3KP9A

Structure of a bacterial homolog of vitamin k epoxide reductase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
259
Chain Sequence
b'QRHSRLILAILAGLGSLLTAYLTYTKLTEQPAAFCTGSDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VKORC1/thioredoxin domain protein
publication title Structure of a bacterial homologue of vitamin K epoxide reductase.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Blood coagulation,oxidoreductase
total genus 71
structure length 259
sequence length 264
ec nomenclature ec 1.1.4.2: Transferred entry: 1.17.4.5.
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3kp9A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kp9A02
1T3BA 5L71A 2YZUA 1O8WA 5A5KA 1RQMA 3EINA 2DJ1A 4CDOA 3O3TA 3JCML 2LS5A 2X8HA 6GSTA 4F9ZA 3D6IA 2ON5A 3IDVA 3ME8A 4I97A 5CRDA 1Y25A 2H0IA 5D9VA 1ERVA 2VO4A 1AW9A 2P5QA 3FR3A 3HY2A 4POKA 4GSNA 1K0BA 5IMDA 3D4TA 5D9TA 1EV4A 4TXOA 5ID2B 5IQYA 2OE3A 4ISDA 4TRXA 1QFNA 1AQVA 2RM5A 3DRNA 3GNJA 5B6NA 1BQ7A 2H70A 3V1WA 1XVQA 1PQNA 1O85A 1EP8A 1MD4A 4Q5QA 1YEPA 2L4QA 1THOA 5IOXA 1TRSA 2O7KA 3F4RA 3GFKA 1AUCA 1K0OA 4AJ7A 3C8EA 1A0FA 4WETA 5ECPB 5IMZA 1YF0A 3EMXA 4V2NA 5ELAA 5H5RA 4L8EA 2HSYA 1PMTA 1FW1A 2AHEA 1UC7A 3VWWA 3ERGA 3E3EA 3P7XA 4JR4A 1AQXA 1JZWA 4I2UA 1GUKA 1O81A 4KSMA 4N11A 4MJCA 2XPDA 4AGSA 1HNAA 3QPMA 3TRPA 1XBSA 1YQ1A 2QC7A 1AQWA 8GSSA 2G0FA 1N8JA 3RPNA 4IVFA 1T7PB 3RHBA 4GQCA 1F3BA 3TJBA 1GNEA 3OR5A 4D73A 4E8HA 3TKSE 2VAFA 5A4WA 3VWUA 3QMXA 4QL9A 4IW9A 3KEBA 1EZKA 1BEDA 1E2YA 4N10A 3UAPA 2WGRA 3GUSA 1J9BA 2VL3A 5IM9A 2H1DA 3MNGA 5IPHA 2MBTA 5H5QA 3CYNA 1TRUA 1DE2A 1T4YA 2DIZA 1GTIA 4ILFA 1U3AA 1YZXA 2IMIA 3ZFBA 2QGVA 1XWBA 2VCWA 1V57A 2TIRA 4YQUA 3NIVA 4ZXGA 2JSYA 1YY7A 4DEJA 17GSA 4PURA 1ON4A 2RLIA 1HYUA 1O7UA 3GV1A 3IOSA 4FIWA 4V1Ag 4IKHA 3VI5A 3N9JA 5ECOB 3F3QA 3UJ1A 4Q5RA 1SK2A 4JRRA 4GWRA 2DJJA 1GSQA 2FWFA 3W6GA 5ECHB 2GGTA 5CO3A 2DC5A 3DIEA 3IE3A 2HZEA 3GH9A 4MPFA 2YWIA 3IBHA 4GQFA 12GSA 1C72A 3DKSA 2C4JA 3VWXA 4EO3A 2AV4A 1KTEA 2O85A 2C3TA 4H86A 2IMKA 4RI7A 7GSSA 4EKZA 3TKQA 2H1AA 1M9AA 4OFTA 3IK9A 4ECIA 1A24A 2ZNMA 1XOBA 2I1UA 4P3YB 3WYWA 5GAPD 5J3RA 4X0XA 1CQGA 4IP1A 4K1FA 3HDCA 2WULA 3BD2A 3QAWA 3LEFA 3VURA 1KBNA 2P31A 4J57E 3RPPA 2P0GA 3CBUA 1T8EB 3ME7A 1EGOA 5H5SA 3I9V2 2YOIA 5B8BA 4IBPA 1HQOA 2R6KA 4MA9A 2B7KA 1GRXA 4KW6A 2B5XA 3CTFA 4POBA 1EEJA 3GA4A 3KM6A 4G9HA 3FRCA 1B4PA 5JCGA 1LBKA 1SK1A 3E9JB 6GSUA 3M1GA 3M0FA 4ML6A 5DALA 2IFQB 2DSAA 1OKTA 2PMTA 1PA3A 1FB0A 2FLSA 4HI7A 2C8UA 1SENA 3R2QA 1URMA 2PN8A 2GS3A 2I81A 3ZL5A 3U6VA 5CRHA 1TK5B 2F8FA 1ILOA 5ECIB 4LMVA 2C0DA 3IK7A 3UOMA 3AY8A 1DUGA 1YDKA 1EGRA 2AAWA 4F03A 2GSQA 3CRUA 3BJ5A 5F8BA 1ZZYA 4L5OA 2K8SA 1YF1A 1ZL9A 2FGXA 1ML6A 3WT2A 1R5PA 4CHSA 5EL8A 4MABA 4KH7A 2F3MA 2GSRA 4MF7A 3IA1A 2CQ9A 4J2FA 2KHPA 4ZILA 5FHIA 5HR3A 2K18A 4LL1B 2ALBA 4DSSA 4HQZA 3RBTA 3DYRA 3FZAA 2L5LA 3DGQA 1WRYA 1TI1A 3TOUA 