 4CGYB 2G5DA 2Q2TA 3HOYG 1LTAD 1PH1A 1FR3A 1BVSA 1E1TA 2BL8A 1ZEQX 2A6HD 2EDGA 3HOZB 5IYDH 3N6RA 3LX0A 4U68A 4WJ3M 4GXTA 2O2LD 1K8AC 1TY0A 3FPUB 5LMNL 5I2YA 3VR4A 4ALPA 4I7ZC 1S72A 1WD1A 3CCJA 1U0LA 3J80E 1UAPA 2K52A 3CPWA 3DM1A 3VA7A 2F0QA 1OXTA 2D0PA 4HIKA 3QOJA 1H9SA 3M85A 1K8MA 1G6ZA 3HOUB 2J0TD 1QVFA 1A8VA 2C9OA 5JVG3 4Q9VA 5CGKA 4C3HG 1N33Q 5JJIA 2SOBA 5GAGC 4IUTA 1CSQA 5GROA 1NAPA 3Q6SA 1A2TA 2IX0A 4DFAA 3GTOB 3P1HA 5H1SE 2NVQH 2OQ0A 1YNNC 3LNNA 3HZXA 2MJFB 1I50B 1XMOQ 4KV6A 4RCNA 3GTQB 1B3QA 1B50A 5D3IB 5CC4A 5LMUL 1N36L 3R2TA 3I4MB 5AFWA 1ASYA 1VQ9A 2B2WA 2JAEA 4JI2L 4BY7G 1EY8A 3DWAA 1TWAH 3CCLA 1JE5A 4DAPA 2AUJD 1WTOA 3FKIH 4PZ8A 2EY5A 4LFBQ 2F0LA 3HOVG 2RF4A 3GV6A 4GOPC 1HHVA 4BBRH 3I90A 4NPSA 1I6HB 2JA8H 3HFZB 1PTOF 2R3ZA 1YITA 3AB9A 5M3MB 4F87A 2PMZB 3PO3G 1E3PA 2UUAL 5C3EB 4BY1H 1LYLA 1VQ7A 2F52A 4PL4A 2RSOA 3E9IA 3QOLA 2E75C 3I56A 4RHSA 1VMCA 2OXPA 5IGFA 4X65Q 1KC8C 4QF4A 4A3BG 4MIUA 1H9SB 2K01A 1XWEA 1NJIC 2PQAB 4DV2L 2G9HD 2HHHL 3MVVA 3J81j 1I4PA 4HJ5A 5JAVA 1EY9A 1UE5A 1YNND 1CKOA 4YCUA 3PMFA 2QA4A 3JAMc 3CRLC 1LTID 3BDCA 4K6DA 4X3KA 5IT9E 3UITA 1Q1BA 3L0OA 1G291 1EFWA 1AH9A 2R92H 4DAYB 2OCEA 1N36Q 1JJCB 1JB7A 4XT1B 4DK3C 5CORA 1F9RA 3KF6B 1JJGA 1VQEA 3TS2A 1JOOA 3I4NH 3CCRA 2C5CA 2R7ZB 1B2TA 4QGUA 3EBEA 1G8ZD 2IW3A 2B2VC 1W6KA 5IGDA 5KNBA 2UXCQ 5FJ8G 4HMIA 1TR5A 5E4XA 4YZ9A 1I5FA 1R4QB 2EY1A 1SYGA 4IO9A 1BBWA 5C4JH 4B3RQ 3H0GH 1IBLQ 2YFAA 1G91A 4AS2A 3KJPA 1N32Q 2UXDQ 2V1CC 1A15A 5C3XA 1KRTA 1KAAA 3PIP3 5FO7B 1STHA 1GKHA 2PNHA 4KK7A 1J5EQ 1GO3E 3K5OA 1WTXA 2JB3A 3C46A 4H7BA 4R8IA 2K04A 1A6XA 2AMCB 2FFKB 3S1QH 4OGQC 3LJ2A 5CBEE 2KJXA 5DAUA 2QGMA 4JCVE 4ZUIA 2QSBA 2F4IA 2HIVA 5CV7A 3U50C 2JA5G 4DR7L 2DNCA 4U6RA 4G75A 2KHIA 1PV4A 2IX1A 1EQRA 2ZRRA 4K8IA 2EYJA 3FMCA 3I72A 2P22B 2JA6B 3KDFA 4PG3A 2DGYA 3EA6A 1N34Q 1PVOA 5FLXc 4IOAA 1EEFD 1A3UA 4DK0A 2XRSD 1YZ6A 4JC0A 2SDFA 4A3FH 5E3FA 1Q82C 1LT5D 1DM0B 2Z9HA 2HD3A 2NZ1D 2RVLA 1SE2A 5LL6X 2E2HH 3D6WA 4ZAIA 3V05A 3PF4A 2MQHA 5GADC 2E2HB 3FBVA 3BVGA 4Z9CB 1STAA 2A68C 4JI5L 3OMGA 1FNVA 2NUCA 4B3ML 4RMFA 4LF9Q 2RLDA 1JWMD 1J9OA 4V190 4JVZA 5GQOA 2G9DA 2NVYB 1BNZA 2VB2X 2JA6H 3ER0A 2MNAA 2ZT9C 4GOPB 4KTAA 1D5XC 2EIFA 4UP7A 1BR9A 2ZXOA 4JI8L 4ID6A 1XMOL 2K14A 3KLRA 4PV1C 4K5VA 4UAIA 3ULPA 1LM0A 3KBXA 2ENBA 2R93B 3HKSA 1S5ED 3STBD 4R8NA 4PL3A 1C7YA 2DJGC 3NTKA 2X6GA 3KK7A 4OX9Q 2H5XA 1PH3A 3PIO3 3MXNB 5ELOA 5IYCG 3OWEB 4ME5A 3JSBA 2F1MA 4MHEA 2Y0SE 4RGTA 4YCWA 2N88A 4GKJL 5M5YB 3PGZA 5JJLA 2A8VA 2E5LL 3KDFB 3AMUA 2TMPA 4ZCKA 5EGTA 1KLUD 4AH6A 4FF1A 1GUOA 1K73C 1KABA 1STYA 4EGVA 4POFA 1VQCA 2JP1A 4C2MH 1UEAB 2B2YC 2CW0D 2QKIC 1S5BD 1GUNA 4QCLA 2ETDA 4CDEC 4C2MB 3VR2A 4C3JB 2R7ZH 4JBWA 1HR0W 4YY3Q 3NXWA 3I4NB 2A2DA 3S2DB 1UE7A 4JPBW 4DR1Q 1VQIA 5ELFA 1CM9A 2FXQA 2R92B 3EFXD 1N8RC 4YHHQ 1LUZA 3F4MA 5KYLA 4LWCA 1B8AA 4LF7Q 2UUBQ 2RQXA 3GTJH 4LNQA 4DV0Q 4L5RC 3J81L 2ALYB 3HOUG 1PRTD 1D5MC 3I7FA 1F2ZA 5C0XH 4IZ8A 2JEAI 2BE5D 3A5ZB 1Y1WG 1IBKL 4RGMA 2UU9L 4A3MG 4H13C 4LF5L 2RSNA 2ZTDA 1BOSA 4K8JA 1PFNA 1AW7A 4NXNL 1KTKA 2EXZA 1YNJC 3DWPA 3R3OA 2WB1E 1V1PA 2BL7A 1WFQA 5J39A 5M9OA 4HCSA 4ZK9B 1ESRA 2B2UC 2ZXPA 3DWQA 3DA4A 4TVAB 4BY1B 2F4VL 4HSVA 5NUCA 3MEFA 3UI2A 2NN6I 5IGCA 4LF4L 4C3HB 3IRBA 1AZQA 4OWTB 1ML0D 1TU2B 2FUG1 1DZ1A 4O1OA 4K2KA 2EJMA 1YJNA 1RTOA 2VB3X 4YWLA 5KYIA 2R6GA 1CZWA 4OO1G 4HN7A 3CMEA 4J15A 2JB2A 1B9NA 1D8LA 2ICEC 4N8X1 2R61A 5C5MA 3TRZA 2VNUD 2EVBA 3IFTA 1VQ4A 4A3FB 2KECA 3PV0A 1PRTF 1G51A 4DXFA 1Y69U 1BCPD 1JORA 4AYBG 3GTPH 3I4MH 1CSPA 1SNQA 3M7NA 3M4YA 1PH8A 3QIAA 3QR8A 5CV6A 3ERQA 3BU2A 4A3IG 5FO8B 3GTQH 1XMQQ 4A3EG 1W2BA 2ATWA 4IQZA 2K1BA 1MD2D 3SVMA 1EOTA 3A56A 3S9WA 4KHVA 3UDXA 4JI1L 2IP6A 1PLFA 4CKBA 4DPGA 4LF8Q 3HOWG 3S1QB 4LF7L 1Y8OB 2PPBC 2D5DA 1QUQB 2A69D 4IUQA 3S1RH 2Q2UA 2BCOA 4O1NA 5JEAJ 3HOUH 1JT8A 4B3TQ 5C0XG 4HJ7A 1EWIA 4A3CG 1XPRA 4KJNA 3OPOA 5EPLA 3M3YH 4A3LH 4R1JA 3K58A 1L2FA 4R4OA 4XXEA 5BR8Q 1Q1EA 2JA7B 1D6EC 5E1FA 4LFAL 2K6AA 2F0PA 2SNMA 4K0KQ 1VQAA 2VZAA 5JEAH 2ZW3A 1PDQA 3H0GB 5C4XG 5C4JB 2KKMA 5IGBA 3SR1A 3QG1A 3DM3A 4RKBA 5HY6A 3I55A 1ZXTA 1AEXA 3JAME 4DK1A 2CKZB 4YWKA 4KY7A 1HA5A 1U4RA 1A62A 1JQOA 3B55A 5M5XB 4R9WA 2JYOA 5IYCH 1X56A 4PMCA 3CP0A 1EFID 4FF3A 1VQ6A 3F2CA 1FJGQ 3OSOA 3LJ0A 1Q86C 3J81c 4A3IB 2GA4B 3NEMA 4LMQD 1VS0A 2X6LA 2MP1A 2KBNA 1OXVA 4GNXA 2NVTH 1ZKOA 3T16A 1D2BA 4OX9L 2F0FA 4X64L 3E0JA 3PUXA 4PNYA 5JVH3 2B63B 3K5LA 1S40A 1IYVA 2ICIA 2L1LB 4X62L 1I3QH 4IFDH 3RN5A 3D4DA 1HCZA 5IT9c 2MFIA 2RCFA 4G76A 1TWFB 2VY3A 3U9SA 3G48A 1DGSA 4GOPA 2A5HA 5LMNW 1QE6A 3A0JA 1CKNA 3B6YA 4JI0Q 2F66B 2F0EA 3IKJA 2IHFA 2JXMB 1LTTD 3RZOB 2UXBQ 3DA3A 5L37A 2EOTA 4MN3A 4TQUS 4YHHL 3OW7A 4HEDA 1MHWC 1O7IA 2PZTA 2JQOA 5IIFA 1AE2A 1JE4A 1IBLL 2JA8B 4C1NK 2F6MB 3S24A 1I6HH 3FKIG 1U4LA 2AUKA 4N9TA 1DJRD 5G3LF 1LT4D 3DEPA 2A73B 2XGTA 2F0SA 4DR5Q 1BKBA 3OOCA 1GM5A 2KCTA 4BBRG 1NMFA 4XT3B 4BY7B 1HQRD 2E74C 1TS5A 3TP5A 3RZDB 2D0OA 5FLMG 1PRTC 1BCPF 2AWNA 1HA6A 5C44G 3A8KE 2RDGA 1HH2P 1JWSD 1XTDA 4AQYQ 1IXRA 1PH4A 3K80C 3OHXC 4HR7B 3G7LA 4DR4Q 1XTCD 3W1BA 1I50H 3K7UC 5KGUA 1WTPA 4A3KB 1B53A 1S5DD 2CW0C 4ILWA 5FK9C 2HDLA 1SLJA 4ULLA 4J6HA 4O42A 4H02A 4IPDA 5IODA 3A7LA 3PUZA 3SDJA 1E2VA 2KHSA 2PCFB 3VR3A 1TY2A 3T1YQ 4BY7H 1ZYRC 4C3IB 3JAMi 1JB3A 3HKZE 4IJHA 1K0RA 4BS9A 4R4QA 3KJOA 1SNMA 3ND8A 1CKMA 2RKSA 3PUWA 1I4QA 3NHHA 1WI5A 4OEMB 4GN4B 2B2VA 4LAAA 3W1GA 3EJIA 4RG1A 3RZOH 2UXCL 2QGQA 4NV2A 2PW7A 4ZYSA 1SJED 2I07B 1IL2A 1M90C 3H3VI 1QNKA 3STBC 2OTLA 1KNEA 1X65A 2Q2HA 2WAQE 1UWVA 3G6JB 5LNK1 3S1MB 3BZCA 2LFNA 1TWFH 4EQ5A 2OF1A 1EY7A 3HRZC 1XXGA 1QZHA 2OTJA 1CA6A 1SFOH 3BYYB 2AQ3B 3A8JE 1JC7A 3DLLA 2IPKD 2PI2E 1H9KA 3DXJC 4XQNA 1RTNA 2K5VA 4JI4L 5E4WC 5LL6S 2B63H 1Q81C 3VYUA 2F3IA 3O13A 4LF6L 2AKWB 1LABA 1RHPA 5ELCA 3C3LA 1X3QA 2Z4IA 4A3IH 1STBA 2OT2A 1X32A 3HEJA 2ZJPA 1CQFA 2E2IB 5DEHA 1HZ9A 1RJTA 3DO9A 5ELBA 1HFGA 3EQLC 4P75A 3BVMA 4EQPA 4DV1L 3CPFA 1ICWA 2K5HA 3PF5A 4G7HC 2PW5A 3HOXH 1DOLA 3CCVA 4A3LG 1JOQA 2X69A 4Z7GA 4CHTB 5CV9A 4C3IG 1FJGL 3OTOQ 2B2TC 4BBSG 2KOLA 1HNXQ 1TVXA 3S1NB 3FDTA 5BN3A 2ES2A 2MGSA 2JA7H 1S3OA 4DU9A 1UUPA 1HQMC 3RUZA 1LTBD 1PYWD 3JAML 1JMCA 3AYHB 4X64Q 1KNAA 1EOVA 4G7OC 1RL2A 2I46A 1DD2A 1QOHA 3OW2A 1E2ZA 2L1BA 1BO0A 4LFBL 1L1OB 3K7AB 4K5WA 3VR5A 2GN5A 5LMUQ 3A5UA 2XWJB 3D8GA 3P75A 4GN5A 3AFQA 4NP5A 4OHJA 5EKIA 3RN2A 1GHKA 3MFGA 1MJEA 2UUAQ 1SEBD 1PTOB 2JSOA 2NZHA 4K14A 4C1NI 2A6HC 3U4ZA 3BG3A 3TZUA 1RKNA 2ZTEA 5GAEC 1C8CA 1FD7D 3K81C 4DXGA 4APVA 1YJWA 3W2DA 1Z7TA 2VW9A 1B7YB 4G4KA 1Q46A 3KYHC 4A4IA 1S5FD 2EYHA 5C44H 4L5TA 2Y0SB 1G2TA 4LW1A 1VQ5A 2RADA 3S17H 2EYFA 2A6EC 2KEEA 3ONAB 2B2UA 2KHJA 5IYDG 5F2DA 3DHQA 3X3NA 2KENA 3PIPA 2WKCA 2I0QA 1J6QA 3AEVA 1YIJA 1CI3M 2YYZA 3S15B 3KF6A 3NK9A 1YHBA 1Y1VB 1PTOC 1SMXA 2RDHA 1SYEA 4C3HH 1EU4A 3HP3A 3CW2C 5M5WB 2VS1A 4A3JG 3M4OH 1UNSA 1SN8A 1U4MA 1CHPD 1DOMA 4AQYL 2DY8A 2F0GA 1XPUA 3UDFA 3D6CA 4GLXA 5T1IA 3S2HH 1HFNA 3ND9A 1GUWA 5C0XJ 3HOWB 4GLVB 1PZKD 1WYDA 1BCPC 5IWAQ 4KKTA 5CV4A 1F9SA 1SNDA 4K6LA 1Q8KA 1I94Q 2JA9A 1TWGH 2JA7G 3PO2H 3HGBA 4IN3A 3T4AC 3J80L 1HTLD 2VQFL 2IX3A 1L0WA 1N33L 3BZKA 1YHQA 4KD4A 2ZJQA 1IL8A 1PH9A 1H9JA 4B3RL 1V1PB 2F0DA 4HIOA 4DAYA 1RDPD 1TDPA 1X55A 4KD3A 1VQOA 1K9MC 1C48A 1S5CD 2YU9B 4A93G 4DR2L 2JN4A 2JA8G 3T13A 1LACA 5EAYA 2WAQG 3HOVH 2RCNA 4GNXB 4PMBA 1O7YA 2HUGA 4X66L 3ZJYC 2FEFA 1AZPA 5IWAL 1HZCA 1VQGA 3QJYA 1TWCH 3L3OC 1JCKB 4DV0L 3P7JA 1SMYD 1OO9B 1WTWA 2C35B 3NBHA 3C1FA 2E2JH 4X62Q 4CDFC 3T51B 2ZM6L 4G7ZC 2I5LX 2VUMB 1PH5A 3CCQA 4L63B 2JE6I 2WAQB 5HGQA 1EY4A 3NE5B 5HGIA 1X9NA 3TP8A 5E7NA 3TBIB 2QDLA 1M4VA 4WFN3 5HURA 3Q23A 4HCEA 4P72A 2VQEQ 2KCMA 1K28A 3D4WA 4J1MA 4NXMQ 1JWUD 2B3GA 4NKLA 4R4TA 2R93H 4IUVA 1A3TA 2R92G 3IAYA 2K50A 5FO9B 3I91A 1FYCA 1F9PA 4RCOA 4JYAL 4X3SA 4S3SA 1Y14B 3BYTB 1B9MA 4DV7L 3LWUA 4LUZA 2KUMA 2E2DC 3FVQA 2IY5B 2Z6KA 1F77A 4P73A 1FNUA 5KRUA 2LMCB 5IY0A 5JOBA 4IUUA 1B44D 1F9QA 2NVYH 3J80c 5JPNC 3S14B 4F8MA 1K8OA 3CU7A 4YZCA 2AWOA 5D65A 1HNZL 3OYYA 1KXLA 2PZWA 3IFDA 1GUGA 1SR3A 3RLOA 5FJ8H 4A3CH 4HTHA 1BCPB 1X54A 1BUVT 1YI2A 5BN4A 1Z9FA 4BA2I 1D5ZC 1TT2A 3FRPB 4Y7NH 4RGOS 2E2JB 1QZGA 5IE8A 4L8JA 1PA6A 1VQHA 4DV5Q 2H4OA 4ZRZA 1WCMG 4DNTB 3NBHB 1SRUA 1PHJA 1LO5D 3VDYA 4DKAC 1UE1A 4JYAQ 4WJWA 2V6EA 3K57A 1YJ9A 2ZJRA 5C6AA 1PZID 1SMYC 1XPOA 