3B55A

Crystal structure of the q81bn2_baccr protein from bacillus cereus. nesg target bcr135
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
408
structure length
408
Chain Sequence
b'PYNTNQIAKWLEAHAKPLKTTNPTASLNDLKPLKNMVGSASIVGLGEATHGAHEVFTMKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKGNPSQHLTPVFKTKEMLDLLDWIRQYNANPKHKSKVRVIGMDIQSVNENVYNNIIEYIKANNSKLLPRVEEKIKGLIPVTKDMNTFESLTKEEKEKYVLDAKTISALLEENKSYLNGKSKEFAWIKQNARIIEQFTTMLATPPDKPADFYLKHDIAMYENAKWTEEHLGKTIVWGHNGHVSKTNMLSFIYPKVAGQHLAEYYGKRYVSIGTSVYEGQYNVKNSDGEFGPYGTLKSDDPNSYNYIFGQVKKDQFFIDLRKANGVTKTWLNEQHPIFAGITTEGPDIPKTVDISLGKAFDILVQIQKVSPSQVHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinoglycan biosynthesis protein
publication title Crystal structure of the Q81BN2_BACCR protein from Bacillus cereus.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Biosynthetic protein
total genus 143
structure length 408
sequence length 408
ec nomenclature
pdb deposition date 2007-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05139 Erythro_esteras Erythromycin esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.30 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Biosynthetic Protein domain 3b55A03
3.30.1870.10 Alpha Beta 2-Layer Sandwich EreA/ChaN-like, small alpha-beta sandwich EreA-like; domain 2 3b55A02
3.40.1660.10 Alpha Beta 3-Layer(aba) Sandwich EreA/ChaN-like fold EreA-like (biosynthetic domain) 3b55A01
3B55A 2RADA 2QGMA
chains in the Genus database with same CATH superfamily
4AS2A 3IAM1 5LNK1 4PL5A 4O1OA 2RADA 2ETDA 4HEA1 2L1LB 2F6MB 2K19A 4PL4A 3DO9A 2V6EA 3UITA 4G76A 3IAS1 4O1PA 2ZW3A 3FBVA 2HGKA 3P23A 3LJ2A 4Z7GA 4I1TA 4JCVE 2FU2A 2CAZB 4Q9VA 1TDPA 2XMXA 2A2CA 2IP6A 4GXTA 4AS3A 2JB3A 2RLDA 2V1CC 3I9V1 4YZCA 2QZGA 5HGIA 2JB2A 1U5KA 4PL3A 4HFVA 3DA4A 4G75A 1W3SA 3Q8DA 2ZRRA 4OAVB 2FUG1 3LJ1A 2P22B 1JQOA 3KP9A 2JB1A 1YO7A 2MJFB 2JAEA 3LJ0A 3FNBA 4OAUC 2XTRA 2XTQA 2BL8A 3SDJA 2KKMA 2RIOA 2JBWA 4Z7HA 4YZDA 2E8GA 4NV2A 2A2DA 2QGMA 2GSCA 3FVVA 3B55A 3DA3A 3VA9A 3F4MA 4YZ9A 2YFAA 2FEFA 4DWLA 4U6RA 4NV5A 2F66B 3L0IA 2YFBA 2QSBA 3JSBA 1SJ8A 2BL7A 3AJFA
chains in the Genus database with same CATH topology
3B55A 2RADA 2QGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B55 A;  2RAD A;  2QGM A; 
#chains in the Genus database with same CATH topology
 4AS2 A;  3IAM 1;  5LNK 1;  4PL5 A;  4O1O A;  2RAD A;  2ETD A;  4HEA 1;  2L1L B;  2F6M B;  2K19 A;  4PL4 A;  3DO9 A;  2V6E A;  3UIT A;  4G76 A;  3IAS 1;  4O1P A;  2ZW3 A;  3FBV A;  2HGK A;  3P23 A;  3LJ2 A;  4Z7G A;  4I1T A;  4JCV E;  2FU2 A;  2CAZ B;  4Q9V A;  1TDP A;  2XMX A;  2A2C A;  2IP6 A;  4GXT A;  4AS3 A;  2JB3 A;  2RLD A;  2V1C C;  3I9V 1;  4YZC A;  2QZG A;  5HGI A;  2JB2 A;  1U5K A;  4PL3 A;  4HFV A;  3DA4 A;  4G75 A;  1W3S A;  3Q8D A;  2ZRR A;  4OAV B;  2FUG 1;  3LJ1 A;  2P22 B;  1JQO A;  3KP9 A;  2JB1 A;  1YO7 A;  2MJF B;  2JAE A;  3LJ0 A;  3FNB A;  4OAU C;  2XTR A;  2XTQ A;  2BL8 A;  3SDJ A;  2KKM A;  2RIO A;  2JBW A;  4Z7H A;  4YZD A;  2E8G A;  4NV2 A;  2A2D A;  2QGM A;  2GSC A;  3FVV A;  3B55 A;  3DA3 A;  3VA9 A;  3F4M A;  4YZ9 A;  2YFA A;  2FEF A;  4DWL A;  4U6R A;  4NV5 A;  2F66 B;  3L0I A;  2YFB A;  2QSB A;  3JSB A;  1SJ8 A;  2BL7 A;  3AJF A; 
#chains in the Genus database with same CATH homology
 3B55 A;  2RAD A;  2QGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...