2GZZA 2CAQA 2FY6A 4PQIA 3EURA 1K3OA 4KE3A 4BVYA 3HA9A 3UBKA 14GSA 4XS4A 4O32A 3ZVJD 3LXZA 2B3SA 2ON7A 3TRXA 1FB6A 2XBIA 2IN3A 1PRXA 1GLQA 5AISA 5C00A 5A4UA 2VD0A 1AXDA 3M8NA 2LNTA 5G30A 3TKSC 5J9BA 3DVWA 3IHQA 3QFBC 1F6MC 5LCZA 1XXUA 1OKDA 2F8AA 2C3NA 5KN3A 4EVMA 3FZ4A 1GULA 4OCEA 3C1RA 3WGDA 5J9CA 3M9KA 1TRVA 4MF6A 4WXTA 1SKSB 2H6XA 2IL3A 3CMIA 3GKMA 1JFUA 4F0CA 2V32A 4KNDA 5HQPA 1SD9A 1XCCA 1QMVA 2OACA 1Z7PA 1SK0A 1SJZA 4GLTA 1TDIA 2B7JA 4OO4A 4XCSA 2PVOC 1V40A 5DAKB 1JZOA 2MBSA 2LRCA 2D2ZA 5FT3A 4I6XA 4OO5A 5DQYA 5ID2A 4KX4A 5KN1A 2X99A 3GMFA 3KTBA 4V2MA 1X9MB 1OC3A 4NAXA 3ERFA 1OAZA 4POLA 2H71A 1DE1A 2H76A 2CA8A 2OE0A 2GLRA 1SKRB 3GH6A 1GUMA 3UEMA 3LGCA 5D73A 4F82A 3MWHA 3HVVA 4L0WA 1QUWA 5IIZA 5D93A 4LL4B 3IPZA 2JZRA 5DJLA 3K8NA 1TK8B 1TOFA 2VLUA 5ECMB 4OWYA 1SJ6A 2FWHA 4TKYA 2H66A 1ACVA 5EPFA 3TJFA 4PXOA 3CTGA 1E6BA 5HFGA 4YAVA 4RQXA 4KAEA 1WWJA 3LWAA 5IMVA 2VCVA 3H79A 5D96A 1O8XA 3Q19A 4FO5A 4J56E 4ECBA 3TB2A 3C7MA 2CZ2A 5DVBA 2GQLA 4DSRA 2CVBA 2OBKA 1NSWA 4KA0A 4K2DA 4G2EA 4MF5A 5CRGA 1WPIA 5AN1A 2GZYA 1QQ2A 4PUFC 3IRAA 3VI7A 2PBJA 2JZSA 5DCHA 1SD8A 19GSA 4ECCA 3UL3A 4MDCA 3P90A 3HVSA 2H19A 3H93A 3F4TA 2NTOA 1K0CA 4HJMA 1A2JA 3KIJA 2LRNA 3EWLA 3D4MA 1WIKA 2JL4A 1R4WA 3KXOA 3APQA 1FHEA 2CZ3A 1B9YC 1RK4A 2C80A 3ISOA 2GSTA 1OVNA 5G5EA 3HYPA 2VOCA 4K8MA 1PKWA 1QK8A 3ZREA 5GAND 2HFDA 4NV2A 3FYGA 2GQMA 2O8VB 3LQ7A 3GYKA 1BJXA 2N5FA 4MZWA 3BBYA 3TKSA 3L0HA 1KEBA 2PU9C 5IO2A 3FW2A 2F9SA 2IMEA 1ABAA 3GTUB 2LJRA 1A2MA 3RAZA 3A5WA 5CNWA 1GL8A 4JZQA 2GT5A 1G6YA 1M2AA 2PVQA 2ZCTA 1GSFA 3BOAA 2K9FA 3UMAA 2V2GA 4PX1A 5ECRB 1OC8A 2YWOA 3SBCA 3HJMA 4IQAA 3P8WA 4LMWA 3DVXA 3HD5A 1ERWA 1O73A 2VM2A 1K0NA 4BPYA 3F0IA 4V1Ap 1G7EA 6GSXA 1BX9A 1Z6NA 1XWGA 3BCIA 2VCZA 1ERTA 2AUVA 3I43A 5G1KA 1ZGNA 4JR6A 5F05A 1YEXA 2EIRA 1GNWA 1HD2A 2YPMA 2YNXA 3LG6A 4PQHA 3TUEA 2LQQA 1K0AA 3M3MA 6GSSA 3I69A 3EVIA 2IFQA 4BWSA 3L4NA 2H30A 4KDXA 2CVKA 3D0ZA 2H0GA 4EDZA 4X43A 1TU8A 2L4CA 2BJXA 5HR2A 5DQSA 3TGZA 3GN3A 1U88A 4WR4A 2NBSA 1K3LA 1A0RP 1OC9A 3KJYA 4XHMA 3N5OA 4BL7A 3FY7A 1PL2A 3J7Yk 3GSSA 2CX4A 6GSYA 4TXOB 4PUAA 2YWMA 1EEMA 3GIXA 3IR4A 1SU9A 3ZMKA 3HHVA 1SKWB 4MH3A 2K8VA 4TR3A 1F9MA 1QXHA 1OE8A 2M46A 3GL5A 3M9JA 3HJPA 4K7IA 1S3DA 2E2MA 1LJRA 2H1BA 4HZ4A 4TVEA 1B48A 2R5GA 1TW9A 2FD3A 5AIVA 2MYGA 4TR1B 4WEYA 3W8SA 3QAVA 9GSSA 1TJDA 3VLNA 3C1SA 3WGXA 1Z9HA 4K6XA 5ENUA 5F07A 4DSQA 4PNGA 5GZZB 4IGJA 1A23A 3RDWA 2GT6A 2EIOA 1UVZA 4WBRD 2KLXA 4YQVA 4KDUA 4NWYA 4QL7A 3Q18A 4JU5A 5D9XA 2IJYA 3H4KA 2PWJA 2VLVA 2VLTA 2B1LA 3GX8A 3CRTA 4K9ZA 2H6YA 1Z7RA 4OMVA 4MLYA 1G0TA 1GSDA 3HZ4A 2FA8A 5ECLB 2RIIA 1EWXA 1ST9A 1B4QA 2M80A 4MJEA 4GXZA 4EXJA 2CT6A 3KMOA 2TRCP 2LQOA 2GVPA 1AC1A 5D9WA 3UVHA 4I5QA 3E0UA 3I6AA 1YKAA 4AJ6A 4EDYA 1JZRA 1SL0B 2LJAA 3A2XA 2HRNA 3PH9A 1ZOFA 3QCPA 4BWQA 2YZHA 1I9DA 5DBQA 1SYXA 2H6ZA 5G1LA 4KCAA 4IELA 5DAKA 1Q4JA 3QFAC 4HU9A 4WR5A 4IQ1A 