3WDNA 3CCUA 1SAPA 2D9UA 1A63A 4IJLA 1GD7A 3GD7A 4JI7Q 3TQYA 2RIOA 3KF8A 4ODGA 4BBSH 1FL0A 1X3PA 3VYSA 2YU9H 1SNOA 3E9HA 1WOCA 1VDZA 1DXMA 1SROA 4R4CA 1Q90A 2QCPX 4DV6L 3K0XA 4DR3Q 1VCIA 2E5LQ 2SNSA 3TSSA 4PZ6A 3NELA 4R4IA 3NWSA 4A3JH 1TXYA 3J81i 1VF7A 4DUYL 2R93G 1FNWA 1TWGB 1QVCA 1D1IA 4JI4Q 3F8TA 3EIVA 2F0UA 4B08A 4JI6Q 1M1KC 1QCBD 4OAVB 3CMAA 3S2HB 3CC7A 3L0IA 1KDAA 4N8FA 1E1OA 1Q3LA 1PH2A 4JI7L 3FEWX 1N34L 4JI5Q 3VA9A 1WCMB 4ZKCB 1PZJD 4P71A 2UUCQ 4GKKL 4DV2Q 2HHHQ 2A6ED 2N49A 2YTVA 4ABNA 3SK6A 1Q7YC 2Z1CA 2ASBA 5A2QE 1EQTA 3IL8A 1E0BA 1VQ8A 5FLXE 4CJ1B 4LFCL 2CAZB 2EYMA 1BQQT 2JK8A 4QB4A 4MTKA 4DV5L 1DONA 3GTGB 1EWHA 2OEOA 2Z8LA 1VQJA 2F0WA 2NB0A 3RR5A 3R8BA 4NB3A 2RBMA 1RODA 2MUYA 4EVOA 2XNAC 1WTQA 2A2CA 4QY7A 2NN6G 1PTOH 1B3AA 4DR6L 2L5TA 2SEBD 3H09A 4WJ4A 3ULJA 4KHPL 2WV6D 3PQIA 1NR4A 3MZ5A 4BXXH 1LTGD 4XIGS 1TWHB 2CWPA 3K7AH 4DN4M 3PIOA 2K33A 2BDNA 1VQPA 1BF4A 3G6EA 3A55A 4RH6A 1R9TB 1QNUA 2PNRC 3BVZA 4AYBE 5M3FG 2J4XA 3MC0B 1GHJA 5J3BA 5C3EH 3NWTA 3DEOA 3CKIB 5M3MH 3T1HQ 1IBMQ 3GTLB 4GLAC 1XMQL 1QVGA 1H9MA 3CQZB 2NVXB 4DK6C 4Q0FA 4P74A 5IP7G 1HR0L 5CV5A 3HS0C 1EYDA 3MAQA 4DAMA 2CH4A 4FF4A 4NV5A 1SE3A 3Q8DA 2FMMA 3I73A 2LXJA 3SHLA 4HFVA 3NBIA 3TREA 4XQJA 3FP9A 1TWAB 4O1PA 3T53B 3GQBA 3Q24A 1Y1WB 4ZUJA 4DV4L 2CCZA 4GNXC 2B2TA 1JOKA 1YNJD 2NZOA 1HUMA 3MEHA 2MHVA 5D3DA 1FVIA 4A3BB 1B1ZA 1IW7D 2L55A 5KEEA 2E2IH 1H9RA 4K0KL 2Z6BA 3K8AA 1GOZA 3CAMA 2EYPA 1MKHA 2VL6A 2EY6A 4DR1L 1SNPA 2NVQB 2QZGA 4UPAA 2CWAA 3UE0A 1J5EL 3GTOH 5I6YA 1GUSA 2K7VA 4CDCC 2EJGC 1Q8IA 3PO3B 3CRKC 1SYFA 4PQXA 5G3LD 3D4RA 1T9HA 4HSPA 1X6OA 2PZUA 1JR0D 2A19A 2QEXA 4GN3B 1SFOB 1ZYRD 1PYSB 3BDOA 2J7ZA 4OWWB 2QF7A 3DMUA 1MIUA 2VUMG 2RHQB 3BDLA 5T1GA 5K36H 1K83H 1IYJB 1SYCA 1V1OA 4FO2A 1JQYD 4OO1H 5ELEA 1PH7A 4JI2Q 3HOZH 3T1HL 1IBML 1SBBB 4A3GB 2JBWA 1ESFA 1CA5A 2MPMA 1WTHA 4BWGB 3HOYB 1K83B 3E3XA 4YWMA 4DNRB 3I4NG 3P20A 1V8QA 2Q8IB 3RLFA 3RMHA 2K19A 3I4OA 4C3IH 4DR3L 3ZYYX 1STEA 2HQEA 1X3EA 2XVSA 4DAVA 5IGGA 5C3WA 2YTXA 4KKSA 5BN5A 2LY7A 5TSSA 4QUCA 1IHZA 1YBYA 4A3KG 2QDBA 3PO3H 1HNWL 4RAUC 3H15A 4HJ9A 1F2LA 2PYKA 3RLNA 1II3A 1WVLA 4X3TA 4EX5A 1DCZA 2NYZD 4IURA 4V0BA 2BH2A 4IPCA 3S16B 5C4XH 1HNXL 3GO5A 2XTIA 3OTOL 3I9V1 4GKKQ 2L9HA 4A3BH 4C3JG 5K5PA 4K5XA 1U5KA 5JEAG 1HZBA 2QEJC 4A3DB 3MXUA 2L0CA 2F0IA 2K5WA 2K5QA 1PH6A 3RZDH 3GTMB 1NY4A 3KUPA 2UUCL 4A3GG 2TSSA 2R7FA 2NTSA 1MI2A 1VQKA 2LS01 3HOXG 1ASZA 1KAWA 2NN6H 1EYGA 2A68D 4OIKA 1SSOA 3GTKB 1C9OA 3L7ZC 3PUYA 2OQKA 1N9WA 4GZYC 4GS3A 1B4OA 3GTLH 4FDBA 3D3RA 1AN8A 5EQ0A 1DOKA 5GAHC 3OMCA 4CJ0B 4KHZA 3HOZG 2K5DA 2RA4A 2FJ2A 3NQIA 1FGUA 1KD1C 1UE6A 1ICFB 3UE1A 1NR2A 3BZDB 5CBAE 1R9TH 3MXGA 3AQQA 4LJZC 4DR6Q 1HZAA 2F03A 3JC66 3MHBA 3A7AB 3GP7A 2F3WA 5EKKA 2EJFC 3AJFA 2EZVA 3LJ1A 1VQBA 4B9XA 2K32A 2QW7A 1TIID 1QWYA 4FNFA 4UDUC 1LT3D 4QUFA 3TS0A 5I6WA 3H0GG 5C4XB 4IPGA 5A35A 1EQVA 3S16H 1HNZQ 2PQAA 1I3QB 2WKDA 4F7XA 4DV3L 1MJCA 4N9PA 1HUNA 5IP9H 1EY5A 1YHAA 3HKZG 3KLWA 4IUPA 5AJ3Q 5I9OA 1SJHD 3CC2A 1EYCA 4IALA 5CMDA 4I1TA 3SE0A 3X3MA 3SXHA 2N78A 3TP7A 1Z47A 2PO4A 3RD4A 1KLGD 4FYDA 3D0FA 4NXNQ 1VQDA 1NCVA 3H6MA 1O7LA 2UUBL 2OWOA 4LUVA 2YV5A 5A2QL 3CCMA 4BA1I 1ILQA 1J8IA 1NMGA 3LGJA 1M8AA 5DLQE 1C0AA 1QUQA 2K03A 1ENFA 2KCNA 2EY2A 5M5XH 1EYAA 3N52A 1XYIA 4L5SA 1C4QA 2GVBA 2JEBI 2WFWA 3HOYH 2DJFC 4JI6L 3H3VC 4JBJA 4LF9L 1ET9A 4A3GH 1T5EA 1MSHA 1EY6A 3SK4A 4X66Q 3W5OA 1CKNB 4CBVA 3KLSA 4JI1Q 4Z7HA 3MA2B 1XX8A 3G71A 2KA7A 3M4PA 4LF4Q 4KMUC 2XRQD 3AU7A 4IFDG 3PCOB 1H95A 1VQNA 3C2PA 2NTTA 1CT1D 1D7QA 1XNQQ 4MNOA 3H91A 4MTNA 1LTRD 2WINB 3J80i 3M3YB 1E24A 3A54A 4A3JB 3E6ZX 4A3MB 3S1RB 1L0XB 4OELB 1Y1VG 5AJ3L 3A74A 3FNBA 1STNA 1D1KA 4FF2A 1LT6D 1TQOA 1K3BC 3SEBA 1SNCA 5EJWA 2L15A 2JA6G 1PFMA 2H1EA 4EQNA 4GKJQ 4DWLA 4A93B 5LMNQ 4HJAA 2BA0A 3MFYA 4JW0A 1OXUA 3V2TA 1YNXA 4DV3Q 2N55A 2B8FA 1KDCA 4O0AA 3GTPB 1TKWB 1VMPA 2F3VA 4QMGA 4JOIA 3TDQA 2VQEL 1Y1WH 2RHSB 5FOBB 3M4QA 4JI3L 1SE4A 2IT1A 4YY3L 3OIPA 1R4PB 1EUJA 4KY6A 1JJ2A 4Y7NB 3NP8A 2B2YA 4WRDA 2MJ8A 4L6TB 3I2ZA 3NSWA 3CQZH 3K6OA 2NVXH 4NW2A 4X6AH 1IYUA 3VA5A 2QILA 2F0TA 2LSSA 1P16A 4NXML 5EPJA 2B29A 2NWGA 1L1OA 3S14H 4F88A 5EPKA 4OONA 3D31A 2HGKA 2K05A 1I6VC 2GVAA 4OAUC 1I4XA 2EXDA 2N8NA 4B3SQ 2F4VQ 1TWHH 3CD6A 3H94A 3J7A5 4I65A 2WIIB 3R2IA 1I4HA 4CKCA 3NPPA 1NUCA 4A75A 1ONLA 4JV5Q 2DN8A 3SK5A 3J7YW 3ULLA 1RCVD 4OL7A 4RA8A 4XTCS 2Z6KC 2MO0A 4O2DA 3L2PA 1VQLA 5IGEA 4KKUA 3GTJB 4XDXA 4QIWB 2UU9Q 2XMXA 1YEZA 5COYA 3SK8A 2FHTA 4RGNA 3GTGH 3J7AF 1E7ZA 2WB1G 4IFDJ 1EWCA 1CZGA 5JJKA 5CYUA 1CQVA 3KP9A 2AQ2B 4DR2Q 1XNRL 3S2DH 2O5JC 1EIGA 4DV4Q 5I4DA 1EU3A 4C3JH 4DF7A 2BA1A 4RFBA 1YVCA 2IJ0A 1E2WA 1F2MA 1RIPA 1JICA 2IWHA 1ET6A 4KJOA 3BJUA 4DV1Q 2EQSA 1WCMH 5FLXL 1AE3A 2BDOA 2FMCA 4KLKA 3CHBD 2CFMA 1TS4A 1O7ZA 1TS2A 4FP5D 4A3EB 4DGZA 2XN9C 2ZXRA 2CHBD 3I3CA 4XYQA 1GJXA 4X3UA 5JPMC 5M5YH 2E8GA 2K75A 1BXTA 4OIJA 3T56B 4KY5A 3RNUA 4JG2A 1NTGA 2VXWA 1BBXC 2Q8TA 5HGTA 3CF5A 3EROA
chains in the Genus database with same CATH topology
1I50H 4DR6L 2QA4A 3JAMc 3K7UC 1A0IA 1CUKA 3PUVA 3UDGA 4WJ4A 3ULJA 4KHPL 2XTQA 1BBUA 3I4MG 3H3VH 1SLJA 4BXXH 4XIGS 3UITA 1Q1BA 3L0OA 1G291 2CWPA 3K7AH 3ICEA 3PIOA 4KI0A 1HJPA 1VQPA 1EFWA 4H02A 4IPDA 3WWVA 3G6EA 2R92H 3HOWH 4DAYB 2OCEA 3PUZA 3SDJA 2K4KA 4A3EH 4AYBE 1N36Q 3UDIA 1JJCB 5M3FG 3T1YQ 1JB7A 4BY7H 4IFDI 4DK3C 5J3BA 3KF6B 3JAMi 1VQEA 3TS2A 4PMWA 1JJGA 3I4NH 3HKZE 4IJHA 3CCRA 1K0RA 5C3EH 4QGUA 3EBEA 3F2DA 5M3MH 4R4QA 3M9BA 5M5WH 3KJOA 3T1HQ 1IBMQ 4QQBX 4HIMA 4GLAC 1XMQL 1CKMA 1Y1VH 1QVGA 2UXCQ 4DK6C 3PUWA 4P74A 5IP7G 5FJ8G 1HR0L 3U4VA 4DUZL 1WI5A 4IPHA 4DAMA 4YZ9A 4NV5A 5M3MG 1I5FA 4GN4B 2JA7G 2HIXA 3Q8DA 2PI2A 3W1GA 2LXJA 5ELNA 4IO9A 4RG1A 3RZOH 4HFVA 1BBWA 2QGQA 4NV2A 3FP9A 3H0GH 3TREA 5IP7H 2YFAA 5C4JH 1IBLQ 1IL2A 4B3RQ 4O1PA 1M90C 4UY8C 3H3VI 3STBC 2OTLA 1X65A 4AS2A 2Q2HA 3KJPA 4DV4L 1N32Q 2UXDQ 2CCZA 3PO2G 2V1CC 2WAQE 1UWVA 4GNXC 5LNK1 1KRTA 3BZCA 4PL5A 1TWFH 2NZOA 4EQ5A 1HR0Q 1FVIA 2YTYA 5IYBG 1QZHA 1XJVA 2E2IH 2OTJA 1I94L 2BH8A 1GKHA 2PNHA 1SFOH 3DLLA 1VQMA 1J5EQ 1Q12A 4K0KL 3K8AA 1GO3E 2PI2E 3CAMA 4B3MQ 1MKHA 2JB3A 2VL6A 3GDEA 1V1QA 2DUDA 2K5VA 4MZ9A 4DR1L 4JI4L 4UPAA 1I6HH 2AMCB 2CWAA 3UE0A 1Q81C 1J5EL 2B63H 2F3IA 3GTOH 3S1QH 3LJ2A 4JI3Q 2YFBA 4JCVE 4LF6L 2AKWB 2HIVA 1T9HA 3U50C 3CCEA 2JA5G 1X6OA 2Q2IA 2R7DA 4U6RA 4HJ8A 4DR7L 4G75A 4A3IH 2A19A 2KHIA 1PV4A 2IX1A 2QEXA 1EQRA 2ZRRA 4GN3B 2ZJPA 4DV6Q 1PYSB 2P22B 4YZDA 3KDFA 4PG3A 2DGYA 4OWWB 1MIUA 4A3DG 4X65L 1N34Q 2UXCL 1PVOA 4OO1I 1KHIA 5FLXc 2VUMG 1HZ9A 4IOAA 3DO9A 2RHQB 4JBMA 4POGA 1EIFA 1YZ6A 4JC0A 4P75A 1K83H 1IYJB 4A3FH 1H95A 1L1OC 4DV1L 1Q82C 3CPFA 2K5HA 1PH7A 3PF5A 4JI2Q 2E2HH 4JI0L 2VUMH 3HOZH 2MO1A 3T1HL 1IBML 3HOXH 1OTCA 2I5HA 1VQFA 3PF4A 5K36G 3CCVA 2MQHA 4A3LG 4LUOA 5GADC 3FBVA 3F2BA 1KL9A 4Z7GA 1FJGL 4BBSG 3OTOQ 4LFCQ 4JI5L 5C0XI 1HNXQ 4YWMA 3EN2A 2R7ZG 2ES2A 3KOJA 4DR5L 2JA7H 1S3OA 3I4NG 4B3ML 4RMFA 4LF9Q 4DUZQ 3F1ZA 3RLFA 2K19A 3I4OA 5GQOA 1KQSA 1JMCA 3AYHB 4C3IH 3CC4A 4PZ7A 4X64Q 4DR3L 3ER0A 2JA6H 1EOVA 1X3EA 1RL2A 4JOIC 1KRSA 2MNAA 4YCVA 3OW2A 4GOPB 4DUYQ 4UP7A 2EIFA 4A93H 2YTXA 4JI8L 4LFBL 1L1OB 5BR8L 2GN5A 1XMOL 1XNRQ 5LMUQ 2K14A 3A5UA 4GKKL 1YBYA 4A3KG 5FLMH 2HQLA 1V43A 4HEA1 3PO3H 4AIMA 3TEHB 3H15A 4HJ9A 3ULPA 1HNWL 1LM0A 4B3TL 4GN5A 3RLNA 2HT1A 3AFQA 4EX5A 3RN2A 1MJEA 1XNQL 2BH2A 2UUAQ 3HKSA 4IPCA 3SGIA 3STBD 4A3MH 2NZHA 5C4XH 1HNXL 4PL3A 3GO5A 4JV5L 2XTIA 3OTOL 3I9V1 1C7YA 4OX9Q 2H5XA 3U4ZA 4GKKQ 4DNIA 1PH3A 2ZTEA 5GAEC 3K81C 4A3BH 3MXNB 4OXPA 5ELOA 5IYCG 4APVA 1YJWA 1U5KA 3JSBA 1HZBA 5JEAG 2VW9A 1B7YB 2Y0SE 4YCWA 1Q46A 3KYHC 1E22A 4GKJL 3PGZA 4A4IA 5JJLA 2A8VA 5C44H 4L5TA 3KDFB 2E5LL 2K5NA 1PH6A 3RZDH 4LW1A 1VQ5A 1NY4A 4A76A 3S17H 2UUCL 4AH6A 4BY1G 4A3GG 5IYDG 2KHJA 1K73C 1EIYB 1HNWQ 2UXDL 1GVPA 2R7FA 3AFPA 4HIDA 4POFA 1VQKA 1VQCA 2KENA 3PIPA 3HOXG 1ASZA 1KAWA 1EYGA 1SJ8A 4C2MH 1J6QA 2I0QA 3AEVA 1YIJA 4KHPQ 1C9OA 3L7ZC 2YYZA 3PUYA 2OQKA 3KF6A 1YHBA 1N9WA 2PMZE 3S15H 1SMXA 4GS3A 4C3HH 3GTLH 4UP8A 4FDBA 1P8LA 3CW2C 2VS1A 4DR7Q 1YO7A 4A3JG 2R7ZH 3M4OH 4Y52H 4JBWA 1HR0W 1SN8A 4YY3Q 2A2DA 5GAHC 1OXSC 4KHZA 3HOZG 4AQYL 1XPUA 1UE7A 3UDFA 1EQQA 4GLXA 2Y0SG 3S2HH 2AHOB 1FGUA 1KD1C 1UE6A 3UE1A 5C0XJ 1VQIA 4DR1Q 2FXQA 4GLVB 3AQQA 1WYDA 1R9TH 1N8RC 4DR6Q 1HZAA 5IWAQ 2LXKA 4YHHQ 3JC66 1PYBA 1LUZA 3F4MA 