3B55A

Crystal structure of the q81bn2_baccr protein from bacillus cereus. nesg target bcr135
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
408
structure length
408
Chain Sequence
PYNTNQIAKWLEAHAKPLKTTNPTASLNDLKPLKNMVGSASIVGLGEATHGAHEVFTMKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKGNPSQHLTPVFKTKEMLDLLDWIRQYNANPKHKSKVRVIGMDIQSVNENVYNNIIEYIKANNSKLLPRVEEKIKGLIPVTKDMNTFESLTKEEKEKYVLDAKTISALLEENKSYLNGKSKEFAWIKQNARIIEQFTTMLATPPDKPADFYLKHDIAMYENAKWTEEHLGKTIVWGHNGHVSKTNMLSFIYPKVAGQHLAEYYGKRYVSIGTSVYEGQYNVKNSDGEFGPYGTLKSDDPNSYNYIFGQVKKDQFFIDLRKANGVTKTWLNEQHPIFAGITTEGPDIPKTVDISLGKAFDILVQIQKVSPSQVHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Q81BN2_BACCR protein from Bacillus cereus.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Biosynthetic protein
molecule keywords Succinoglycan biosynthesis protein
total genus 143
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05139 Erythro_esteras Erythromycin esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.30 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Biosynthetic Protein domain 3b55A03
3.30.1870.10 Alpha Beta 2-Layer Sandwich EreA/ChaN-like, small alpha-beta sandwich EreA-like; domain 2 3b55A02
3.40.1660.10 Alpha Beta 3-Layer(aba) Sandwich EreA/ChaN-like fold EreA-like (biosynthetic domain) 3b55A01
3B55A 2RADA 2QGMA
chains in the Genus database with same CATH superfamily
3AJFA 1YO7A 3I9V1 4NV2A 4G75A 2FEFA 2F6MB 2FU2A 4G76A 2XTRA 3LJ0A 2A2CA 2P22B 4JCVE 4U6RA 1SJ8A 2XTQA 4O1PA 4YZCA 3DA3A 5HGIA 4YZ9A 2RIOA 2YFAA 3Q8DA 2RLDA 1TDPA 2YFBA 2ZRRA 2F66B 3IAM1 4Z7GA 2QZGA 4PL4A 3LJ2A 4I1TA 2CAZB 4AS2A 2MJFB 4PL3A 2KKMA 2JB1A 4HFVA 3KP9A 3IAS1 4Q9VA 3P23A 2QSBA 2K19A 4Z7HA 3VA9A 2ETDA 2JBWA 2JAEA 2IP6A 2L1LB 2BL8A 2XMXA 3SDJA 1U5KA 3LJ1A 2E8GA 2BL7A 2QGMA 2A2DA 2JB3A 1W3SA 4AS3A 4OAUC 3DA4A 3DO9A 3FNBA 1JQOA 4DWLA 4HEA1 5LNK1 3UITA 2GSCA 3JSBA 4NV5A 3FVVA 4O1OA 2V1CC 3L0IA 4GXTA 4PL5A 2HGKA 4YZDA 2JB2A 2FUG1 2V6EA 3B55A 4OAVB 2RADA 3FBVA 2ZW3A 3F4MA
chains in the Genus database with same CATH topology
3B55A 2RADA 2QGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B55 A;  2RAD A;  2QGM A; 
#chains in the Genus database with same CATH topology
 3AJF A;  1YO7 A;  3I9V 1;  4NV2 A;  4G75 A;  2FEF A;  2F6M B;  2FU2 A;  4G76 A;  2XTR A;  3LJ0 A;  2A2C A;  2P22 B;  4JCV E;  4U6R A;  1SJ8 A;  2XTQ A;  4O1P A;  4YZC A;  3DA3 A;  5HGI A;  4YZ9 A;  2RIO A;  2YFA A;  3Q8D A;  2RLD A;  1TDP A;  2YFB A;  2ZRR A;  2F66 B;  3IAM 1;  4Z7G A;  2QZG A;  4PL4 A;  3LJ2 A;  4I1T A;  2CAZ B;  4AS2 A;  2MJF B;  4PL3 A;  2KKM A;  2JB1 A;  4HFV A;  3KP9 A;  3IAS 1;  4Q9V A;  3P23 A;  2QSB A;  2K19 A;  4Z7H A;  3VA9 A;  2ETD A;  2JBW A;  2JAE A;  2IP6 A;  2L1L B;  2BL8 A;  2XMX A;  3SDJ A;  1U5K A;  3LJ1 A;  2E8G A;  2BL7 A;  2QGM A;  2A2D A;  2JB3 A;  1W3S A;  4AS3 A;  4OAU C;  3DA4 A;  3DO9 A;  3FNB A;  1JQO A;  4DWL A;  4HEA 1;  5LNK 1;  3UIT A;  2GSC A;  3JSB A;  4NV5 A;  3FVV A;  4O1O A;  2V1C C;  3L0I A;  4GXT A;  4PL5 A;  2HGK A;  4YZD A;  2JB2 A;  2FUG 1;  2V6E A;  3B55 A;  4OAV B;  2RAD A;  3FBV A;  2ZW3 A;  3F4M A; 
#chains in the Genus database with same CATH homology
 3B55 A;  2RAD A;  2QGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...