1BAYA 4F2IA 2YV7A 4FYCA 2ZUPA 3LYPA 4MZCA 3D21A 4ID0A 2KUCA 2EC4A 3IV4A 1A2LA 2CAIA 3NZNA 3MSZA 3CSJA 3KZQA 1GH2A 3CSIA 5J4UA 2DIYA 3ED3A 3IAM2 1GWCA 1FO5A 4K7OA 2MZCA 2XPEA 5CRWA 4E8EA 3QDNA 4MMMA 11GSA 3S9FA 5JCWA 1GLPA 3EU3A 4KDYA 5COHA 2WZ9A 2FWGA 2HZEB 2JZTA 1Z6MA 1M7TA 20GSA 2C0EA 2XHFA 5LD0A 2IWTA 3L9UA 4ML1A 2MMNA 2NPBA 2DJ2A 3O76A 2P5RA 3KP9A 1W89A 2TRXA 3TKPA 2V6OA 1B8XA 2YN1A 5DDLA 1PX6A 2HNLA 4EE0A 2VCXA 1SL1B 5KEJA 3F6FA 1DBYA 1V58A 4LLRA 4MJBA 3LJRA 1V98A 1PKZA 2R4VA 5AGYA 2X8GA 3F3RA 3L9VA 2WDUA 2E2GA 1ZYQB 2FCHA 1X9SB 4HUAA 4FH8A 3DMLA 1EP7A 4NHWA 3FEUA 4ZB6A 4FYBA 4ZL7A 1M9BA 2DLXA 4MP4A 1WJKA 4GF0A 1V2AA 5DALB 3DXBA 1F3AA 2N5BA 2H0HA 3DWVA 3TJJA 3PR8A 2PPTA 2JSZA 3LXTA 5KN2A 4JEDA 1WMJA 2CVDA 2FA4A 2DJ0A 1NHYA 3PINA 2QSIA 4XS6A 3VPTA 3DD3A 4HEA2 3TKRA 1GUHA 2DMMA 2VIMA 5KN0A 2O87A 4MPGA 1IYIA 4TN8A 5ECQB 3FKFA 3NOFA 2IIYA 3L9SA 3A2WA 4GTUA 4TR4A 5GSTA 4RQRA 1U87A 4FYUA 2HSHA 1W4VA 1X9WB 1PL1A 22GSA 4HQSA 1GSUA 2VCTA 3ZFLA 2HYXA 4DSSB 3ZIJA 2BMXA 5E59A 1J08A 1K0MA 5G2ZA 2VCQA 1M0UA 5IOWA 3MAKA 3GTUA 5HR0A 1TTZA 1USBA 1WOUA 1VF3A 2C0FA 4AJ8A 2WCIA 5DJMA 1XIYA 3EE2A 1Z3EA 3EC3A 3VWVA 5CREA 3L78A 5HR1A 4LA1A 1U3IA 2YJHA 3GSTA 4RUVA 2M72A 1TXXA 3F8UA 1XW6A 4GSSA 2OKAA 4ZBBA 2H74A 1FVKA 4O92A 4RI6A 3G7IA 1O6JA 2DJ3A 4OFMA 4XTSA 2GZPA 4HZ2A 4F0BA 4V2LA 2LV3A 4KUNA 4WBJA 4N0VA 1K3YA 3HXSA 2E0QA 3SWLA 3TCOA 2YP6A 3KTLA 2L6DA 4MK3A 5CP1A 3ZRDA 3LYKA 3BCKA 6GSVA 2X64A 3KGKA 2WS2A 2K6VA 3F4SA 4MH2A 3G7YA 2NDOA 2PUKC 4NMUA 4GCIA 4L0UA 5IMCA 3FHKA 4Z7XA 2C0GA 1TK0B 3ZTLA 4XRAA 2VL2C 3GX0A 1F2EA 3GURA 1MDKA 1TP9A 3MDKA 1BG5A 4ECJA 3D22A 3CXGA 1ZYEA 3LORA 1TKDB 4OD7A 4WKWA 1ZCPA 1MEKA 2IMDA 5ABRA 4X1UA 2X8CA 2LTKA 3VPQA 4HOJA 2GQKA 1XWCA 2WB9A 2I3YA 5GSSA 4QQ7A 4TR1A 5J41A 1RW1A 5HFKA 4WF5A 1X5DA 2YANA 5C04A 4IJ3A 2HLSA 2O89A 2RUEA 4OCFA 1NW2A 1FOVA 2KP2A 2OA7A 3QAGA 2LNSA 3TRQA 5B8AA 2DJKA 4IN0A 1TI3A 1X5CA 2MMOA 1LU4A 4KSOA 1H4OA 3FZ5A 2B6MA 4TXVA 4EL1A 3Q6OA 4WF4A 4MJAA 2H73A 1V9WA 1YKCA 3LFLA 3DEXA 4IP6A 1VF2A 2EIQA 1XVWA 1ZMAA 1PGTA 1Z5YE 1HNBA 1XOAA 3VFIA 3Q74A 3GKXA 4CW9A 4GRFA 1PN9A 3US3A 2R37A 2A2SA 4TOPA 3WT1A 1A8YA 4HDEA 1K0DA 1Y6EA 2I4AA 4G19A 3QD9A 5IO0A 2XC2A 3D5JA 2LKUA 3J7Yb 2R3XA 3F6DA 2GDRA 3UBLA 1Q98A 2J23A 4GSTA 4PQ1A 1A8LA 2OE1A 3F9UA 2G2QA 2PGTA 1F37A 2FUG2 4IJIA 2I9HA 4IHUA 1PSQA 5JWRB 2JADA 4PNFA 3ZIVA 2FWEA 3G9BA 4N30A 4NXIA 4ZIJA 1H75A 16GSA 1M2BA 2FHEA 2LUSA 1SYRA 5EY6A 1VGLA 5ELGA 2VD1A 4HU7A 4XS1A 4YAPA 2HE3A 3FK8A 2VM1A 1BYEA 3HVXA 2OBIA 4ZL9A 13GSA 5HFIA 2HZFA 3HKRA 3KH7A 4N0ZA 4PGTA 4EF0A 1WE0A 1KNGA 2H75A 18GSA 3GHAA 3TJKA 2RUFA 3WD6A 3QR6A 5CYYA 2B5YA 2JU5A 3KP8A 3EYTA 2LJKA 1MDIA 4BVXA 4G10A 2B5EA 4ZB9A 3UIWA 3A2VA 4O5RA 2VL9A 1M99A 3CSHA 2LRTA 2B1KA 4I2TA 1XW5A 2VL2A 3FZ9A 1MD3A 4TW5A 1GSSA 4KB3A 1UN2A 2L6CA 3ZZXA 3VK9A 5ECKB 3ZLPA 4D73B 5CAXA 2A2RA 4KCEA 1XWAA 2F51A 1AAZA 5IMAA 3TDGA 2DBCA 