1Q8KA 2JB1A 4LWCA 3FHWA 2JA9A 1B8AA 3AJFA 1TWGH 1I94Q 2UUBQ 3LJ1A 1VQBA 4A3KH 3GTJH 4LF7Q 3PO2H 4LNQA 4DV0Q 1KIXA 4JBKA 2IHEA 4L5RC 2ZTCA 2ALYB 3TS0A 3HOUG 3H0GG 3I7FA 4IPGA 2VQFL 2JEAI 3A5ZB 1L0WA 1N33L 3S16H 1Y1WG 1IBKL 2PQAA 3BZKA 1HNZQ 1YHQA 3PSIA 4A3MG 2UU9L 4DV3L 1PH9A 2ZJQA 3IAS1 1MJCA 2ZTDA 3P23A 4LF5L 4B3RL 4HIOA 5IP9H 1YHAA 3HKZG 1X55A 2CQOA 3KLWA 5AJ3Q 1VQOA 4NXNL 1K9MC 3CC2A 2B63G 3U58A 4A93G 4I1TA 4DR2L 2N78A 1Z47A 2JA8G 5EAYA 2WB1E 3D0FA 3KF8B 1VQDA 4NXNQ 5IP9G 4LF8L 1WFQA 2WAQG 2UUBL 1SE8A 2OWOA 4LUVA 3HOVH 2YV5A 2RCNA 4GNXB 3CCMA 4BA1I 3DA4A 1NBWA 4TVAB 4X66L 2D62A 3ZJYC 2F4VL 1W3SA 2ZM6Q 5IWAL 4OWXB 4B3SL 2VQFQ 1NMGA 3LGJA 5DLQE 1HZCA 1VQGA 3MEFA 1C0AA 1QUQA 1TWCH 1AH9A 2NN6I 3S1NH 2N3SA 5M5XH 4LF4L 4DV0L 2UXBL 4L5SA 3IRBA 2GVBA 2JEBI 3GTKH 4OWTB 2WFWA 3HOYH 1B70B 2FUG1 3E0EA 4O1OA 4JI6L 1YJNA 2C35B 4JBJA 4YWLA 2E2JH 4X62Q 4LF9L 2R6GA 4A3GH 2I5MX 3CCSA 2ZM6L 4OO1G 4JI8Q 2I5LX 3CMEA 1PH5A 1N32L 4X66Q 2JB2A 1D8LA 1CKNB 4J15A 3W5OA 4JI1Q 4Z7HA 4ME3A 3G71A 3CCQA 4LF4Q 3M4PA 3GTMH 3TRZA 1UEBA 2JE6I 1VQ4A 3KFUA 2VNUD 1G6PA 3ERSX 3PV0A 4IFDG 1G51A 5HGQA 3PCOB 5HGIA 3IAM1 4A3DH 1VQNA 3NENA 4DR4L 4AYBG 3GTPH 1X9NA 1CSPA 3I4MH 3M7NA 1D7QA 5E7NA 1PH8A 1XNQQ 4MNOA 4MTNA 4BXXG 3J80i 2JA5H 4QL5A 4UP9A 4P72A 3BU2A 1E24A 2VQEQ 2KCMA 4A3IG 1V9PA 4QIWE 4QJFA 4LFAQ 1OXXK 3GTQH 1XMQQ 1PFSA 4A3EG 4NXMQ 1X3GA 1W2BA 2B3GA 2ATWA 4R4TA 4L5QA 3CXCA 3G4SA 2R93H 1JT8A 1Y1VG 5AJ3L 3A74A 3UDXA 1X3FA 4JI1L 2IP6A 4DPGA 4LF5Q 4LF8Q 2R92G 3HOWG 4DV7Q 3T1YL 2K50A 4LF7L 2L15A 4IOCA 4A3FG 2JA6G 5M3FH 4JYAL 1QUQB 2A1AA 5IYBH 4GKJQ 1K8GA 4DWLA 1Y14B 3S1RH 2Q2UA 3J7ZC 4DV7L 5LMNQ 4LUZA 5JEAJ 2BA0A 4HJAA 1WJJA 3HOUH 1K3RA 5C3EG 4B3TQ 5C0XG 4HJ7A 1LTLA 2Z6KA 2IY5B 1IZ6A 1EWIA 1OXUA 4P73A 5IY0A 1XPRA 3M3YH 4A3CG 2NVYH 1YNXA 4R1JA 3J80c 1L2FA 4DV3Q 4A3LH 4R4OA 4YZCA 2AWOA 1IBKQ 1HNZL 3OYYA 4O0AA 1KXLA 2ID0A 5BR8Q 1Q1EA 3S1MH 4JOIA 1SR3A 3RLOA 1NE3A 5FJ8H 4LFAL 4AS3A 4K0KQ 2VQEL 1Y1WH 1VQAA 2VZAA 4A3CH 4LF6Q 2XTRA 2RHSB 2WP8J 1X54A 2JJQA 1YI2A 2Z0SA 3M4QA 1Z9FA 4JI3L 4BA2I 2KKMA 5C4XG 4Y7NH 2Q2TA 2IT1A 4YY3L 3HOYG 1PH1A 3DM3A 5HY6A 3I55A 1BVSA 1EUJA 1E1TA 1QZGA 1JJ2A 5IE8A 2CKZB 5IYDH 4YWKA 1PA6A 1VQHA 4DV5Q 4WJ3M 4GXTA 1A62A 1K8AC 3I2ZA 1WCMG 3CQZH 3NBHB 2NVXH 1SRUA 5LMNL 4ALPA 4X6AH 1PHJA 3VDYA 5IYCH 4DKAC 1S72A 2LSSA 1UE1A 1P16A 3CCJA 4NXML 1U0LA 4JYAQ 2K52A 1X56A 3CPWA 2V6EA 2B29A 1YJ9A 1L1OA 3CP0A 2ZJRA 3S14H 1OXTA 1XPOA 2D0PA 1VQ6A 4OONA 3F2CA 4HIKA 3LJ0A 3CCUA 1FJGQ 3M85A 3D31A 1Q86C 3J81c 1QVFA 2GVAA 1A63A 4OAUC 1A8VA 2EXDA 1GD7A 2N8NA 3NEMA 4IJLA 4B3SQ 3GD7A 4Q9VA 1N33Q 2F4VQ 4JI7Q 3TQYA 1VS0A 2RIOA 1TWHH 5JJIA 4BBSH 5GAGC 3CD6A 1FL0A 2YU9H 2KBNA 3E9HA 1WOCA 1OXVA 1CSQA 4GNXA 2NVTH 3J7A5 5GROA 1SROA 4R4CA 4OX9L 2IX0A 4DV6L 3K0XA 3PUXA 4X64L 1VCIA 4A75A 4DR3Q 2E5LQ 1S40A 4JV5Q 5H1SE 3ULLA 2L1LB 2NVQH 2OQ0A 4X62L 4PZ6A 1I3QH 3NELA 2MJFB 4R4IA 1XMOQ 4XTCS 3RN5A 2Z6KC 4A3JH 1TXYA 3J81i 2MO0A 5IT9c 2MFIA 4O2DA 3L2PA 4DUYL 1VQLA 2R93G 2UU9Q 2XMXA 4G76A 1QVCA 5LMUL 1N36L 1YEZA 2VY3A 4JI4Q 3G48A 3F8TA 3EIVA 1DGSA 1ASYA 1VQ9A 4GOPA 5LMNW 3A0JA 4JI6Q 1M1KC 1CKNA 2JAEA 3B6YA 3GTGH 1E7ZA 2WB1G 4JI0Q 4JI2L 4BY7G 2F66B 1TWAH 4IFDJ 3CCLA 1JE5A 4OAVB 3CMAA 2IHFA 2UXBQ 5JJKA 3DA3A 3CC7A 3L0IA 3KP9A 3FKIH 1XNRL 4DR2Q 4TQUS 3S2DH 4PZ8A 4YHHL 4LFBQ 1E1OA 1PH2A 1O7IA 4DV4Q 4JI7L 3HOVG 1N34L 2RF4A 4JI5Q 4C3JH 3VA9A 2BA1A 2JQOA 1AE2A 1YVCA 4GOPC 4BBRH 1IBLL 4P71A 4NPSA 2UUCQ 2F6MB 3S24A 4DV2Q 1RIPA 2HHHQ 3FKIG 2JA8H 3HFZB 2N49A 2YTVA 1YITA 3BJUA 4DV1Q 2EQSA 1WCMH 1Q7YC 2XGTA 1AE3A 2ASBA 1E3PA 4KLKA 3PO3G 2UUAL 4DR5Q 1BKBA 2CFMA 1VQ8A 1GM5A 1LYLA 2KCTA 4BY1H 1VQ7A 4BBRG 2F52A 4LFCL 2CAZB 4PL4A 1NMFA 3E9IA 2JK8A 4DV5L 2D0OA 5FLMG 3I56A 2AWNA 5M5YH 4X65Q 5C44G 1KC8C 2E8GA 2K75A 4A3BG 1VQJA 1NJIC 1HH2P 3RNUA 1XTDA 2PQAB 3RR5A 4JG2A 4NB3A 1NTGA 4AQYQ 1IXRA 1PH4A 4DV2L 2HHHL 3K80C 3J81j 4DR4Q 4HJ5A 2A2CA 1UE5A 3CF5A 3W1BA 1CKOA 4QY7A 2NN6G 4YCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I50 H;  4DR6 L;  2QA4 A;  3JAM c;  3K7U C;  1A0I A;  1CUK A;  3PUV A;  3UDG A;  4WJ4 A;  3ULJ A;  4KHP L;  1BBU A;  3I4M G;  3H3V H;  1SLJ A;  4BXX H;  4XIG S;  1Q1B A;  3L0O A;  1G29 1;  2CWP A;  3K7A H;  3ICE A;  3PIO A;  4KI0 A;  1HJP A;  1VQP A;  1EFW A;  4H02 A;  4IPD A;  3WWV A;  3G6E A;  2R92 H;  3HOW H;  4DAY B;  2OCE A;  3PUZ A;  4A3E H;  2K4K A;  4AYB E;  1N36 Q;  3UDI A;  1JJC B;  5M3F G;  3T1Y Q;  1JB7 A;  4BY7 H;  4IFD I;  4DK3 C;  5J3B A;  3KF6 B;  3JAM i;  1VQE A;  3TS2 A;  4PMW A;  1JJG A;  3I4N H;  3HKZ E;  4IJH A;  3CCR A;  1K0R A;  5C3E H;  4QGU A;  3EBE A;  3F2D A;  5M3M H;  4R4Q A;  3M9B A;  5M5W H;  3KJO A;  3T1H Q;  1IBM Q;  4QQB X;  4HIM A;  4GLA C;  1XMQ L;  1CKM A;  1Y1V H;  1QVG A;  2UXC Q;  4DK6 C;  3PUW A;  4P74 A;  5IP7 G;  5FJ8 G;  1HR0 L;  3U4V A;  4DUZ L;  1WI5 A;  4IPH A;  4DAM A;  5M3M G;  1I5F A;  4GN4 B;  2HIX A;  3Q8D A;  2PI2 A;  3W1G A;  2LXJ A;  5ELN A;  4IO9 A;  4RG1 A;  3RZO H;  2UXC L;  1BBW A;  2QGQ A;  3TRE A;  3FP9 A;  3H0G H;  5IP7 H;  5C4J H;  1IBL Q;  1IL2 A;  4B3R Q;  1M90 C;  4UY8 C;  3H3V I;  3STB C;  2OTL A;  1X65 A;  2Q2H A;  3KJP A;  4DV4 L;  1N32 Q;  2UXD Q;  2CCZ A;  3PO2 G;  2V1C C;  2WAQ E;  1UWV A;  4GNX C;  1KRT A;  3BZC A;  1TWF H;  2NZO A;  4EQ5 A;  1HR0 Q;  1FVI A;  2YTY A;  5IYB G;  1QZH A;  1XJV A;  2E2I H;  2OTJ A;  1I94 L;  2BH8 A;  1GKH A;  2PNH A;  1SFO H;  3DLL A;  1VQM A;  1J5E Q;  1Q12 A;  4K0K L;  3K8A A;  1GO3 E;  2PI2 E;  3CAM A;  4B3M Q;  1MKH A;  2VL6 A;  3GDE A;  1V1Q A;  2DUD A;  2K5V A;  4MZ9 A;  4DR1 L;  4JI4 L;  4UPA A;  1I6H H;  2AMC B;  2CWA A;  3UE0 A;  1Q81 C;  1J5E L;  2B63 H;  2F3I A;  3GTO H;  3S1Q H;  4JI3 Q;  4JCV E;  4LF6 L;  2AKW B;  2HIV A;  1T9H A;  3U50 C;  3CCE A;  2JA5 G;  1X6O A;  2Q2I A;  2R7D A;  4HJ8 A;  4DR7 L;  4A3I H;  2A19 A;  2KHI A;  1PV4 A;  2IX1 A;  2QEX A;  1EQR A;  4GN3 B;  2ZJP A;  4DV6 Q;  1PYS B;  3KDF A;  4PG3 A;  2DGY A;  4OWW B;  1MIU A;  4A3D G;  4X65 L;  1N34 Q;  1PVO A;  4OO1 I;  1KHI A;  5FLX c;  2VUM G;  1HZ9 A;  4IOA A;  2RHQ B;  4JBM A;  4POG A;  1EIF A;  1YZ6 A;  4JC0 A;  4P75 A;  1K83 H;  1IYJ B;  4A3F H;  1H95 A;  1L1O C;  4DV1 L;  1Q82 C;  3CPF A;  2K5H A;  1PH7 A;  3PF5 A;  4JI2 Q;  2E2H H;  4JI0 L;  2VUM H;  3HOZ H;  2MO1 A;  3T1H L;  1IBM L;  3HOX H;  1OTC A;  2I5H A;  1VQF A;  3PF4 A;  5K36 G;  3CCV A;  2MQH A;  4A3L G;  4LUO A;  5GAD C;  3F2B A;  1KL9 A;  1FJG L;  4BBS G;  3OTO Q;  4LFC Q;  4JI5 L;  5C0X I;  1HNX Q;  4YWM A;  3EN2 A;  2R7Z G;  2ES2 A;  3KOJ A;  4DR5 L;  2JA7 H;  1S3O A;  3I4N G;  4B3M L;  4RMF A;  4LF9 Q;  4DUZ Q;  3F1Z A;  3RLF A;  3I4O A;  5GQO A;  1KQS A;  1JMC A;  3AYH B;  4C3I H;  3CC4 A;  4PZ7 A;  4X64 Q;  4DR3 L;  3ER0 A;  2JA6 H;  1EOV A;  1X3E A;  1RL2 A;  4JOI C;  1KRS A;  2MNA A;  4YCV A;  3OW2 A;  4GOP B;  4DUY Q;  4UP7 A;  2EIF A;  4A93 H;  2YTX A;  4JI8 L;  4LFB L;  1L1O B;  5BR8 L;  2GN5 A;  1XMO L;  1XNR Q;  5LMU Q;  2K14 A;  3A5U A;  1YBY A;  4A3K G;  5FLM H;  2HQL A;  1V43 A;  3PO3 H;  1HNW L;  4AIM A;  3TEH B;  3H15 A;  4HJ9 A;  3ULP A;  1LM0 A;  4B3T L;  4GN5 A;  3RLN A;  2HT1 A;  3AFQ A;  4EX5 A;  3RN2 A;  1MJE A;  1XNQ L;  2BH2 A;  2UUA Q;  3HKS A;  4IPC A;  3SGI A;  3STB D;  4A3M H;  2NZH A;  5C4X H;  1HNX L;  3GO5 A;  4JV5 L;  2XTI A;  3OTO L;  1C7Y A;  4OX9 Q;  2H5X A;  3U4Z A;  4GKK Q;  4DNI A;  1PH3 A;  2ZTE A;  5GAE C;  3K81 C;  4A3B H;  3MXN B;  4OXP A;  5ELO A;  5IYC G;  4APV A;  1YJW A;  1U5K A;  5JEA G;  1HZB A;  2VW9 A;  1B7Y B;  2Y0S E;  4YCW A;  1Q46 A;  3KYH C;  1E22 A;  4GKJ L;  3PGZ A;  4A4I A;  5JJL A;  2A8V A;  5C44 H;  4L5T A;  3KDF B;  2E5L L;  2K5N A;  1PH6 A;  3RZD H;  4LW1 A;  1VQ5 A;  1NY4 A;  4A76 A;  3S17 H;  2UUC L;  4AH6 A;  4BY1 G;  4A3G G;  5IYD G;  2KHJ A;  1K73 C;  1EIY B;  1HNW Q;  2UXD L;  1GVP A;  2R7F A;  3AFP A;  4HID A;  4POF A;  1VQK A;  1VQC A;  2KEN A;  3PIP A;  3HOX G;  1ASZ A;  1KAW A;  1EYG A;  2I0Q A;  4C2M H;  1J6Q A;  3AEV A;  1YIJ A;  4KHP Q;  1C9O A;  3L7Z C;  2YYZ A;  3PUY A;  2OQK A;  3KF6 A;  1YHB A;  1N9W A;  2PMZ E;  3S15 H;  1SMX A;  4GS3 A;  4C3H H;  3GTL H;  4UP8 A;  4FDB A;  1P8L A;  3CW2 C;  2VS1 A;  4DR7 Q;  4A3J G;  3M4O H;  2R7Z H;  4Y52 H;  4JBW A;  1HR0 W;  1SN8 A;  