2HXKA 2Z9SA 1NHOA 1JLWA 5A4VA 4POMA 1XWKA 3W8JA 4TR0A 1MDJA 2IPAA 4ACSA 1T1VA 4MZBA 5IMFA 2PERA 3F63A 1HNCA 1R5AA 1S3CA 2J9HA 3IXRA 2CX3A 1CQHA 2CV4A 1JLVA 3FR6A 2V6KA 2IMFA 2AYTA 1OE7A 2AB6A 1R7HA 5JWOB 1X0RA 2H01A 1NM3A 1T4ZA 1OC9B 2E7PA 1G6WA 4ZBAA 4NPBA 5JCUA 5F06A 3P2AA 1SJIA 1GTAA 1EOHA 3ZMLA 2YV9A 4KGIA 2MMAA 1PX7A 1R26A 2BTOT 4NV5A 2YCDA 4K7NA 4Q5FA 5FWGA 3C73A 2GSSA 3ZVJA 3EU4A 2DMLA 5JWQB 2FNOA 1FG4A 2KP1A 1VRSD 2QKEA 2HRFA 1M2DA 2GTUA 4Q5NA 2A4VA 1J0FA 5F0GA 1QGVA 2AJQB 3HCZA 4O7HA 4ZBDA 4NHZA 2JACA 3C71A 3EMPA 1VF4A 3APSA 3IAS2 5G5FA 4K0GA 4YQMA 1DSBA 3H8QA 2YWNA 2OJLA 3H1NA 1B9XC 1GTUA 2L59A 5AIXA 1EV9A 1G7OA 1GSYA 4HJ2A 4YH2A 1FAAA 3O6TA 3GL3A 3U5RE 5E4WA 2RM6A 1OYJA 2WRTA 4JBBA 3UARA 4IS0A 3KD0A 5G31A 4ZL8A 3FR9A 3IC4A 1XW9A 2NVLA 3KMNA 4EUYA 2L5OA 1I5GA 4ULXA 4HS1A 1JHBA 3ERWA 3QOUA 10GSA 1UA5A 1AIUA 3PGTA 4AF2A 1MTCA 1WP0A 1U6TA 1IYHA 2MMZA 2VUPA 1GTBA 5ECNB 5DCGA 2L57A 5IPGA 1YJ6A 3TJGA 3KH9A 4I8BA 2WJUA 4BA7A 3GKNA 1PD21 1SL2B 4MCUA 2LEGA 5J5NA 1T00A 2H72A 3WGEA 2KOKA 4JE1A 5INYA 2HI7A 3TOTA 5LNKe 4EC0A 5B6MA 1ERUA 2H8LA 3KCMA 2N5AA 2ES7A 4XRDA 5B7CA 2LSTA 4ZB8A 4DVCA 2HT9A 1XFLA 5D8IA 3HJOA 4OFNA 5ECSA 5EVOA 1S3AA 3ZYWA 1VF1A 1TU7A 1FVJA 4XS4B 3HZ8A 4XIHA 1THXA 1X5EA 2XBQA 1TRWA 2V1MA 2R2JA 2OADA 2C1YA 1N2AA 3RHCA 1JZDA 3GKKA 3ZITA 1GSEA 1EOGA 3UVTA 2WFCA 2H1GA 2REMA 6GSWA 1XZOA 4L5LA 3GRXA 3APOA 1GP1A 2C3QA 3LSZA 1XPVA 3A3TA 2YJ7A 2V41A 3G7JA 4K0NA
chains in the Genus database with same CATH superfamily
1T3BA 5L71A 2YZUA 1O8WA 5A5KA 1RQMA 3EINA 4A5PA 2DJ1A 4CDOA 2DKIA 1ZYPA 3O3TA 3JCML 2LS5A 2X8HA 6GSTA 4F9ZA 3D6IA 4CY8A 2ON5A 3IDVA 3ME8A 4I97A 5CRDA 1Y25A 2H0IA 4BIKA 5D9VA 1ERVA 2VO4A 1AW9A 2P5QA 3FR3A 3HY2A 4POKA 3IAM1 4GSNA 1K0BA 5IMDA 3D4TA 5D9TA 1EV4A 4TXOA 5ID2B 5IQYA 2OE3A 4ISDA 4TRXA 1QFNA 1AQVA 2RM5A 3DRNA 3GNJA 5B6NA 1BQ7A 2H70A 3V1WA 1XVQA 1PQNA 1O85A 1EP8A 1MD4A 4Q5QA 1YEPA 2L4QA 1THOA 5IOXA 1TRSA 2O7KA 3F4RA 2V1CC 3GFKA 1AUCA 1K0OA 4AJ7A 3C8EA 1A0FA 4WETA 5ECPB 5IMZA 1YF0A 3EMXA 4V2NA 5ELAA 5H5RA 4OAVB 4L8EA 2HSYA 1PMTA 1FW1A 1ZYNA 2AHEA 1UC7A 3VWWA 3ERGA 3E3EA 3P7XA 4JR4A 1AQXA 1JZWA 4I2UA 4HFVA 1GUKA 1O81A 4KSMA 4N11A 4MJCA 2XPDA 4AGSA 1HNAA 3QPMA 3TRPA 1XBSA 1YQ1A 2QC7A 1AQWA 8GSSA 2G0FA 1N8JA 3RPNA 4IVFA 1T7PB 3RHBA 4GQCA 1F3BA 3TJBA 1GNEA 3OR5A 4D73A 4E8HA 3TKSE 2VAFA 4Z2TA 5A4WA 4G75A 3VWUA 3QMXA 4QL9A 4IW9A 3KEBA 1EZKA 1BEDA 1E2YA 4N10A 3UAPA 2WGRA 3GUSA 1J9BA 2VL3A 2RLDA 2HRKA 5IM9A 2H1DA 3MNGA 4HEA1 5IPHA 2MBTA 5H5QA 3CYNA 1TRUA 1DE2A 1T4YA 2CAZB 2DIZA 1GTIA 4ILFA 1U3AA 1YZXA 4Z7HA 2IMIA 3ZFBA 4YKGA 2QGVA 1XWBA 2VCWA 1V57A 2TIRA 4YQUA 3NIVA 4ZXGA 2JSYA 1YY7A 4DEJA 17GSA 4PURA 1ON4A 2RLIA 1HYUA 1O7UA 3GV1A 3IOSA 4FIWA 4V1Ag 4IKHA 3VI5A 3N9JA 5ECOB 3F3QA 3UJ1A 4Q5RA 1SK2A 4JRRA 4GWRA 2DJJA 4K5SA 1GSQA 2FWFA 3W6GA 3FMWA 5ECHB 2GGTA 5CO3A 2DC5A 3DIEA 3IE3A 2HZEA 3GH9A 4MPFA 2YWIA 3IBHA 