4YY3 Q;  5GAH C;  1OXS C;  4KHZ A;  3HOZ G;  4AQY L;  1XPU A;  1UE7 A;  3UDF A;  1EQQ A;  4GLX A;  2Y0S G;  3S2H H;  2AHO B;  1FGU A;  1KD1 C;  1UE6 A;  3UE1 A;  5C0X J;  1VQI A;  4DR1 Q;  2FXQ A;  4GLV B;  3AQQ A;  1WYD A;  1R9T H;  1N8R C;  4DR6 Q;  1HZA A;  5IWA Q;  2LXK A;  4YHH Q;  3JC6 6;  1PYB A;  1LUZ A;  1Q8K A;  4LWC A;  3FHW A;  1B8A A;  1TWG H;  2JA9 A;  1I94 Q;  4LF7 Q;  2UUB Q;  1VQB A;  2JA7 G;  4A3K H;  3GTJ H;  3PO2 H;  4LNQ A;  4DV0 Q;  1KIX A;  4JBK A;  2IHE A;  4L5R C;  2ZTC A;  2ALY B;  3TS0 A;  3HOU G;  3H0G G;  3I7F A;  4IPG A;  2VQF L;  2JEA I;  3A5Z B;  1L0W A;  1N33 L;  3S16 H;  1Y1W G;  1IBK L;  2PQA A;  3BZK A;  1HNZ Q;  1YHQ A;  3PSI A;  4A3M G;  2UU9 L;  4DV3 L;  1PH9 A;  2ZJQ A;  1MJC A;  2ZTD A;  4LF5 L;  4B3R L;  4HIO A;  5IP9 H;  1YHA A;  3HKZ G;  1X55 A;  2CQO A;  3KLW A;  5AJ3 Q;  1VQO A;  4NXN L;  1K9M C;  3CC2 A;  2B63 G;  3U58 A;  4A93 G;  4DR2 L;  2N78 A;  1Z47 A;  2JA8 G;  5EAY A;  2WB1 E;  3D0F A;  3KF8 B;  1VQD A;  4NXN Q;  5IP9 G;  4LF8 L;  1WFQ A;  2WAQ G;  2UUB L;  1SE8 A;  2OWO A;  4LUV A;  3HOV H;  2YV5 A;  2RCN A;  4GNX B;  3CCM A;  4BA1 I;  1NBW A;  4TVA B;  4X66 L;  2D62 A;  3ZJY C;  2F4V L;  1W3S A;  2ZM6 Q;  5IWA L;  4OWX B;  4B3S L;  2VQF Q;  1NMG A;  3LGJ A;  5DLQ E;  1HZC A;  1VQG A;  3MEF A;  1C0A A;  1QUQ A;  1TWC H;  1AH9 A;  2NN6 I;  3S1N H;  2N3S A;  5M5X H;  4LF4 L;  4DV0 L;  2UXB L;  4L5S A;  3IRB A;  2GVB A;  2JEB I;  3GTK H;  4OWT B;  2WFW A;  3HOY H;  1B70 B;  3E0E A;  4JI6 L;  1YJN A;  2C35 B;  4JBJ A;  4YWL A;  2E2J H;  4X62 Q;  4LF9 L;  2R6G A;  4A3G H;  2I5M X;  3CCS A;  2ZM6 L;  4OO1 G;  4JI8 Q;  2I5L X;  3CME A;  1PH5 A;  1N32 L;  4X66 Q;  1D8L A;  4J15 A;  1CKN B;  3W5O A;  3G71 A;  4JI1 Q;  4ME3 A;  3CCQ A;  4LF4 Q;  3M4P A;  3GTM H;  3TRZ A;  1UEB A;  2JE6 I;  1VQ4 A;  3KFU A;  2VNU D;  1G6P A;  3ERS X;  3PV0 A;  4IFD G;  1G51 A;  5HGQ A;  3PCO B;  4A3D H;  1VQN A;  3NEN A;  4DR4 L;  4AYB G;  3GTP H;  1X9N A;  1CSP A;  3I4M H;  3M7N A;  1D7Q A;  5E7N A;  1PH8 A;  1XNQ Q;  4MNO A;  4MTN A;  4BXX G;  3J80 i;  2JA5 H;  4QL5 A;  4UP9 A;  4P72 A;  3BU2 A;  1E24 A;  2VQE Q;  2KCM A;  4A3I G;  1V9P A;  4QIW E;  4QJF A;  4LFA Q;  1OXX K;  3GTQ H;  1XMQ Q;  1PFS A;  4A3E G;  4NXM Q;  1X3G A;  1W2B A;  2B3G A;  2ATW A;  4R4T A;  4L5Q A;  3CXC A;  3G4S A;  2R93 H;  1JT8 A;  1Y1V G;  5AJ3 L;  3A74 A;  3UDX A;  1X3F A;  4JI1 L;  4DPG A;  4LF5 Q;  4LF8 Q;  2R92 G;  3HOW G;  4DV7 Q;  3T1Y L;  2K50 A;  4LF7 L;  2L15 A;  4IOC A;  4A3F G;  2JA6 G;  5M3F H;  4JYA L;  1QUQ B;  2A1A A;  5IYB H;  4GKJ Q;  1K8G A;  1Y14 B;  3S1R H;  2Q2U A;  3J7Z C;  4DV7 L;  5LMN Q;  4LUZ A;  5JEA J;  2BA0 A;  4HJA A;  1WJJ A;  3HOU H;  1K3R A;  5C3E G;  4B3T Q;  5C0X G;  4HJ7 A;  1LTL A;  2Z6K A;  2IY5 B;  1IZ6 A;  1EWI A;  1OXU A;  4P73 A;  5IY0 A;  1XPR A;  3M3Y H;  4A3C G;  2NVY H;  1YNX A;  4R1J A;  3J80 c;  1L2F A;  4DV3 Q;  4A3L H;  4R4O A;  2AWO A;  1IBK Q;  1HNZ L;  3OYY A;  4O0A A;  1KXL A;  2ID0 A;  5BR8 Q;  1Q1E A;  3S1M H;  4JOI A;  1SR3 A;  3RLO A;  1NE3 A;  5FJ8 H;  4LFA L;  4K0K Q;  2VQE L;  1Y1W H;  1VQA A;  2VZA A;  4A3C H;  4LF6 Q;  2RHS B;  2WP8 J;  1X54 A;  2JJQ A;  1YI2 A;  2Z0S A;  3M4Q A;  1Z9F A;  4JI3 L;  4BA2 I;  5C4X G;  4Y7N H;  2Q2T A;  2IT1 A;  4YY3 L;  3HOY G;  1PH1 A;  3DM3 A;  5HY6 A;  3I55 A;  1BVS A;  1EUJ A;  1E1T A;  1QZG A;  1JJ2 A;  5IE8 A;  2CKZ B;  5IYD H;  4YWK A;  1PA6 A;  1VQH A;  4DV5 Q;  4WJ3 M;  1A62 A;  1K8A C;  3I2Z A;  1WCM G;  3CQZ H;  3NBH B;  2NVX H;  1SRU A;  5LMN L;  4ALP A;  4X6A H;  1PHJ A;  3VDY A;  5IYC H;  4DKA C;  1S72 A;  2LSS A;  1UE1 A;  1P16 A;  3CCJ A;  4NXM L;  1U0L A;  4JYA Q;  2K52 A;  1X56 A;  3CPW A;  2B29 A;  1YJ9 A;  1L1O A;  3CP0 A;  2ZJR A;  3S14 H;  1OXT A;  1XPO A;  2D0P A;  1VQ6 A;  4OON A;  3F2C A;  4HIK A;  3CCU A;  1FJG Q;  3M85 A;  3D31 A;  1Q86 C;  3J81 c;  1QVF A;  2GVA A;  1A63 A;  1A8V A;  2EXD A;  2N8N A;  1GD7 A;  4IJL A;  3NEM A;  4B3S Q;  3GD7 A;  1N33 Q;  5JJI A;  2F4V Q;  4JI7 Q;  3TQY A;  1VS0 A;  1TWH H;  4BBS H;  5GAG C;  3CD6 A;  1FL0 A;  2YU9 H;  2KBN A;  3E9H A;  1WOC A;  1OXV A;  1CSQ A;  4GNX A;  2NVT H;  3J7A 5;  5GRO A;  1SRO A;  4R4C A;  4OX9 L;  2IX0 A;  4DV6 L;  3K0X A;  3PUX A;  4X64 L;  1VCI A;  4A75 A;  4DR3 Q;  2E5L Q;  1S40 A;  4JV5 Q;  5H1S E;  3ULL A;  2NVQ H;  2OQ0 A;  4X62 L;  4PZ6 A;  1I3Q H;  3NEL A;  4R4I A;  1XMO Q;  4XTC S;  3RN5 A;  2Z6K C;  4A3J H;  1TXY A;  3J81 i;  2MO0 A;  5IT9 c;  2MFI A;  4O2D A;  3L2P A;  4DUY L;  1VQL A;  2R93 G;  2UU9 Q;  5LMU L;  1QVC A;  1N36 L;  1YEZ A;  2VY3 A;  4JI4 Q;  3G48 A;  3F8T A;  3EIV A;  1DGS A;  1ASY A;  1VQ9 A;  4GOP A;  5LMN W;  3A0J A;  4JI6 Q;  1M1K C;  1CKN A;  3GTG H;  3B6Y A;  1E7Z A;  2WB1 G;  4JI0 Q;  4JI2 L;  4BY7 G;  1TWA H;  4IFD J;  3CCL A;  1JE5 A;  3CMA A;  2IHF A;  2UXB Q;  5JJK A;  3CC7 A;  3FKI H;  1XNR L;  4DR2 Q;  4TQU S;  3S2D H;  4PZ8 A;  4YHH L;  4LFB Q;  1E1O A;  1PH2 A;  1O7I A;  4DV4 Q;  4JI7 L;  3HOV G;  1N34 L;  2RF4 A;  4JI5 Q;  4C3J H;  2BA1 A;  2JQO A;  1AE2 A;  1YVC A;  4GOP C;  4BBR H;  1IBL L;  4P71 A;  4NPS A;  2UUC Q;  3S24 A;  4DV2 Q;  2HHH Q;  1RIP A;  2JA8 H;  3FKI G;  4GKK L;  3HFZ B;  2N49 A;  2YTV A;  1YIT A;  3BJU A;  4DV1 Q;  2EQS A;  1WCM H;  1Q7Y C;  2XGT A;  1AE3 A;  2ASB A;  1E3P A;  4KLK A;  3PO3 G;  2UUA L;  4DR5 Q;  1BKB A;  2CFM A;  1VQ8 A;  1GM5 A;  1LYL A;  2KCT A;  4BY1 H;  1VQ7 A;  4BBR G;  2F52 A;  4LFC L;  1NMF A;  3E9I A;  2JK8 A;  4DV5 L;  2D0O A;  5FLM G;  3I56 A;  2AWN A;  5M5Y H;  4X65 Q;  5C44 G;  1KC8 C;  2E8G A;  2K75 A;  4A3B G;  1VQJ A;  1NJI C;  1HH2 P;  3RNU A;  1XTD A;  2PQA B;  3RR5 A;  4JG2 A;  4NB3 A;  1NTG A;  4AQY Q;  1IXR A;  1PH4 A;  4DV2 L;  2HHH L;  3K80 C;  3J81 j;  4DR4 Q;  4HJ5 A;  1UE5 A;  3CF5 A;  3W1B A;  1CKO A;  4QY7 A;  2NN6 G;  4YCU A; 
#chains in the Genus database with same CATH topology
 2M00 A;  1CFM A;  1MBY A;  1A0I A;  1CUK A;  3K5N A;  3PUV A;  3UDG A;  2AQ1 B;  1NNX A;  2XTQ A;  1BBU A;  2K28 A;  3I4M G;  3NUC A;  3H3V H;  4CKE A;  4BBS B;  1O80 A;  3ICE A;  4KI0 A;  1HJP A;  3WWV A;  3HOW H;  3QO2 A;  4P2C B;  4A3E H;  2K4K A;  2PQE A;  3UDI A;  4IFD I;  5ISR A;  3J81 E;  4EQO A;  5IOC A;  4FXD A;  4PMW A;  1IKM A;  3F2D A;  3M9B A;  5M5W H;  4QQB X;  3VR6 A;  4HIM A;  2O5I C;  1Y1V H;  1IKL A;  1DYQ A;  2BOS A;  4KN7 C;  3U4V A;  4DUZ L;  4IPH A;  2XSC A;  1STG A;  2DY7 A;  5M3M G;  2L11 A;  2HIX A;  2PI2 A;  1ENC A;  3TME A;  3K0Y A;  5ELN A;  2P5Z X;  5IP7 H;  3S17 B;  1SDF A;  2FIN B;  2M9V A;  4UY8 C;  2GSC A;  1BDO A;  1AFP A;  5C44 B;  5C4Z A;  3PO2 G;  2KCC A;  2WB1 B;  1RD9 D;  2IL8 A;  1U9R A;  2F0N A;  4PL5 A;  5LHY 1;  1HR0 Q;  2YTY A;  5IYB G;  1XJV A;  1I94 L;  2BH8 A;  1QJO A;  2LKV A;  1SXT A;  4AYB B;  1VQM A;  1Q12 A;  4B3M Q;  3TP6 A;  4DA2 A;  3I70 A;  3GDE A;  1V1Q A;  2DUD A;  4MZ9 A;  5DM7 3;  1QB5 D;  3FPP A;  4JK1 C;  1HPC A;  4JI3 Q;  1SYB A;  2YFB A;  1CTM A;  1CHQ D;  2V4D A;  3FVV A;  3CCE A;  4B9W A;  5KIX A;  2Q2I A;  2R7D A;  4HJ8 A;  2CVR A;  1MGS A;  3MTS A;  3Q22 A;  4DV6 Q;  5FKA C;  4YZD A;  4I7A A;  4A3D G;  4X65 L;  3MWY W;  3U9O A;  4OO1 I;  1KHI A;  4JBM A;  4POG A;  3W3A A;  2A69 C;  5EKL A;  1EIF A;  5J1Z A;  1QIL A;  1L1O C;  2HCC A;  3NTH A;  2EE1 A;  1KDB A;  1WTR A;  1I4R A;  5CR3 A;  4ZQ3 A;  4JI0 L;  2VUM H;  2MO1 A;  1OTC A;  3HOX B;  2I5H A;  1VQF A;  5K36 G;  5DM6 3;  4LUO A;  3F2B A;  1KL9 A;  5ELD A;  3J7A V;  4TKO B;  4LFC Q;  5C0X I;  4H0L C;  3EN2 A;  4NMZ A;  2R7Z G;  4FXK C;  1TWC B;  3KOJ A;  4DR5 L;  4U67 3;  5I2X A;  4DUZ Q;  3F1Z A;  1PXU A;  2L12 A;  1KQS A;  3CC4 A;  2B2W C;  2F0V A;  4PZ7 A;  1I4G A;  3HOV B;  4JOI C;  2FU2 A;  1KRS A;  2B39 A;  1GUT A;  4YCV A;  4DUY Q;  4A93 H;  1EZ8 A;  5BR8 L;  1XNR Q;  4CDD C;  1T5X D;  2HQL A;  1V43 A;  4HEA 1;  2XWB B;  3ITP A;  3TEH B;  4AIM A;  1L0Y B;  5FLM H;  4K2L A;  4B3T L;  2WAC A;  4WOR A;  3C1E A;  2HT1 A;  4NDX A;  4RWS C;  5KND A;  1XNQ L;  4H44 C;  3SGI A;  4A3M H;  2RDF A;  3KLS X;  4JV5 L;  2HCI A;  3LWE A;  4DNI A;  2F0J A;  3PO2 B;  5C5L A;  3WOE A;  1WTV A;  4OXP A;  1A2U A;  1K0S A;  1EL0 A;  1S4Z A;  5CV8 A;  3VYT A;  1E22 A;  1W6J A;  1F2Y A;  1PFB A;  1PMR A;  2EYL A;  2K5N A;  3L9A X;  3QB3 A;  3MXN A;  4A76 A;  3NTI A;  4BY1 G;  3OWF A;  1EIY B;  1HNW Q;  1GVP A;  1AP0 A;  3AFP A;  4FVM A;  1GXD C;  4HID A;  3M4O B;  2BE5 C;  5IT9 L;  1SJ8 A;  1TS3 A;  2E76 C;  2Z4H A;  4C56 C;  4KHP Q;  2PMZ E;  4KN4 C;  3S15 H;  4TSS A;  4BBR B;  5DNF A;  3WOF A;  4UP8 A;  1P8L A;  4FXG C;  4DR7 Q;  3SDZ A;  1YO7 A;  4Y52 H;  1LTS D;  1MSG A;  3FKI B;  1OXS C;  2Q8R E;  1EQQ A;  3I8Z A;  2F0M A;  2Y0S G;  1LLR D;  2AHO B;  4Q5V A;  4IUN A;  5C4H A;  2O4X A;  2LXK A;  3DUZ A;  1PYB A;  5D14 A;  4HMJ A;  5I9P A;  2JB1 A;  3HG9 A;  3FHW A;  4A3K H;  4M8A A;  1KIX A;  4JBK A;  2IHE A;  2ZTC A;  3Q0A A;  1O78 A;  5JJZ A;  2DNE A;  4ZLT F;  3PSI A;  3IAS 1;  3P23 A;  3V96 A;  3A8I E;  4J8Q A;  2CQO A;  2KQ3 A;  2B63 G;  2F0H A;  3K59 A;  3OIQ A;  4UHV A;  3U58 A;  1FGB D;  3TZD A;  3KF8 B;  5IP9 G;  4LF8 L;  3NQT A;  1SE8 A;  1NBW A;  1Y8N B;  1Y8P B;  4CJ2 C;  2D62 A;  1W3S A;  2ZM6 Q;  4ZKB B;  1SYD A;  4OWX B;  2VQF Q;  4RKL A;  5J22 A;  4B3S L;  3BS1 A;  3M7G A;  3S1N H;  2N3S A;  2UXB L;  1ENA A;  3GTK H;  1B70 B;  3E0E A;  3EVQ A;  3KBG A;  5EBD A;  2XIW A;  2KED A;  4XYO A;  2I5M X;  4G57 A;  3CCS A;  1EZ6 A;  2B8G A;  4JI8 Q;  4YIJ A;  1N32 L;  2UXD L;  3QWN A;  4ME3 A;  3GTM H;  1G6P A;  1UEB A;  3GV3 A;  3KFU A;  1IW7 C;  1Z6H A;  3ERS X;  3TN2 A;  2HDM A;  1VF5 C;  3IAM 1;  1EEI D;  4A3D H;  3NEN A;  4DR4 L;  3URY A;  3F2U A;  4RHR A;  1CK1 A;  4TRD A;  4BXX G;  2KVM A;  5KNC A;  2F0O A;  2JA5 H;  4QL5 A;  4UP9 A;  1PTO D;  4LK1 C;  1V9P A;  4QIW E;  4QJF A;  4LFA Q;  1OXX K;  2CH4 W;  1PFS A;  1X3G A;  4L5Q A;  3CXC A;  4E6I A;  3G4S A;  2A74 C;  5M3F B;  2CQA A;  3I4L A;  2EYO A;  1X3F A;  4LF5 Q;  2NVT B;  4HAE A;  4DV7 Q;  3T1Y L;  1A3V A;  3HKZ B;  4IOC A;  4A3F G;  3MXP A;  5M3F H;  1LV9 A;  2F0K A;  2A1A A;  5IYB H;  1U4P A;  1K8G A;  4M1U B;  3VYR A;  3J7Z C;  1WJJ A;  1ILP A;  1K3R A;  5C3E G;  1LTL A;  1HRJ A;  1IZ6 A;  2NBF A;  3R93 A;  2EPB A;  2JA5 B;  1WD0 A;  1HXY D;  1HTP A;  1IBK Q;  2D2C C;  1QG7 A;  4XQQ A;  3E5S A;  2L4N A;  2ID0 A;  3S1M H;  1EY0 A;  1G2S A;  1RF2 D;  1EIH A;  1NE3 A;  4AS3 A;  5EBC A;  1PRT B;  4LF6 Q;  2XTR A;  3K5M A;  2M2L A;  2WP8 J;  2JJQ A;  2Z0S A;  1NSN S;  4CGY B;  2G5D A;  2Q2T A;  3HOY G;  1LTA D;  1PH1 A;  1FR3 A;  1BVS A;  1E1T A;  2BL8 A;  1ZEQ X;  2A6H D;  2EDG A;  3HOZ B;  5IYD H;  3N6R A;  3LX0 A;  4U68 A;  4WJ3 M;  4GXT A;  2O2L D;  1K8A C;  1TY0 A;  3FPU B;  5LMN L;  5I2Y A;  3VR4 A;  4ALP A;  4I7Z C;  1S72 A;  1WD1 A;  3CCJ A;  1U0L A;  3J80 E;  1UAP A;  2K52 A;  3CPW A;  3DM1 A;  3VA7 A;  2F0Q A;  1OXT A;  2D0P A;  4HIK A;  3QOJ A;  1H9S A;  3M85 A;  1K8M A;  1G6Z A;  3HOU B;  2J0T D;  1QVF A;  1A8V A;  2C9O A;  5JVG 3;  4Q9V A;  5CGK A;  4C3H G;  1N33 Q;  5JJI A;  2SOB A;  5GAG C;  4IUT A;  1CSQ A;  5GRO A;  1NAP A;  3Q6S A;  1A2T A;  2IX0 A;  4DFA A;  3GTO B;  3P1H A;  5H1S E;  2NVQ H;  2OQ0 A;  1YNN C;  3LNN A;  3HZX A;  2MJF B;  1I50 B;  1XMO Q;  4KV6 A;  4RCN A;  3GTQ B;  1B3Q A;  1B50 A;  5D3I B;  5CC4 A;  5LMU L;  1N36 L;  3R2T A;  3I4M B;  5AFW A;  1ASY A;  1VQ9 A;  2B2W A;  2JAE A;  4JI2 L;  4BY7 G;  1EY8 A;  3DWA A;  1TWA H;  3CCL A;  1JE5 A;  4DAP A;  2AUJ D;  1WTO A;  3FKI H;  4PZ8 A;  2EY5 A;  4LFB Q;  2F0L A;  3HOV G;  2RF4 A;  3GV6 A;  4GOP C;  1HHV A;  4BBR H;  3I90 A;  4NPS A;  1I6H B;  2JA8 H;  3HFZ B;  1PTO F;  2R3Z A;  1YIT A;  3AB9 A;  5M3M B;  4F87 A;  2PMZ B;  3PO3 G;  1E3P A;  2UUA L;  5C3E B;  4BY1 H;  1LYL A;  1VQ7 A;  2F52 A;  4PL4 A;  2RSO A;  3E9I A;  3QOL A;  2E75 C;  3I56 A;  4RHS A;  1VMC A;  2OXP A;  5IGF A;  4X65 Q;  1KC8 C;  4QF4 A;  4A3B G;  4MIU A;  1H9S B;  2K01 A;  1XWE A;  1NJI C;  2PQA B;  4DV2 L;  2G9H D;  2HHH L;  3MVV A;  3J81 j;  1I4P A;  4HJ5 A;  5JAV A;  1EY9 A;  1UE5 A;  1YNN D;  1CKO A;  4YCU A;  3PMF A;  2QA4 A;  3JAM c;  3CRL C;  1LTI D;  3BDC A;  4K6D A;  4X3K A;  5IT9 E;  3UIT A;  1Q1B A;  3L0O A;  1G29 1;  1EFW A;  1AH9 A;  2R92 H;  4DAY B;  2OCE A;  1N36 Q;  1JJC B;  1JB7 A;  4XT1 B;  4DK3 C;  5COR A;  1F9R A;  3KF6 B;  1JJG A;  1VQE A;  3TS2 A;  1JOO A;  3I4N H;  3CCR A;  2C5C A;  2R7Z B;  1B2T A;  4QGU A;  3EBE A;  1G8Z D;  2IW3 A;  2B2V C;  1W6K A;  5IGD A;  5KNB A;  2UXC Q;  5FJ8 G;  4HMI A;  1TR5 A;  5E4X A;  4YZ9 A;  1I5F A;  1R4Q B;  2EY1 A;  1SYG A;  4IO9 A;  1BBW A;  5C4J H;  4B3R Q;  3H0G H;  1IBL Q;  2YFA A;  1G91 A;  4AS2 A;  3KJP A;  1N32 Q;  2UXD Q;  2V1C C;  1A15 A;  5C3X A;  1KRT A;  1KAA A;  3PIP 3;  5FO7 B;  1STH A;  1GKH A;  2PNH A;  4KK7 A;  1J5E Q;  1GO3 E;  3K5O A;  1WTX A;  2JB3 A;  3C46 A;  4H7B A;  4R8I A;  2K04 A;  1A6X A;  2AMC B;  2FFK B;  3S1Q H;  4OGQ C;  3LJ2 A;  5CBE E;  2KJX A;  5DAU A;  2QGM A;  4JCV E;  4ZUI A;  2QSB A;  2F4I A;  2HIV A;  5CV7 A;  3U50 C;  2JA5 G;  4DR7 L;  2DNC A;  4U6R A;  4G75 A;  2KHI A;  1PV4 A;  2IX1 A;  1EQR A;  2ZRR A;  4K8I A;  2EYJ A;  3FMC A;  3I72 A;  2P22 B;  2JA6 B;  3KDF A;  4PG3 A;  2DGY A;  3EA6 A;  1N34 Q;  1PVO A;  5FLX c;  4IOA A;  1EEF D;  1A3U A;  4DK0 A;  2XRS D;  1YZ6 A;  4JC0 A;  2SDF A;  4A3F H;  5E3F A;  1Q82 C;  1LT5 D;  1DM0 B;  2Z9H A;  2HD3 A;  2NZ1 D;  2RVL A;  1SE2 A;  5LL6 X;  2E2H H;  3D6W A;  4ZAI A;  3V05 A;  3PF4 A;  2MQH A;  5GAD C;  2E2H B;  3FBV A;  3BVG A;  4Z9C B;  1STA A;  2A68 C;  4JI5 L;  3OMG A;  1FNV A;  2NUC A;  4B3M L;  4RMF A;  4LF9 Q;  2RLD A;  1JWM D;  1J9O A;  4V19 0;  4JVZ A;  5GQO A;  2G9D A;  2NVY B;  1BNZ A;  2VB2 X;  2JA6 H;  3ER0 A;  2MNA A;  2ZT9 C;  4GOP B;  4KTA A;  1D5X C;  2EIF A;  4UP7 A;  1BR9 A;  2ZXO A;  4JI8 L;  4ID6 A;  1XMO L;  2K14 A;  3KLR A;  4PV1 C;  4K5V A;  4UAI A;  3ULP A;  1LM0 A;  3KBX A;  2ENB A;  2R93 B;  3HKS A;  1S5E D;  3STB D;  4R8N A;  4PL3 A;  1C7Y A;  2DJG C;  3NTK A;  2X6G A;  3KK7 A;  4OX9 Q;  2H5X A;  1PH3 A;  3PIO 3;  3MXN B;  5ELO A;  5IYC G;  3OWE B;  4ME5 A;  3JSB A;  2F1M A;  4MHE A;  2Y0S E;  4RGT A;  4YCW A;  2N88 A;  4GKJ L;  5M5Y B;  3PGZ A;  5JJL A;  2A8V A;  2E5L L;  3KDF B;  3AMU A;  2TMP A;  4ZCK A;  5EGT A;  1KLU D;  4AH6 A;  4FF1 A;  1GUO A;  1K73 C;  1KAB A;  1STY A;  4EGV A;  4POF A;  1VQC A;  2JP1 A;  4C2M H;  1UEA B;  2B2Y C;  2CW0 D;  2QKI C;  1S5B D;  1GUN A;  4QCL A;  2ETD A;  4CDE C;  4C2M B;  3VR2 A;  4C3J B;  2R7Z H;  4JBW A;  1HR0 W;  4YY3 Q;  3NXW A;  3I4N B;  2A2D A;  3S2D B;  1UE7 A;  4JPB W;  4DR1 Q;  1VQI A;  5ELF A;  1CM9 A;  2FXQ A;  2R92 B;  3EFX D;  1N8R C;  4YHH Q;  1LUZ A;  3F4M A;  5KYL A;  4LWC A;  1B8A A;  4LF7 Q;  2UUB Q;  2RQX A;  3GTJ H;  4LNQ A;  4DV0 Q;  4L5R C;  3J81 L;  2ALY B;  3HOU G;  1PRT D;  1D5M C;  3I7F A;  1F2Z A;  5C0X H;  4IZ8 A;  2JEA I;  2BE5 D;  3A5Z B;  1Y1W G;  1IBK L;  4RGM A;  2UU9 L;  4A3M G;  4H13 C;  4LF5 L;  2RSN A;  2ZTD A;  1BOS A;  4K8J A;  1PFN A;  1AW7 A;  4NXN L;  1KTK A;  2EXZ A;  1YNJ C;  3DWP A;  3R3O A;  2WB1 E;  1V1P A;  2BL7 A;  1WFQ A;  5J39 A;  5M9O A;  4HCS A;  4ZK9 B;  1ESR A;  2B2U C;  2ZXP A;  3DWQ A;  3DA4 A;  4TVA B;  4BY1 B;  2F4V L;  4HSV A;  5NUC A;  3MEF A;  3UI2 A;  2NN6 I;  5IGC A;  4LF4 L;  4C3H B;  3IRB A;  1AZQ A;  4OWT B;  1ML0 D;  1TU2 B;  2FUG 1;  1DZ1 A;  4O1O A;  4K2K A;  2EJM A;  1YJN A;  1RTO A;  2VB3 X;  4YWL A;  5KYI A;  2R6G A;  1CZW A;  4OO1 G;  4HN7 A;  3CME A;  4J15 A;  2JB2 A;  1B9N A;  1D8L A;  2ICE C;  4N8X 1;  2R61 A;  5C5M A;  3TRZ A;  2VNU D;  2EVB A;  3IFT A;  1VQ4 A;  4A3F B;  2KEC A;  3PV0 A;  1PRT F;  1G51 A;  4DXF A;  1Y69 U;  1BCP D;  1JOR A;  4AYB G;  3GTP H;  3I4M H;  1CSP A;  1SNQ A;  3M7N A;  3M4Y A;  1PH8 A;  3QIA A;  3QR8 A;  5CV6 A;  3ERQ A;  3BU2 A;  4A3I G;  5FO8 B;  3GTQ H;  1XMQ Q;  4A3E G;  1W2B A;  2ATW A;  4IQZ A;  2K1B A;  1MD2 D;  3SVM A;  1EOT A;  3A56 A;  3S9W A;  4KHV A;  3UDX A;  4JI1 L;  2IP6 A;  1PLF A;  4CKB A;  4DPG A;  4LF8 Q;  3HOW G;  3S1Q B;  4LF7 L;  1Y8O B;  2PPB C;  2D5D A;  1QUQ B;  2A69 D;  4IUQ A;  3S1R H;  2Q2U A;  2BCO A;  4O1N A;  5JEA J;  3HOU H;  1JT8 A;  4B3T Q;  5C0X G;  4HJ7 A;  1EWI A;  4A3C G;  1XPR A;  4KJN A;  3OPO A;  5EPL A;  3M3Y H;  4A3L H;  4R1J A;  3K58 A;  1L2F A;  4R4O A;  4XXE A;  5BR8 Q;  1Q1E A;  2JA7 B;  1D6E C;  5E1F A;  4LFA L;  2K6A