4GQFA 12GSA 1C72A 3DKSA 2C4JA 3VWXA 4EO3A 2AV4A 4PL3A 4G76A 1KTEA 2E8GA 2O85A 2C3TA 3HVNA 4H86A 2IMKA 4RI7A 7GSSA 4EKZA 3TKQA 3LJ0A 2JAEA 2H1AA 1M9AA 4OFTA 3IK9A 4ECIA 1A24A 2ZNMA 1XOBA 2I1UA 4P3YB 3WYWA 5GAPD 5J3RA 4X0XA 1CQGA 4IP1A 4K1FA 4KF9A 3HDCA 2WULA 3BD2A 3QAWA 3LEFA 3VURA 1KBNA 2P31A 4J57E 3RPPA 2P0GA 3CBUA 1T8EB 3ME7A 1EGOA 5H5SA 3I9V2 2YOIA 5B8BA 4IBPA 1HQOA 2R6KA 4MA9A 2B7KA 1GRXA 4KW6A 2B5XA 3CTFA 4POBA 1EEJA 3GA4A 3KM6A 4G9HA 3DA4A 3FRCA 1B4PA 5JCGA 1LBKA 1SK1A 3E9JB 6GSUA 3M1GA 3M0FA 4ML6A 5DALA 2IFQB 2DSAA 1OKTA 2PMTA 2RIOA 1PA3A 1FB0A 2FLSA 4HI7A 2C8UA 1SENA 3R2QA 1URMA 2PN8A 2GS3A 2I81A 3ZL5A 4CY6A 3U6VA 5CRHA 1TK5B 2F8FA 1ILOA 5ECIB 4LMVA 2C0DA 3IK7A 3UOMA 3AY8A 3IHGA 1DUGA 1YDKA 4BL7B 1EGRA 2AAWA 4F03A 2GSQA 3CRUA 3BJ5A 5F8BA 3P23A 1ZZYA 4L5OA 2K8SA 1YF1A 1ZL9A 2FGXA 1ML6A 3WT2A 1R5PA 4CHSA 5EL8A 4MABA 4KH7A 2F3MA 2GSRA 4MF7A 3IA1A 2CQ9A 4J2FA 2KHPA 4AS3A 4ZILA 5FHIA 5HR3A 2K18A 4LL1B 2ALBA 1TDPA 4DSSA 4HQZA 3RBTA 3DYRA 3FZAA 2L5LA 3DGQA 3DO9A 1WRYA 1TI1A 3TOUA 2GZZA 2ETDA 2CAQA 2FY6A 4PQIA 3EURA 1K3OA 4KE3A 4G0LA 4BVYA 3HA9A 3UBKA 14GSA 4XS4A 4O32A 3ZVJD 3LXZA 2B3SA 2ON7A 3TRXA 4BVXB 1FB6A 2XBIA 2IN3A 1PRXA 1GLQA 5AISA 5C00A 3MIXA 5A4UA 2VD0A 1AXDA 3M8NA 2LNTA 5G30A 3TKSC 5J9BA 3DVWA 3IHQA 2FUG1 1F6MC 3QFBC 5LCZA 2XTRA 1XXUA 1OKDA 2F8AA 2C3NA 5KN3A 4EVMA 3FZ4A 1GULA 4OCEA 3C1RA 3WGDA 5J9CA 3M9KA 1TRVA 4MF6A 4WXTA 1SKSB 4PL5A 2H6XA 2IL3A 3CMIA 3GKMA 1JFUA 4F0CA 5KOWA 2V32A 3R3EA 4KNDA 5HQPA 1SD9A 1XCCA 1QMVA 2OACA 1Z7PA 1SK0A 1SJZA 4GLTA 1TDIA 2B7JA 4OO4A 4XCSA 2PVOC 1V40A 5DAKB 1JZOA 5HGIA 2MBSA 2LRCA 2D2ZA 5FT3A 4I6XA 4OO5A 5DQYA 5ID2A 4KX4A 5KN1A 2X99A 3GMFA 3KTBA 4V2MA 1X9MB 1OC3A 4NAXA 3ERFA 2BL7A 1OAZA 4POLA 2F66B 2H71A 1DE1A 2H76A 2CA8A 2OE0A 2GLRA 1SKRB 3GH6A 1GUMA 3UEMA 3LGCA 5D73A 4O1OA 4F82A 3MWHA 3HVVA 2IP6A 3IC8A 4L0WA 1QUWA 3JSBA 5IIZA 5D93A 4LL4B 3IPZA 2JZRA 5DJLA 3K8NA 1TK8B 1TOFA 2VLUA 5ECMB 4OWYA 1SJ6A 2FWHA 4TKYA 2H66A 1ACVA 2FU2A 5EPFA 3TJFA 4PXOA 3CTGA 1E6BA 5HFGA 4YAVA 4RQXA 4KAEA 1WWJA 3LWAA 5IMVA 2VCVA 3H79A 5D96A 4EIPA 1O8XA 3Q19A 4FO5A 2P22B 4J56E 4ECBA 3TB2A 3C7MA 2CZ2A 5DVBA 2GQLA 4DSRA 2CVBA 2OBKA 1NSWA 4KA0A 4K2DA 4G2EA 3MYDA 4MF5A 5CRGA 2GSCA 1WPIA 3Q8DA 5AN1A 2GZYA 1QQ2A 4PUFC 3IRAA 3VI7A 2PBJA 2JZSA 3A5IA 5DCHA 1SD8A 2FEFA 19GSA 4ECCA 3UL3A 4MDCA 3P90A 3HVSA 2H19A 3H93A 3F4TA 2NTOA 1K0CA 4HJMA 3FVVA 1A2JA 3KIJA 2LRNA 3EWLA 3D4MA 1WIKA 2JL4A 3KXOA 1R4WA 3APQA 1FHEA 2CZ3A 1B9YC 1RK4A 2C80A 3ISOA 2GSTA 4AS2A 1OVNA 4PTSA 5G5EA 3HYPA 2VOCA 4K8MA 1PKWA 1QK8A 3ZREA 5GAND 2F6MB 4O5UA 2HFDA 4NV2A 3FYGA 4G0IA 2GQMA 2O8VB 2R0CA 3LQ7A 3GYKA 1BJXA 2N5FA 4MZWA 2ZRRA 1PFOA 3BBYA 3TKSA 3L0HA 1KEBA 2PU9C 5IO2A 3FW2A 3B55A 2F9SA 2IMEA 1ABAA 3GTUB 2LJRA 2L1LB 1A2MA 3RAZA 4I1TA 3A5WA 5CNWA 1GL8A 4JZQA 2GT5A 1G6YA 2DKHA 3CQFA 1M2AA 2PVQA 2ZCTA 1GSFA 3BOAA 2K9FA 3UMAA 2V2GA 4PX1A 5ECRB 1OC8A 2YWOA 3SBCA 3HJMA 4IQAA 3P8WA 4LMWA 3DVXA 2XTQA 3HD5A 1ERWA 1O73A 2VM2A 1K0NA 4BPYA 3F0IA 4JCVE 4V1Ap 1G7EA 6GSXA 1BX9A 1Z6NA 1XWGA 3BCIA 2VCZA 1ERTA 2AUVA 3I43A 5G1KA 1ZGNA 4JR6A 2JBWA 1YEXA 2EIRA 5F05A 1GNWA 1HD2A 2YPMA 2YNXA 3LG6A 4PQHA 3TUEA 2LQQA 1K0AA 3M3MA 6GSSA 3I69A 3EVIA 2IFQA 4BWSA 3L4NA 2H30A 4KDXA 2CVKA 3D0ZA 2H0GA 4EDZA 4X43A 1TU8A 2L4CA 2BJXA 5HR2A 5DQSA 3TGZA 3GN3A 1U88A 4WR4A 2NBSA 1K3LA 1A0RP 1OC9A 3KJYA 4XHMA 3N5OA 4BL7A 3FY7A 1PL2A 3J7Yk 3GSSA 2CX4A 6GSYA 4TXOB 4PUAA 2YWMA 1EEMA 3GIXA 3IR4A 1SU9A 3ZMKA 3HHVA 1SKWB 4MH3A 2K8VA 4TR3A 2JB1A 1M3JA 1JQOA 1F9MA 1QXHA 1OE8A 2M46A 3GL5A 3M9JA 3HJPA 2A2CA 4K7IA 1S3DA 2E2MA 1LJRA 2H1BA 4HZ4A 4TVEA 1B48A 2R5GA 1TW9A 2FD3A 5AIVA 2X49A 2MYGA 4TR1B 4WEYA 3W8SA 3QAVA 9GSSA 1TJDA 3VLNA 3C1SA 3WGXA 2XMXA 1Z9HA 4K6XA 5ENUA 5F07A 4DSQA 4PNGA 5GZZB 4IGJA 1A23A 3RDWA 2GT6A 2EIOA 1UVZA 4WBRD 2KLXA 1FOHA 4YQVA 4KDUA 4NWYA 4QL7A 3Q18A 4JU5A 5D9XA 4Z7GA 2IJYA 3H4KA 2PWJA 2VLVA 2UZ8A 2VLTA 2B1LA 3GX8A 3CRTA 4K9ZA 2H6YA 1Z7RA 4OMVA 4MLYA 1G0TA 1GSDA 3HZ4A 2FA8A 5ECLB 2RIIA 1EWXA 1ST9A 1B4QA 2M80A 4MJEA 4GXZA 4EXJA 2CT6A 3KMOA 2TRCP 2LQOA 2GVPA 1AC1A 5D9WA 3UVHA 4I5QA 3E0UA 3I6AA 3FBVA 1YKAA 4AJ6A 4EDYA 1JZRA 1SL0B 2LJAA 3A2XA 2HRNA 3PH9A 1ZOFA 3QCPA 4BWQA 2YZHA 1I9DA 5DBQA 5KOXA 1SYXA 2H6ZA 5G1LA 4KCAA 4IELA 5DAKA 1Q4JA 3QFAC 4HU9A 4WR5A 4IQ1A 1BAYA 4FQUA 4F2IA 2YV7A 4FYCA 2ZUPA 3LYPA 4MZCA 3EPTA 3D21A 4ID0A 2KUCA 2EC4A 3IV4A 1A2LA 2CAIA 4K2XA 3NZNA 3MSZA 4HSCX 3CSJA 3KZQA 1GH2A 2K19A 3CSIA 5J4UA 2DIYA 3ED3A 3IAM2 1GWCA 1FO5A 4K7OA 2MZCA 2XPEA 5CRWA 4E8EA 3QDNA 4MMMA 11GSA 3S9FA 5JCWA 1GLPA 3EU3A 4KDYA 5COHA 2WZ9A 2FWGA 2HZEB 3DA3A 2A2PA 2JZTA 1Z6MA 1M7TA 20GSA 2C0EA 2XHFA 5LD0A 3L0IA 2IWTA 3L9UA 4ML1A 2MMNA 2NPBA 2DJ2A 3O76A 2P5RA 3KP9A 1W89A 2TRXA 3TKPA 2V6OA 4Z2RA 1B8XA 2YN1A 5DDLA 1PX6A 2HNLA 4EE0A 2VCXA 1SL1B 5KEJA 3F6FA 1DBYA 1V58A 1YO7A 4LLRA 4MJBA 3LJRA 1V98A 1PKZA 2R4VA 5AGYA 2X8GA 3F3RA 3L9VA 2WDUA 2E2GA 1ZYQB 2FCHA 4YZCA 1X9SB 4HUAA 4FH8A 3DMLA 1EP7A 4NHWA 3FEUA 4ZB6A 4FYBA 4ZL7A 1M9BA 2DLXA 4MP4A 1WJKA 4GF0A 4EIQA 1V2AA 5DALB 3DXBA 2HGKA 4O5QA 1F3AA 2N5BA 2H0HA 3DWVA 3TJJA 3PR8A 2R0PA 2PPTA 2JSZA 3LXTA 5KN2A 4JEDA 1WMJA 2CVDA 4DWLA 2FA4A 2DJ0A 1NHYA 3PINA 2QSIA 4XS6A 3VPTA 3DD3A 4HEA2 3TKRA 1GUHA 2DMMA 2VIMA 5KN0A 3LW9A 2O87A 4MPGA 1IYIA 4TN8A 5ECQB 3FKFA 3NOFA 2IIYA 3L9SA 3A2WA 4GTUA 4TR4A 5GSTA 4RQRA 1U87A 4FYUA 2BL8A 2HSHA 1W4VA 1X9WB 1PL1A 22GSA 4HQSA 1GSUA 2VCTA 3ZFLA 2HYXA 4YKFA 4DSSB 3ZIJA 2BMXA 5E59A 1J08A 1K0MA 5G2ZA 2VCQA 1M0UA 5IOWA 3MAKA 3GTUA 5HR0A 1TTZA 1USBA 1WOUA 1VF3A 2C0FA 4AJ8A 2WCIA 5DJMA 1XIYA 3EE2A 1Z3EA 4BVYB 3EC3A 3VWVA 5CREA 3L78A 5HR1A 4LA1A 1U3IA 2YJHA 3GSTA 4RUVA 2M72A 1TXXA 2X4AA 3F8UA 1XW6A 4GSSA 2OKAA 4ZBBA 2H74A 1FVKA 1PN0A 4O92A 4RI6A 3G7IA 1O6JA 2DJ3A 4OFMA 4XTSA 2GZPA 4HZ2A 4F0BA 4V2LA 2LV3A 4KUNA 4WBJA 4N0VA 4Z2UA 1K3YA 3HXSA 2E0QA 3SWLA 