A;  2F0P A;  2SNM A;  4K0K Q;  1VQA A;  2VZA A;  5JEA H;  2ZW3 A;  1PDQ A;  3H0G B;  5C4X G;  5C4J B;  2KKM A;  5IGB A;  3SR1 A;  3QG1 A;  3DM3 A;  4RKB A;  5HY6 A;  3I55 A;  1ZXT A;  1AEX A;  3JAM E;  4DK1 A;  2CKZ B;  4YWK A;  4KY7 A;  1HA5 A;  1U4R A;  1A62 A;  1JQO A;  3B55 A;  5M5X B;  4R9W A;  2JYO A;  5IYC H;  1X56 A;  4PMC A;  3CP0 A;  1EFI D;  4FF3 A;  1VQ6 A;  3F2C A;  1FJG Q;  3OSO A;  3LJ0 A;  1Q86 C;  3J81 c;  4A3I B;  2GA4 B;  3NEM A;  4LMQ D;  1VS0 A;  2X6L A;  2MP1 A;  2KBN A;  1OXV A;  4GNX A;  2NVT H;  1ZKO A;  3T16 A;  1D2B A;  4OX9 L;  2F0F A;  4X64 L;  3E0J A;  3PUX A;  4PNY A;  5JVH 3;  2B63 B;  3K5L A;  1S40 A;  1IYV A;  2ICI A;  2L1L B;  4X62 L;  1I3Q H;  4IFD H;  3RN5 A;  3D4D A;  1HCZ A;  5IT9 c;  2MFI A;  2RCF A;  4G76 A;  1TWF B;  2VY3 A;  3U9S A;  3G48 A;  1DGS A;  4GOP A;  2A5H A;  5LMN W;  1QE6 A;  3A0J A;  1CKN A;  3B6Y A;  4JI0 Q;  2F66 B;  2F0E A;  3IKJ A;  2IHF A;  2JXM B;  1LTT D;  3RZO B;  2UXB Q;  3DA3 A;  5L37 A;  2EOT A;  4MN3 A;  4TQU S;  4YHH L;  3OW7 A;  4HED A;  1MHW C;  1O7I A;  2PZT A;  2JQO A;  5IIF A;  1AE2 A;  1JE4 A;  1IBL L;  2JA8 B;  4C1N K;  2F6M B;  3S24 A;  1I6H H;  3FKI G;  1U4L A;  2AUK A;  4N9T A;  1DJR D;  5G3L F;  1LT4 D;  3DEP A;  2A73 B;  2XGT A;  2F0S A;  4DR5 Q;  1BKB A;  3OOC A;  1GM5 A;  2KCT A;  4BBR G;  1NMF A;  4XT3 B;  4BY7 B;  1HQR D;  2E74 C;  1TS5 A;  3TP5 A;  3RZD B;  2D0O A;  5FLM G;  1PRT C;  1BCP F;  2AWN A;  1HA6 A;  5C44 G;  3A8K E;  2RDG A;  1HH2 P;  1JWS D;  1XTD A;  4AQY Q;  1IXR A;  1PH4 A;  3K80 C;  3OHX C;  4HR7 B;  3G7L A;  4DR4 Q;  1XTC D;  3W1B A;  1I50 H;  3K7U C;  5KGU A;  1WTP A;  4A3K B;  1B53 A;  1S5D D;  2CW0 C;  4ILW A;  5FK9 C;  2HDL A;  1SLJ A;  4ULL A;  4J6H A;  4O42 A;  4H02 A;  4IPD A;  5IOD A;  3A7L A;  3PUZ A;  3SDJ A;  1E2V A;  2KHS A;  2PCF B;  3VR3 A;  1TY2 A;  3T1Y Q;  4BY7 H;  1ZYR C;  4C3I B;  3JAM i;  1JB3 A;  3HKZ E;  4IJH A;  1K0R A;  4BS9 A;  4R4Q A;  3KJO A;  1SNM A;  3ND8 A;  1CKM A;  2RKS A;  3PUW A;  1I4Q A;  3NHH A;  1WI5 A;  4OEM B;  4GN4 B;  2B2V A;  4LAA A;  3W1G A;  3EJI A;  4RG1 A;  3RZO H;  2UXC L;  2QGQ A;  4NV2 A;  2PW7 A;  4ZYS A;  1SJE D;  2I07 B;  1IL2 A;  1M90 C;  3H3V I;  1QNK A;  3STB C;  2OTL A;  1KNE A;  1X65 A;  2Q2H A;  2WAQ E;  1UWV A;  3G6J B;  5LNK 1;  3S1M B;  3BZC A;  2LFN A;  1TWF H;  4EQ5 A;  2OF1 A;  1EY7 A;  3HRZ C;  1XXG A;  1QZH A;  2OTJ A;  1CA6 A;  1SFO H;  3BYY B;  2AQ3 B;  3A8J E;  1JC7 A;  3DLL A;  2IPK D;  2PI2 E;  1H9K A;  3DXJ C;  4XQN A;  1RTN A;  2K5V A;  4JI4 L;  5E4W C;  5LL6 S;  2B63 H;  1Q81 C;  3VYU A;  2F3I A;  3O13 A;  4LF6 L;  2AKW B;  1LAB A;  1RHP A;  5ELC A;  3C3L A;  1X3Q A;  2Z4I A;  4A3I H;  1STB A;  2OT2 A;  1X32 A;  3HEJ A;  2ZJP A;  1CQF A;  2E2I B;  5DEH A;  1HZ9 A;  1RJT A;  3DO9 A;  5ELB A;  1HFG A;  3EQL C;  4P75 A;  3BVM A;  4EQP A;  4DV1 L;  3CPF A;  1ICW A;  2K5H A;  3PF5 A;  4G7H C;  2PW5 A;  3HOX H;  1DOL A;  3CCV A;  4A3L G;  1JOQ A;  2X69 A;  4Z7G A;  4CHT B;  5CV9 A;  4C3I G;  1FJG L;  3OTO Q;  2B2T C;  4BBS G;  2KOL A;  1HNX Q;  1TVX A;  3S1N B;  3FDT A;  5BN3 A;  2ES2 A;  2MGS A;  2JA7 H;  1S3O A;  4DU9 A;  1UUP A;  1HQM C;  3RUZ A;  1LTB D;  1PYW D;  3JAM L;  1JMC A;  3AYH B;  4X64 Q;  1KNA A;  1EOV A;  4G7O C;  1RL2 A;  2I46 A;  1DD2 A;  1QOH A;  3OW2 A;  1E2Z A;  2L1B A;  1BO0 A;  4LFB L;  1L1O B;  3K7A B;  4K5W A;  3VR5 A;  2GN5 A;  5LMU Q;  3A5U A;  2XWJ B;  3D8G A;  3P75 A;  4GN5 A;  3AFQ A;  4NP5 A;  4OHJ A;  5EKI A;  3RN2 A;  1GHK A;  3MFG A;  1MJE A;  2UUA Q;  1SEB D;  1PTO B;  2JSO A;  2NZH A;  4K14 A;  4C1N I;  2A6H C;  3U4Z A;  3BG3 A;  3TZU A;  1RKN A;  2ZTE A;  5GAE C;  1C8C A;  1FD7 D;  3K81 C;  4DXG A;  4APV A;  1YJW A;  3W2D A;  1Z7T A;  2VW9 A;  1B7Y B;  4G4K A;  1Q46 A;  3KYH C;  4A4I A;  1S5F D;  2EYH A;  5C44 H;  4L5T A;  2Y0S B;  1G2T A;  4LW1 A;  1VQ5 A;  2RAD A;  3S17 H;  2EYF A;  2A6E C;  2KEE A;  3ONA B;  2B2U A;  2KHJ A;  5IYD G;  5F2D A;  3DHQ A;  3X3N A;  2KEN A;  3PIP A;  2WKC A;  2I0Q A;  1J6Q A;  3AEV A;  1YIJ A;  1CI3 M;  2YYZ A;  3S15 B;  3KF6 A;  3NK9 A;  1YHB A;  1Y1V B;  1PTO C;  1SMX A;  2RDH A;  1SYE A;  4C3H H;  1EU4 A;  3HP3 A;  3CW2 C;  5M5W B;  2VS1 A;  4A3J G;  3M4O H;  1UNS A;  1SN8 A;  1U4M A;  1CHP D;  1DOM A;  4AQY L;  2DY8 A;  2F0G A;  1XPU A;  3UDF A;  3D6C A;  4GLX A;  5T1I A;  3S2H H;  1HFN A;  3ND9 A;  1GUW A;  5C0X J;  3HOW B;  4GLV B;  1PZK D;  1WYD A;  1BCP C;  5IWA Q;  4KKT A;  5CV4 A;  1F9S A;  1SND A;  4K6L A;  1Q8K A;  1I94 Q;  2JA9 A;  1TWG H;  2JA7 G;  3PO2 H;  3HGB A;  4IN3 A;  3T4A C;  3J80 L;  1HTL D;  2VQF L;  2IX3 A;  1L0W A;  1N33 L;  3BZK A;  1YHQ A;  4KD4 A;  2ZJQ A;  1IL8 A;  1PH9 A;  1H9J A;  4B3R L;  1V1P B;  2F0D A;  4HIO A;  4DAY A;  1RDP D;  1TDP A;  1X55 A;  4KD3 A;  1VQO A;  1K9M C;  1C48 A;  1S5C D;  2YU9 B;  4A93 G;  4DR2 L;  2JN4 A;  2JA8 G;  3T13 A;  1LAC A;  5EAY A;  2WAQ G;  3HOV H;  2RCN A;  4GNX B;  4PMB A;  1O7Y A;  2HUG A;  4X66 L;  3ZJY C;  2FEF A;  1AZP A;  5IWA L;  1HZC A;  1VQG A;  3QJY A;  1TWC H;  3L3O C;  1JCK B;  4DV0 L;  3P7J A;  1SMY D;  1OO9 B;  1WTW A;  2C35 B;  3NBH A;  3C1F A;  2E2J H;  4X62 Q;  4CDF C;  3T51 B;  2ZM6 L;  4G7Z C;  2I5L X;  2VUM B;  1PH5 A;  3CCQ A;  4L63 B;  2JE6 I;  2WAQ B;  5HGQ A;  1EY4 A;  3NE5 B;  5HGI A;  1X9N A;  3TP8 A;  5E7N A;  3TBI B;  2QDL A;  1M4V A;  4WFN 3;  5HUR A;  3Q23 A;  4HCE A;  4P72 A;  2VQE Q;  2KCM A;  1K28 A;  3D4W A;  4J1M A;  4NXM Q;  1JWU D;  2B3G A;  4NKL A;  4R4T A;  2R93 H;  4IUV A;  1A3T A;  2R92 G;  3IAY A;  2K50 A;  5FO9 B;  3I91 A;  1FYC A;  1F9P A;  4RCO A;  4JYA L;  4X3S A;  4S3S A;  1Y14 B;  3BYT B;  1B9M A;  4DV7 L;  3LWU A;  4LUZ A;  2KUM A;  2E2D C;  3FVQ A;  2IY5 B;  2Z6K A;  1F77 A;  4P73 A;  1FNU A;  5KRU A;  2LMC B;  5IY0 A;  5JOB A;  4IUU A;  1B44 D;  1F9Q A;  2NVY H;  3J80 c;  5JPN C;  3S14 B;  4F8M A;  1K8O A;  3CU7 A;  4YZC A;  2AWO A;  5D65 A;  1HNZ L;  3OYY A;  1KXL A;  2PZW A;  3IFD A;  1GUG A;  1SR3 A;  3RLO A;  5FJ8 H;  4A3C H;  4HTH A;  1BCP B;  1X54 A;  1BUV T;  1YI2 A;  5BN4 A;  1Z9F A;  4BA2 I;  1D5Z C;  1TT2 A;  3FRP B;  4Y7N H;  4RGO S;  2E2J B;  1QZG A;  5IE8 A;  4L8J A;  1PA6 A;  1VQH A;  4DV5 Q;  2H4O A;  4ZRZ A;  1WCM G;  4DNT B;  3NBH B;  1SRU A;  1PHJ A;  1LO5 D;  3VDY A;  4DKA C;  1UE1 A;  4JYA Q;  4WJW A;  2V6E A;  3K57 A;  1YJ9 A;  2ZJR A;  5C6A A;  1PZI D;  1SMY C;  1XPO A;  3WDN A;  3CCU A;  1SAP A;  2D9U A;  1A63 A;  4IJL A;  1GD7 A;  3GD7 A;  4JI7 Q;  3TQY A;  2RIO A;  3KF8 A;  4ODG A;  4BBS H;  1FL0 A;  1X3P A;  3VYS A;  2YU9 H;  1SNO A;  3E9H A;  1WOC A;  1VDZ A;  1DXM A;  1SRO A;  4R4C A;  1Q90 A;  2QCP X;  4DV6 L;  3K0X A;  4DR3 Q;  1VCI A;  2E5L Q;  2SNS A;  3TSS A;  4PZ6 A;  3NEL A;  4R4I A;  3NWS A;  4A3J H;  1TXY A;  3J81 i;  1VF7 A;  4DUY L;  2R93 G;  1FNW A;  1TWG B;  1QVC A;  1D1I A;  4JI4 Q;  3F8T A;  3EIV A;  2F0U A;  4B08 A;  4JI6 Q;  1M1K C;  1QCB D;  4OAV B;  3CMA A;  3S2H B;  3CC7 A;  3L0I A;  1KDA A;  4N8F A;  1E1O A;  1Q3L A;  1PH2 A;  4JI7 L;  3FEW X;  1N34 L;  4JI5 Q;  3VA9 A;  1WCM B;  4ZKC B;  1PZJ D;  4P71 A;  2UUC Q;  4GKK L;  4DV2 Q;  2HHH Q;  2A6E D;  2N49 A;  2YTV A;  4ABN A;  3SK6 A;  1Q7Y C;  2Z1C A;  2ASB A;  5A2Q E;  1EQT A;  3IL8 A;  1E0B A;  1VQ8 A;  5FLX E;  4CJ1 B;  4LFC L;  2CAZ B;  2EYM A;  1BQQ T;  2JK8 A;  4QB4 A;  4MTK A;  4DV5 L;  1DON A;  3GTG B;  1EWH A;  2OEO A;  2Z8L A;  1VQJ A;  2F0W A;  2NB0 A;  3RR5 A;  3R8B A;  4NB3 A;  2RBM A;  1ROD A;  2MUY A;  4EVO A;  2XNA C;  1WTQ A;  2A2C A;  4QY7 A;  2NN6 G;  1PTO H;  1B3A A;  4DR6 L;  2L5T A;  2SEB D;  3H09 A;  4WJ4 A;  3ULJ A;  4KHP L;  2WV6 D;  3PQI A;  1NR4 A;  3MZ5 A;  4BXX H;  1LTG D;  4XIG S;  1TWH B;  2CWP A;  3K7A H;  4DN4 M;  3PIO A;  2K33 A;  2BDN A;  1VQP A;  1BF4 A;  3G6E A;  3A55 A;  4RH6 A;  1R9T B;  1QNU A;  2PNR C;  3BVZ A;  4AYB E;  5M3F G;  2J4X A;  3MC0 B;  1GHJ A;  5J3B A;  5C3E H;  3NWT A;  3DEO A;  3CKI B;  5M3M H;  3T1H Q;  1IBM Q;  3GTL B;  4GLA C;  1XMQ L;  1QVG A;  1H9M A;  3CQZ B;  2NVX B;  4DK6 C;  4Q0F A;  4P74 A;  5IP7 G;  1HR0 L;  5CV5 A;  3HS0 C;  1EYD A;  3MAQ A;  4DAM A;  2CH4 A;  4FF4 A;  4NV5 A;  1SE3 A;  3Q8D A;  2FMM A;  3I73 A;  2LXJ A;  3SHL