3TCOA 2YP6A 3KTLA 2L6DA 4MK3A 5CP1A 3ZRDA 3LYKA 3BCKA 6GSVA 2X64A 3KGKA 2WS2A 2K6VA 2QA1A 3F4SA 4MH2A 3G7YA 2NDOA 2PUKC 4NMUA 4GCIA 4L0UA 5IMCA 3FHKA 4Z7XA 2C0GA 1TK0B 1XG8A 3ZTLA 4XRAA 2VL2C 3GX0A 1F2EA 3GURA 1MDKA 1TP9A 3MDKA 1BG5A 4ECJA 3D22A 3CXGA 1ZYEA 3LORA 1TKDB 4OD7A 3LJ2A 2QGMA 4Q9VA 4WKWA 1ZCPA 1MEKA 2IMDA 5ABRA 4X1UA 2X8CA 2LTKA 3VPQA 3IAS1 4HOJA 2GQKA 1XWCA 2WB9A 4YZ9A 2I3YA 5GSSA 4QQ7A 4TR1A 5J41A 1RW1A 1W3SA 5HFKA 4WF5A 1X5DA 2YANA 5C04A 4IJ3A 2HLSA 2O89A 2RUEA 4OCFA 1NW2A 1FOVA 2KP2A 2OA7A 1U5KA 3QAGA 2LNSA 3TRQA 5B8AA 2DJKA 4IN0A 1TI3A 1X5CA 2MMOA 1LU4A 4KSOA 1H4OA 3FZ5A 2B6MA 4TXVA 4EL1A 3Q6OA 2HRAA 4WF4A 4MJAA 3AJFA 2H73A 4MNNA 1V9WA 1YKCA 3LFLA 3DEXA 4IP6A 1VF2A 2EIQA 1XVWA 1ZMAA 1PGTA 1Z5YE 1HNBA 1XOAA 3VFIA 3Q74A 3GKXA 3SDJA 4PL4A 4CW9A 4GRFA 1PN9A 3US3A 2R37A 3VA9A 2A2SA 4TOPA 3WT1A 1A8YA 2A2DA 4HDEA 1K0DA 1Y6EA 2I4AA 4G19A 4U6RA 3QD9A 5IO0A 2XC2A 4O1PA 3D5JA 2LKUA 3J7Yb 2R3XA 3F6DA 2GDRA 3UBLA 1Q98A 2J23A 4GSTA 4PQ1A 1A8LA 2QSBA 2OE1A 3F9UA 2G2QA 2PGTA 1F37A 2FUG2 4IJIA 2I9HA 4IHUA 1PSQA 5JWRB 2JADA 4PNFA 3ZIVA 2FWEA 3G9BA 4N30A 4NXIA 4G0KA 4ZIJA 2RADA 1H75A 16GSA 1M2BA 5BRTA 2FHEA 2LUSA 1SYRA 5EY6A 1VGLA 5ELGA 2VD1A 4HU7A 4XS1A 2V6EA 4YAPA 2HE3A 3FK8A 4USSA 2VM1A 4K5RA 1BYEA 3HVXA 2OBIA 4ZL9A 13GSA 5HFIA 2HZFA 3HKRA 3KH7A 4N0ZA 4PGTA 4EF0A 1WE0A 1KNGA 2H75A 18GSA 1M3IA 3GHAA 3TJKA 2RUFA 3WD6A 3QR6A 5CYYA 2B5YA 2JU5A 3KP8A 3EYTA 2LJKA 1MDIA 4BVXA 4G10A 2B5EA 4ZB9A 3UIWA 3A2VA 2R0GA 4O5RA 2VL9A 1M99A 3CSHA 2LRTA 2B1KA 4I2TA 1XW5A 2VL2A 3FZ9A 1MD3A 4TW5A 4GXTA 1GSSA 4KB3A 1UN2A 2L6CA 3ZZXA 3VK9A 5ECKB 3ZLPA 4D73B 5CAXA 2A2RA 4KCEA 1XWAA 2F51A 2JB2A 1AAZA 5IMAA 3TDGA 2DBCA 2HXKA 2Z9SA 1NHOA 1JLWA 5A4VA 4POMA 1XWKA 3W8JA 1MDJA 2IPAA 4TR0A 4ACSA 1T1VA 2A4HA 4MZBA 5IMFA 2PERA 3F63A 1HNCA 1R5AA 1S3CA 2J9HA 3IXRA 2CX3A 1CQHA 2CV4A 5BMUA 1JLVA 3FR6A 2V6KA 2IMFA 3PPUA 2AYTA 1OE7A 2AB6A 1R7HA 5JWOB 1X0RA 2H01A 1NM3A 4YZDA 1T4ZA 1OC9B 2E7PA 1G6WA 4ZBAA 4NPBA 5JCUA 5F06A 3P2AA 1SJIA 1GTAA 1EOHA 3ZMLA 2YV9A 4KGIA 2MMAA 1PX7A 1R26A 2BTOT 4NV5A 2YCDA 4K7NA 4X4JA 4Q5FA 5FWGA 4OAUC 3C73A 2GSSA 3ZVJA 3F4MA 3EU4A 2DMLA 5JWQB 2FNOA 1FG4A 2KP1A 1VRSD 2QKEA 2HRFA 1M2DA 2GTUA 5LNK1 4Q5NA 2A4VA 2KKMA 1J0FA 2ZW3A 5F0GA 1QGVA 2AJQB 3HCZA 4O7HA 4ZBDA 4NHZA 2JACA 3C71A 3EMPA 3FNBA 1VF4A 3APSA 3IAS2 1SJ8A 5G5FA 4K0GA 4YQMA 1S3RA 1DSBA 3H8QA 2YFBA 2YWNA 2OJLA 3H1NA 1B9XC 1GTUA 2L59A 5AIXA 1EV9A 1G7OA 1GSYA 4HJ2A 4YH2A 1FAAA 3O6TA 2QZGA 3GL3A 3U5RE 5E4WA 2RM6A 1OYJA 2QA2A 2WRTA 4JBBA 3UARA 4IS0A 3KD0A 5G31A 4ZL8A 3FR9A 3IC4A 1XW9A 2NVLA 3KMNA 4EUYA 2L5OA 1I5GA 4ULXA 4HS1A 1JHBA 3ERWA 3QOUA 10GSA 1UA5A 1AIUA 3PGTA 4AF2A 1MTCA 1WP0A 1U6TA 1IYHA 2MMZA 2VUPA 1GTBA 5ECNB 5DCGA 2L57A 5IPGA 1YJ6A 3TJGA 3KH9A 4I8BA 2WJUA 4BA7A 3GKNA 1PD21 1SL2B 4MCUA 2YFAA 2LEGA 5J5NA 1T00A 2H72A 3WGEA 2KOKA 3LJ1A 4JE1A 5INYA 2HI7A 3TOTA 5LNKe 4EC0A 5B6MA 1ERUA 2H8LA 3KCMA 2N5AA 2ES7A 4XRDA 5B7CA 2LSTA 4ZB8A 4DVCA 2HT9A 1XFLA 2MJFB 5D8IA 3HJOA 4OFNA 5ECSA 5EVOA 3I9V1 1S3AA 3ZYWA 1VF1A 1TU7A 1FVJA 4XS4B 3UITA 2JB3A 3HZ8A 4XIHA 1THXA 1X5EA 2XBQA 1TRWA 2V1MA 2R2JA 2OADA 2C1YA 1N2AA 3RHCA 1JZDA 3GKKA 3ZITA 1GSEA 1EOGA 3UVTA 2WFCA 2H1GA 2REMA 6GSWA 1XZOA 4L5LA 3GRXA 3APOA 4ICYA 1GP1A 2C3QA 3LSZA 1XPVA 3A3TA 2YJ7A 2V41A 3G7JA 4K0NA 2HSMA