A;  4HFV A;  3NBI A;  3TRE A;  4XQJ A;  3FP9 A;  1TWA B;  4O1P A;  3T53 B;  3GQB A;  3Q24 A;  1Y1W B;  4ZUJ A;  4DV4 L;  2CCZ A;  4GNX C;  2B2T A;  1JOK A;  1YNJ D;  2NZO A;  1HUM A;  3MEH A;  2MHV A;  5D3D A;  1FVI A;  4A3B B;  1B1Z A;  1IW7 D;  2L55 A;  5KEE A;  2E2I H;  1H9R A;  4K0K L;  2Z6B A;  3K8A A;  1GOZ A;  3CAM A;  2EYP A;  1MKH A;  2VL6 A;  2EY6 A;  4DR1 L;  1SNP A;  2NVQ B;  2QZG A;  4UPA A;  2CWA A;  3UE0 A;  1J5E L;  3GTO H;  5I6Y A;  1GUS A;  2K7V A;  4CDC C;  2EJG C;  1Q8I A;  3PO3 B;  3CRK C;  1SYF A;  4PQX A;  5G3L D;  3D4R A;  1T9H A;  4HSP A;  1X6O A;  2PZU A;  1JR0 D;  2A19 A;  2QEX A;  4GN3 B;  1SFO B;  1ZYR D;  1PYS B;  3BDO A;  2J7Z A;  4OWW B;  2QF7 A;  3DMU A;  1MIU A;  2VUM G;  2RHQ B;  3BDL A;  5T1G A;  5K36 H;  1K83 H;  1IYJ B;  1SYC A;  1V1O A;  4FO2 A;  1JQY D;  4OO1 H;  5ELE A;  1PH7 A;  4JI2 Q;  3HOZ H;  3T1H L;  1IBM L;  1SBB B;  4A3G B;  2JBW A;  1ESF A;  1CA5 A;  2MPM A;  1WTH A;  4BWG B;  3HOY B;  1K83 B;  3E3X A;  4YWM A;  4DNR B;  3I4N G;  3P20 A;  1V8Q A;  2Q8I B;  3RLF A;  3RMH A;  2K19 A;  3I4O A;  4C3I H;  4DR3 L;  3ZYY X;  1STE A;  2HQE A;  1X3E A;  2XVS A;  4DAV A;  5IGG A;  5C3W A;  2YTX A;  4KKS A;  5BN5 A;  2LY7 A;  5TSS A;  4QUC A;  1IHZ A;  1YBY A;  4A3K G;  2QDB A;  3PO3 H;  1HNW L;  4RAU C;  3H15 A;  4HJ9 A;  1F2L A;  2PYK A;  3RLN A;  1II3 A;  1WVL A;  4X3T A;  4EX5 A;  1DCZ A;  2NYZ D;  4IUR A;  4V0B A;  2BH2 A;  4IPC A;  3S16 B;  5C4X H;  1HNX L;  3GO5 A;  2XTI A;  3OTO L;  3I9V 1;  4GKK Q;  2L9H A;  4A3B H;  4C3J G;  5K5P A;  4K5X A;  1U5K A;  5JEA G;  1HZB A;  2QEJ C;  4A3D B;  3MXU A;  2L0C A;  2F0I A;  2K5W A;  2K5Q A;  1PH6 A;  3RZD H;  3GTM B;  1NY4 A;  3KUP A;  2UUC L;  4A3G G;  2TSS A;  2R7F A;  2NTS A;  1MI2 A;  1VQK A;  2LS0 1;  3HOX G;  1ASZ A;  1KAW A;  2NN6 H;  1EYG A;  2A68 D;  4OIK A;  1SSO A;  3GTK B;  1C9O A;  3L7Z C;  3PUY A;  2OQK A;  1N9W A;  4GZY C;  4GS3 A;  1B4O A;  3GTL H;  4FDB A;  3D3R A;  1AN8 A;  5EQ0 A;  1DOK A;  5GAH C;  3OMC A;  4CJ0 B;  4KHZ A;  3HOZ G;  2K5D A;  2RA4 A;  2FJ2 A;  3NQI A;  1FGU A;  1KD1 C;  1UE6 A;  1ICF B;  3UE1 A;  1NR2 A;  3BZD B;  5CBA E;  1R9T H;  3MXG A;  3AQQ A;  4LJZ C;  4DR6 Q;  1HZA A;  2F03 A;  3JC6 6;  3MHB A;  3A7A B;  3GP7 A;  2F3W A;  5EKK A;  2EJF C;  3AJF A;  2EZV A;  3LJ1 A;  1VQB A;  4B9X A;  2K32 A;  2QW7 A;  1TII D;  1QWY A;  4FNF A;  4UDU C;  1LT3 D;  4QUF A;  3TS0 A;  5I6W A;  3H0G G;  5C4X B;  4IPG A;  5A35 A;  1EQV A;  3S16 H;  1HNZ Q;  2PQA A;  1I3Q B;  2WKD A;  4F7X A;  4DV3 L;  1MJC A;  4N9P A;  1HUN A;  5IP9 H;  1EY5 A;  1YHA A;  3HKZ G;  3KLW A;  4IUP A;  5AJ3 Q;  5I9O A;  1SJH D;  3CC2 A;  1EYC A;  4IAL A;  5CMD A;  4I1T A;  3SE0 A;  3X3M A;  3SXH A;  2N78 A;  3TP7 A;  1Z47 A;  2PO4 A;  3RD4 A;  1KLG D;  4FYD A;  3D0F A;  4NXN Q;  1VQD A;  1NCV A;  3H6M A;  1O7L A;  2UUB L;  2OWO A;  4LUV A;  2YV5 A;  5A2Q L;  3CCM A;  4BA1 I;  1ILQ A;  1J8I A;  1NMG A;  3LGJ A;  1M8A A;  5DLQ E;  1C0A A;  1QUQ A;  2K03 A;  1ENF A;  2KCN A;  2EY2 A;  5M5X H;  1EYA A;  3N52 A;  1XYI A;  4L5S A;  1C4Q A;  2GVB A;  2JEB I;  2WFW A;  3HOY H;  2DJF C;  4JI6 L;  3H3V C;  4JBJ A;  4LF9 L;  1ET9 A;  4A3G H;  1T5E A;  1MSH A;  1EY6 A;  3SK4 A;  4X66 Q;  3W5O A;  1CKN B;  4CBV A;  3KLS A;  4JI1 Q;  4Z7H A;  3MA2 B;  1XX8 A;  3G71 A;  2KA7 A;  3M4P A;  4LF4 Q;  4KMU C;  2XRQ D;  3AU7 A;  4IFD G;  3PCO B;  1H95 A;  1VQN A;  3C2P A;  2NTT A;  1CT1 D;  1D7Q A;  1XNQ Q;  4MNO A;  3H91 A;  4MTN A;  1LTR D;  2WIN B;  3J80 i;  3M3Y B;  1E24 A;  3A54 A;  4A3J B;  3E6Z X;  4A3M B;  3S1R B;  1L0X B;  4OEL B;  1Y1V G;  5AJ3 L;  3A74 A;  3FNB A;  1STN A;  1D1K A;  4FF2 A;  1LT6 D;  1TQO A;  1K3B C;  3SEB A;  1SNC A;  5EJW A;  2L15 A;  2JA6 G;  1PFM A;  2H1E A;  4EQN A;  4GKJ Q;  4DWL A;  4A93 B;  5LMN Q;  4HJA A;  2BA0 A;  3MFY A;  4JW0 A;  1OXU A;  3V2T A;  1YNX A;  4DV3 Q;  2N55 A;  2B8F A;  1KDC A;  4O0A A;  3GTP B;  1TKW B;  1VMP A;  2F3V A;  4QMG A;  4JOI A;  3TDQ A;  2VQE L;  1Y1W H;  2RHS B;  5FOB B;  3M4Q A;  4JI3 L;  1SE4 A;  2IT1 A;  4YY3 L;  3OIP A;  1R4P B;  1EUJ A;  4KY6 A;  1JJ2 A;  4Y7N B;  3NP8 A;  2B2Y A;  4WRD A;  2MJ8 A;  4L6T B;  3I2Z A;  3NSW A;  3CQZ H;  3K6O A;  2NVX H;  4NW2 A;  4X6A H;  1IYU A;  3VA5 A;  2QIL A;  2F0T A;  2LSS A;  1P16 A;  4NXM L;  5EPJ A;  2B29 A;  2NWG A;  1L1O A;  3S14 H;  4F88 A;  5EPK A;  4OON A;  3D31 A;  2HGK A;  2K05 A;  1I6V C;  2GVA A;  4OAU C;  1I4X A;  2EXD A;  2N8N A;  4B3S Q;  2F4V Q;  1TWH H;  3CD6 A;  3H94 A;  3J7A 5;  4I65 A;  2WII B;  3R2I A;  1I4H A;  4CKC A;  3NPP A;  1NUC A;  4A75 A;  1ONL A;  4JV5 Q;  2DN8 A;  3SK5 A;  3J7Y W;  3ULL A;  1RCV D;  4OL7 A;  4RA8 A;  4XTC S;  2Z6K C;  2MO0 A;  4O2D A;  3L2P A;  1VQL A;  5IGE A;  4KKU A;  3GTJ B;  4XDX A;  4QIW B;  2UU9 Q;  2XMX A;  1YEZ A;  5COY A;  3SK8 A;  2FHT A;  4RGN A;  3GTG H;  3J7A F;  1E7Z A;  2WB1 G;  4IFD J;  1EWC A;  1CZG A;  5JJK A;  5CYU A;  1CQV A;  3KP9 A;  2AQ2 B;  4DR2 Q;  1XNR L;  3S2D H;  2O5J C;  1EIG A;  4DV4 Q;  5I4D A;  1EU3 A;  4C3J H;  4DF7 A;  2BA1 A;  4RFB A;  1YVC A;  2IJ0 A;  1E2W A;  1F2M A;  1RIP A;  1JIC A;  2IWH A;  1ET6 A;  4KJO A;  3BJU A;  4DV1 Q;  2EQS A;  1WCM H;  5FLX L;  1AE3 A;  2BDO A;  2FMC A;  4KLK A;  3CHB D;  2CFM A;  1TS4 A;  1O7Z A;  1TS2 A;  4FP5 D;  4A3E B;  4DGZ A;  2XN9 C;  2ZXR A;  2CHB D;  3I3C A;  4XYQ A;  1GJX A;  4X3U A;  5JPM C;  5M5Y H;  2E8G A;  2K75 A;  1BXT A;  4OIJ A;  3T56 B;  4KY5 A;  3RNU A;  4JG2 A;  1NTG A;  2VXW A;  1BBX C;  2Q8T A;  5HGT A;  3CF5 A;  3ERO A; 
#chains in the Genus database with same CATH homology
 1I50 H;  4DR6 L;  2QA4 A;  3JAM c;  3K7U C;  1A0I A;  1CUK A;  3PUV A;  3UDG A;  4WJ4 A;  3ULJ A;  4KHP L;  2XTQ A;  1BBU A;  3I4M G;  3H3V H;  1SLJ A;  4BXX H;  4XIG S;  3UIT A;  1Q1B A;  3L0O A;  1G29 1;  2CWP A;  3K7A H;  3ICE A;  3PIO A;  4KI0 A;  1HJP A;  1VQP A;  1EFW A;  4H02 A;  4IPD A;  3WWV A;  3G6E A;  2R92 H;  3HOW H;  4DAY B;  2OCE A;  3PUZ A;  3SDJ A;  2K4K A;  4A3E H;  4AYB E;  1N36 Q;  3UDI A;  1JJC B;  5M3F G;  3T1Y Q;  1JB7 A;  4BY7 H;  4IFD I;  4DK3 C;  5J3B A;  3KF6 B;  3JAM i;  1VQE A;  3TS2 A;  4PMW A;  1JJG A;  3I4N H;  3HKZ E;  4IJH A;  3CCR A;  1K0R A;  5C3E H;  4QGU A;  3EBE A;  3F2D A;  5M3M H;  4R4Q A;  3M9B A;  5M5W H;  3KJO A;  3T1H Q;  1IBM Q;  4QQB X;  4HIM A;  4GLA C;  1XMQ L;  1CKM A;  1Y1V H;  1QVG A;  2UXC Q;  4DK6 C;  3PUW A;  4P74 A;  5IP7 G;  5FJ8 G;  1HR0 L;  3U4V A;  4DUZ L;  1WI5 A;  4IPH A;  4DAM A;  4YZ9 A;  4NV5 A;  5M3M G;  1I5F A;  4GN4 B;  2JA7 G;  2HIX A;  3Q8D A;  2PI2 A;  3W1G A;  2LXJ A;  5ELN A;  4IO9 A;  4RG1 A;  3RZO H;  4HFV A;  1BBW A;  2QGQ A;  4NV2 A;  3FP9 A;  3H0G H;  3TRE A;  5IP7 H;  2YFA A;  5C4J H;  1IBL Q;  1IL2 A;  4B3R Q;  4O1P A;  1M90 C;  4UY8 C;  3H3V I;  3STB C;  2OTL A;  1X65 A;  4AS2 A;  2Q2H A;  3KJP A;  4DV4 L;  1N32 Q;  2UXD Q;  2CCZ A;  3PO2 G;  2V1C C;  2WAQ E;  1UWV A;  4GNX C;  5LNK 1;  1KRT A;  3BZC A;  4PL5 A;  1TWF H;  2NZO A;  4EQ5 A;  1HR0 Q;  1FVI A;  2YTY A;  5IYB G;  1QZH A;  1XJV A;  2E2I H;  2OTJ A;  1I94 L;  2BH8 A;  1GKH A;  2PNH A;  1SFO H;  3DLL A;  1VQM A;  1J5E Q;  1Q12 A;  4K0K L;  3K8A A;  1GO3 E;  2PI2 E;  3CAM A;  4B3M Q;  1MKH A;  2JB3 A;  2VL6 A;  3GDE A;  1V1Q A;  2DUD A;  2K5V A;  4MZ9 A;  4DR1 L;  4JI4 L;  4UPA A;  1I6H H;  2AMC B;  2CWA A;  3UE0 A;  1Q81 C;  1J5E L;  2B63 H;  2F3I A;  3GTO H;  3S1Q H;  3LJ2 A;  4JI3 Q;  2YFB A;  4JCV E;  4LF6 L;  2AKW B;  2HIV A;  1T9H A;  3U50 C;  3CCE A;  2JA5 G;  1X6O A;  2Q2I A;  2R7D A;  4U6R A;  4HJ8 A;  4DR7 L;  4G75 A;  4A3I H;  2A19 A;  2KHI A;  1PV4 A;  2IX1 A;  2QEX A;  1EQR A;  2ZRR A;  4GN3 B;  2ZJP A;  4DV6 Q;  1PYS B;  2P22 B;  4YZD A;  3KDF A;  4PG3 A;  2DGY A;  4OWW B;  1MIU A;  4A3D G;  4X65 L;  1N34 Q;  2UXC L;  1PVO A;  4OO1 I;  1KHI A;  5FLX c;  2VUM G;  1HZ9 A;  4IOA A;  3DO9 A;  2RHQ B;  4JBM A;  4POG A;  1EIF A;  1YZ6 A;  4JC0 A;  4P75 A;  1K83 H;  1IYJ B;  4A3F H;  1H95 A;  1L1O C;  4DV1 L;  1Q82 C;  3CPF A;  2K5H A;  1PH7 A;  3PF5 A;  4JI2 Q;  2E2H H;  4JI0 L;  2VUM H;  3HOZ H;  2MO1 A;  3T1H L;  1IBM L;  3HOX H;  1OTC A;  2I5H A;  1VQF A;  3PF4 A;  5K36 G;  3CCV A;  2MQH A;  4A3L G;  4LUO A;  5GAD C;  3FBV A;  3F2B A;  1KL9 A;  4Z7G A;  1FJG L;  4BBS G;  3OTO Q;  4LFC Q;  4JI5 L;  5C0X I;  1HNX Q;  4YWM A;  3EN2 A;  2R7Z G;  2ES2 A;  3KOJ A;  4DR5 L;  2JA7 H;  1S3O A;  3I4N G;  4B3M L;  4RMF A;  4LF9 Q;  4DUZ Q;  3F1Z A;  3RLF A;  2K19 A;  3I4O A;  5GQO A;  1KQS A;  1JMC A;  3AYH B;  4C3I H;  3CC4 A;  4PZ7 A;  4X64 Q;  4DR3 L;  3ER0 A;  2JA6 H;  1EOV A;  1X3E A;  1RL2 A;  4JOI C;  1KRS A;  2MNA A;  4YCV A;  3OW2 A;  4GOP B;  4DUY Q;  4UP7 A;  2EIF A;  4A93 H;  2YTX A;  4JI8 L;  4LFB L;  1L1O B;  5BR8 L;  2GN5 A;  1XMO L;  1XNR Q;  5LMU Q;  2K14 A;  3A5U A;  4GKK L;  1YBY A;  4A3K G;  5FLM H;  2HQL A;  1V43 A;  4HEA 1;  3PO3 H;  4AIM A;  3TEH B;  3H15 A;  4HJ9 A;  3ULP A;  1HNW L;  1LM0 A;  4B3T L;  4GN5 A;  3RLN A;  2HT1 A;  3AFQ A;  4EX5 A;  3RN2 A;  1MJE A;  1XNQ L;  2BH2 A;  2UUA Q;  3HKS A;  4IPC A;  3SGI A;  3STB D;  4A3M H;  2NZH A;  5C4X H;  1HNX L;  4PL3 A;  3GO5 A;  4JV5 L;  2XTI A;  3OTO L;  3I9V 1;  1C7Y A;  4OX9 Q;  2H5X A;  3U4Z A;  4GKK Q;  4DNI A;  1PH3 A;  2ZTE A;  5GAE C;  3K81 C;  4A3B H;  3MXN B;  4OXP A;  5ELO A;  5IYC G;  4APV A;  1YJW A;  1U5K A;  3JSB A;  1HZB A;  5JEA G;  2VW9 A;  1B7Y B;  2Y0S E;  4YCW A;  1Q46 A;  3KYH C;  1E22 A;  4GKJ L;  3PGZ A;  4A4I A;  5JJL A;  2A8V A;  5C44 H;  4L5T A;  3KDF B;  2E5L L;  2K5N A;  1PH6 A;  3RZD H;  4LW1 A;  1VQ5 A;  1NY4 A;  4A76 A;  3S17 H;  2UUC L;  4AH6 A;  4BY1 G;  4A3G G;  5IYD G;  2KHJ A;  1K73 C;  1EIY B;  1HNW Q;  2UXD L;  1GVP A;  2R7F A;  3AFP A;  4HID A;  4POF A;  1VQK A;  1VQC A;  2KEN A;  3PIP A;  3HOX G;  1ASZ A;  1KAW A;  1EYG A;  1SJ8 A;  4C2M H;  1J6Q A;  2I0Q A;  3AEV A;  1YIJ A;  4KHP Q;  1C9O A;  3L7Z C;  2YYZ A;  3PUY A;  2OQK A;  3KF6 A;  1YHB A;  1N9W A;  2PMZ E;  3S15 H;  1SMX A;  4GS3 A;  4C3H H;  3GTL H;  4UP8 A;  4FDB A;  1P8L A;  3CW2 C;  2VS1 A;  4DR7 Q;  1YO7 A;  4A3J G;  2R7Z H;  3M4O H;  4Y52 H;  4JBW A;  1HR0 W;  1SN8 A;  4YY3 Q;  2A2D A;  5GAH C;  1OXS C;  4KHZ A;  3HOZ G;  4AQY L;  1XPU A;  1UE7 A;  3UDF A;  1EQQ A;  4GLX A;  2Y0S G;  3S2H H;  2AHO B;  1FGU A;  1KD1 C;  1UE6 A;  3UE1 A;  5C0X J;  1VQI A;  4DR1 Q;  2FXQ A;  4GLV B;  3AQQ A;  1WYD A;  1R9T H;  1N8R C;  4DR6 Q;  1HZA A;  5IWA Q;  2LXK A;  4YHH Q;  3JC6 6;  1PYB A;  1LUZ A;  3F4M A;  1Q8K A;  2JB1 A;  4LWC A;  3FHW A;  2JA9 A;  1B8A A;  3AJF A;  1TWG H;  1I94 Q;  2UUB Q;  3LJ1 A;  1VQB A;  4A3K H;  3GTJ H;  4LF7 Q;  3PO2 H;  4LNQ A;  4DV0 Q;  1KIX A;  4JBK A;  2IHE A;  4L5R C;  2ZTC A;  2ALY B;  3TS0 A;  3HOU G;  3H0G G;  3I7F A;  4IPG A;  2VQF L;  2JEA I;  3A5Z B;  1L0W A;  1N33 L;  3S16 H;  1Y1W G;  1IBK L;  2PQA A;  3BZK A;  1HNZ Q;  1YHQ A;  3PSI A;  4A3M G;  2UU9 L;  4DV3 L;  1PH9 A;  2ZJQ A;  3IAS 1;  1MJC A;  2ZTD A;  3P23 A;  4LF5 L;  4B3R L;  4HIO A;  5IP9 H;  1YHA A;  3HKZ G;  1X55 A;  2CQO A;  3KLW A;  5AJ3 Q;  1VQO A;  4NXN L;  1K9M C;  3CC2 A;  2B63 G;  3U58 A;  4A93 G;  4I1T A;  4DR2 L;  2N78 A;  1Z47 A;  2JA8 G;  5EAY A;  2WB1 E;  3D0F A;  3KF8 B;  1VQD A;  4NXN Q;  5IP9 G;  4LF8 L;  1WFQ A;  2WAQ G;  2UUB L;  1SE8 A;  2OWO A;  4LUV A;  3HOV H;  2YV5 A;  2RCN A;  4GNX B;  3CCM A;  4BA1 I;  3DA4 A;  1NBW A;  4TVA B;  4X66 L;  2D62 A;  3ZJY C;  2F4V L;  1W3S A;  2ZM6 Q;  5IWA L;  4OWX B;  4B3S L;  2VQF Q;  1NMG A;  3LGJ A;  5DLQ E;  1HZC A;  1VQG A;  3MEF A;  1C0A A;  1QUQ A;  1TWC H;  1AH9 A;  2NN6 I;  3S1N H;  2N3S A;  5M5X H;  4LF4 L;  4DV0 L;  2UXB L;  4L5S A;  3IRB A;  2GVB A;  2JEB I;  3GTK H;  4OWT B;  2WFW A;  3HOY H;  1B70 B;  2FUG 1;  3E0E A;  4O1O A;  4JI6 L;  1YJN A;  2C35 B;  4JBJ A;  4YWL A;  2E2J H;  4X62 Q;  4LF9 L;  2R6G A;  4A3G H;  2I5M X;  3CCS A;  2ZM6 L;  4OO1 G;  4JI8 Q;  2I5L X;  3CME A;  1PH5 A;  1N32 L;  4X66 Q;  2JB2 A;  1D8L A;  1CKN B;  4J15 A;  3W5O A;  4JI1 Q;  4Z7H A;  4ME3 A;  3G71 A;  3CCQ A;  4LF4 Q;  3M4P A;  3GTM H;  3TRZ A;  1UEB A;  2JE6 I;  1VQ4 A;  3KFU A;  2VNU D;  1G6P A;  3ERS X;  3PV0 A;  4IFD G;  1G51 A;  5HGQ A;  3PCO B;  5HGI A;  3IAM 1;  4A3D H;  1VQN A;  3NEN A;  4DR4 L;  4AYB G;  3GTP H;  1X9N A;  1CSP A;  3I4M H;  3M7N A;  1D7Q A;  5E7N A;  1PH8 A;  1XNQ Q;  4MNO A;  4MTN A;  4BXX G;  3J80 i;  2JA5 H;  4QL5 A;  4UP9 A;  4P72 A;  3BU2 A;  1E24 A;  2VQE Q;  2KCM A;  4A3I G;  1V9P A;  4QIW E;  4QJF A;  4LFA Q;  1OXX K;  3GTQ H;  1XMQ Q;  1PFS A;  4A3E G;  4NXM Q;  1X3G A;  1W2B A;  2B3G A;  2ATW A;  4R4T A;  4L5Q A;  3CXC A;  3G4S A;  2R93 H;  1JT8 A;  1Y1V G;  5AJ3 L;  3A74 A;  3UDX A;  1X3F A;  4JI1 L;  2IP6 A;  4DPG A;  4LF5 Q;  4LF8 Q;  2R92 G;  3HOW G;  4DV7 Q;  3T1Y L;  2K50 A;  4LF7 L;  2L15 A;  4IOC A;  4A3F G;  2JA6 G;  5M3F H;  4JYA L;  1QUQ B;  2A1A A;  5IYB H;  4GKJ Q;  1K8G A;  4DWL A;  1Y14 B;  3S1R H;  2Q2U A;  3J7Z C;  4DV7 L;  5LMN Q;  4LUZ A;  5JEA J;  2BA0 A;  4HJA A;  1WJJ A;  3HOU H;  1K3R A;  5C3E G;  4B3T Q;  5C0X G;  4HJ7 A;  1LTL A;  2Z6K A;  2IY5 B;  1IZ6 A;  1EWI A;  1OXU A;  4P73 A;  5IY0 A;  1XPR A;  3M3Y H;  4A3C G;  2NVY H;  1YNX A;  4R1J A;  3J80 c;  1L2F A;  4DV3 Q;  4A3L H;  4R4O A;  4YZC A;  2AWO A;  1IBK Q;  1HNZ L;  3OYY A;  4O0A A;  1KXL A;  2ID0 A;  5BR8 Q;  1Q1E A;  3S1M H;  4JOI A;  1SR3 A;  3RLO A;  1NE3 A;  5FJ8 H;  4LFA L;  4AS3 A;  4K0K Q;  2VQE L;  1Y1W H;  1VQA A;  2VZA A;  4A3C H;  4LF6 Q;  2XTR A;  2RHS B;  2WP8 J;  1X54 A;  2JJQ A;  1YI2 A;  2Z0S A;  3M4Q A;  1Z9F A;  4JI3 L;  4BA2 I;  2KKM A;  5C4X G;  4Y7N H;  2Q2T A;  2IT1 A;  4YY3 L;  3HOY G;  1PH1 A;  3DM3 A;  5HY6 A;  3I55 A;  1BVS A;  1EUJ A;  1E1T A;  1QZG A;  1JJ2 A;  5IE8 A;  2CKZ B;  5IYD H;  4YWK A;  1PA6 A;  1VQH A;  4DV5 Q;  4WJ3 M;  4GXT A;  1A62 A;  1K8A C;  3I2Z A;  1WCM G;  3CQZ H;  3NBH B;  2NVX H;  1SRU A;  5LMN L;  4ALP A;  4X6A H;  1PHJ A;  3VDY A;  5IYC H;  4DKA C;  1S72 A;  2LSS A;  1UE1 A;  1P16 A;  3CCJ A;  4NXM L;  1U0L A;  4JYA Q;  2K52 A;  1X56 A;  3CPW A;  2V6E A;  2B29 A;  1YJ9 A;  1L1O A;  3CP0 A;  2ZJR A;  3S14 H;  1OXT A;  1XPO A;  2D0P A;  1VQ6 A;  4OON A;  3F2C A;  4HIK A;  3LJ0 A;  3CCU A;  1FJG Q;  3M85 A;  3D31 A;  1Q86 C;  3J81 c;  1QVF A;  2GVA A;  1A63 A;  4OAU C;  1A8V A;  2EXD A;  1GD7 A;  2N8N A;  3NEM A;  4IJL A;  4B3S Q;  3GD7 A;  4Q9V A;  1N33 Q;  2F4V Q;  4JI7 Q;  3TQY A;  1VS0 A;  2RIO A;  1TWH H;  5JJI A;  4BBS H;  5GAG C;  3CD6 A;  1FL0 A;  2YU9 H;  2KBN A;  3E9H A;  1WOC A;  1OXV A;  1CSQ A;  4GNX A;  2NVT H;  3J7A 5;  5GRO A;  1SRO A;  4R4C A;  4OX9 L;  2IX0 A;  4DV6 L;  3K0X A;  3PUX A;  4X64 L;  1VCI A;  4A75 A;  4DR3 Q;  2E5L Q;  1S40 A;  4JV5 Q;  5H1S E;  3ULL A;  2L1L B;  2NVQ H;  2OQ0 A;  4X62 L;  4PZ6 A;  1I3Q H;  3NEL A;  2MJF B;  4R4I A;  1XMO Q;  4XTC S;  3RN5 A;  2Z6K C;  4A3J H;  1TXY A;  3J81 i;  2MO0 A;  5IT9 c;  2MFI A;  4O2D A;  3L2P A;  4DUY L;  1VQL A;  2R93 G;  2UU9 Q;  2XMX A;  4G76 A;  1QVC A;  5LMU L;  1N36 L;  1YEZ A;  2VY3 A;  4JI4 Q;  3G48 A;  3F8T A;  3EIV A;  1DGS A;  1ASY A;  1VQ9 A;  4GOP A;  5LMN W;  3A0J A;  4JI6 Q;  1M1K C;  1CKN A;  2JAE A;  3B6Y A;  3GTG H;  1E7Z A;  2WB1 G;  4JI0 Q;  4JI2 L;  4BY7 G;  2F66 B;  1TWA H;  4IFD J;  3CCL A;  1JE5 A;  4OAV B;  3CMA A;  2IHF A;  2UXB Q;  5JJK A;  3DA3 A;  3CC7 A;  3L0I A;  3KP9 A;  3FKI H;  1XNR L;  4DR2 Q;  4TQU S;  3S2D H;  4PZ8 A;  4YHH L;  4LFB Q;  1E1O A;  1PH2 A;  1O7I A;  4DV4 Q;  4JI7 L;  3HOV G;  1N34 L;  2RF4 A;  4JI5 Q;  4C3J H;  3VA9 A;  2BA1 A;  2JQO A;  1AE2 A;  1YVC A;  4GOP C;  4BBR H;  1IBL L;  4P71 A;  4NPS A;  2UUC Q;  2F6M B;  3S24 A;  4DV2 Q;  1RIP A;  2HHH Q;  3FKI G;  2JA8 H;  3HFZ B;  2N49 A;  2YTV A;  1YIT A;  3BJU A;  4DV1 Q;  2EQS A;  1WCM H;  1Q7Y C;  2XGT A;  1AE3 A;  2ASB A;  1E3P A;  4KLK A;  3PO3 G;  2UUA L;  4DR5 Q;  1BKB A;  2CFM A;  1VQ8 A;  1GM5 A;  1LYL A;  2KCT A;  4BY1 H;  1VQ7 A;  4BBR G;  2F52 A;  4LFC L;  2CAZ B;  4PL4 A;  1NMF A;  3E9I A;  2JK8 A;  4DV5 L;  2D0O A;  5FLM G;  3I56 A;  2AWN A;  5M5Y H;  4X65 Q;  5C44 G;  1KC8 C;  2E8G A;  2K75 A;  4A3B G;  1VQJ A;  1NJI C;  1HH2 P;  3RNU A;  1XTD A;  2PQA B;  3RR5 A;  4JG2 A;  4NB3 A;  1NTG A;  4AQY Q;  1IXR A;  1PH4 A;  4DV2 L;  2HHH L;  3K80 C;  3J81 j;  4DR4 Q;  4HJ5 A;  2A2C A;  1UE5 A;  3CF5 A;  3W1B A;  1CKO A;  4QY7 A;  2NN6 G;  4YCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...