chains in the Genus database with same CATH topology
1T3BA 5L71A 2YZUA 1O8WA 5A5KA 1RQMA 3EINA 4A5PA 2DJ1A 4CDOA 2DKIA 1ZYPA 3O3TA 3JCML 2LS5A 2X8HA 6GSTA 4F9ZA 3D6IA 4CY8A 2ON5A 3IDVA 3ME8A 4I97A 5CRDA 1Y25A 2H0IA 5D9VA 1ERVA 2VO4A 1AW9A 2P5QA 3FR3A 3HY2A 4POKA 3IAM1 4GSNA 1K0BA 5IMDA 3D4TA 5D9TA 1EV4A 4TXOA 5ID2B 5IQYA 2OE3A 4ISDA 4TRXA 1QFNA 1AQVA 2RM5A 3DRNA 3GNJA 5B6NA 1BQ7A 2H70A 3V1WA 1XVQA 1PQNA 1O85A 1EP8A 1MD4A 4Q5QA 1YEPA 2L4QA 1THOA 5IOXA 1TRSA 2O7KA 3F4RA 2V1CC 3GFKA 1AUCA 1K0OA 4AJ7A 3C8EA 1A0FA 4WETA 5ECPB 5IMZA 1YF0A 3EMXA 4V2NA 5ELAA 5H5RA 4OAVB 4L8EA 2HSYA 1PMTA 1FW1A 1ZYNA 2AHEA 1UC7A 3VWWA 3ERGA 3E3EA 3P7XA 4JR4A 1AQXA 1JZWA 4I2UA 4HFVA 1GUKA 1O81A 4KSMA 4N11A 4MJCA 2XPDA 4AGSA 1HNAA 3QPMA 3TRPA 1XBSA 1YQ1A 2QC7A 1AQWA 8GSSA 2G0FA 1N8JA 3RPNA 4IVFA 1T7PB 3RHBA 4GQCA 1F3BA 3TJBA 1GNEA 3OR5A 4D73A 4E8HA 3TKSE 2VAFA 4Z2TA 5A4WA 4G75A 3VWUA 3QMXA 4QL9A 4IW9A 3KEBA 1EZKA 1BEDA 1E2YA 4N10A 3UAPA 2WGRA 3GUSA 1J9BA 2VL3A 2HRKA 5IM9A 2H1DA 3MNGA 4HEA1 5IPHA 2MBTA 5H5QA 3CYNA 1TRUA 1DE2A 1T4YA 2CAZB 2DIZA 1GTIA 4ILFA 1U3AA 1YZXA 4Z7HA 2IMIA 3ZFBA 4YKGA 2QGVA 1XWBA 2VCWA 1V57A 2TIRA 4YQUA 3NIVA 4ZXGA 2JSYA 1YY7A 4DEJA 17GSA 4PURA 1ON4A 2RLIA 1HYUA 1O7UA 3GV1A 3IOSA 4FIWA 4V1Ag 4IKHA 3VI5A 3N9JA 5ECOB 3F3QA 3UJ1A 4Q5RA 1SK2A 4JRRA 4GWRA 2DJJA 4K5SA 1GSQA 2FWFA 3W6GA 3FMWA 5ECHB 2GGTA 5CO3A 2DC5A 3DIEA 3IE3A 2HZEA 3GH9A 4MPFA 2YWIA 3IBHA 4GQFA 12GSA 1C72A 3DKSA 2C4JA 3VWXA 4EO3A 2AV4A 4PL3A 4G76A 1KTEA 2E8GA 2O85A 2C3TA 4H86A 2IMKA 4RI7A 7GSSA 4EKZA 3TKQA 3LJ0A 2JAEA 2H1AA 1M9AA 4OFTA 3IK9A 4ECIA 1A24A 2ZNMA 1XOBA 2I1UA 4P3YB 3WYWA 5GAPD 5J3RA 4X0XA 1CQGA 4IP1A 4K1FA 4KF9A 3HDCA 2WULA 3BD2A 3QAWA 3LEFA 3VURA 1KBNA 2P31A 4J57E 3RPPA 2P0GA 3CBUA 1T8EB 3ME7A 1EGOA 5H5SA 3I9V2 2YOIA 5B8BA 4IBPA 1HQOA 2R6KA 4MA9A 2B7KA 1GRXA 4KW6A 2B5XA 3CTFA 4POBA 1EEJA 3GA4A 3KM6A 4G9HA 3DA4A 3FRCA 1B4PA 5JCGA 1LBKA 1SK1A 3E9JB 6GSUA 3M1GA 3M0FA 4ML6A 5DALA 2IFQB 2DSAA 1OKTA 2PMTA 2RIOA 1PA3A 1FB0A 2FLSA 4HI7A 2C8UA 1SENA 3R2QA 1URMA 2PN8A 2GS3A 2I81A 3ZL5A 4CY6A 3U6VA 5CRHA 1TK5B 2F8FA 1ILOA 5ECIB 4LMVA 2C0DA 3IK7A 3UOMA 3AY8A 3IHGA 1DUGA 1YDKA 4BL7B 1EGRA 2AAWA 4F03A 2GSQA 3CRUA 3BJ5A 5F8BA 3P23A 1ZZYA 4L5OA 2K8SA 1YF1A 1ZL9A 2FGXA 1ML6A 3WT2A 1R5PA 4CHSA 5EL8A 4MABA 4KH7A 2F3MA 2GSRA 4MF7A 3IA1A 2CQ9A 4J2FA 2KHPA 4AS3A 4ZILA 5FHIA 5HR3A 2K18A 4LL1B 2ALBA 4DSSA 4HQZA 3RBTA 3DYRA 3FZAA 2L5LA 3DGQA 3DO9A 1WRYA 1TI1A 3TOUA 2GZZA 2CAQA 2FY6A 4PQIA 3EURA 1K3OA 4KE3A 4G0LA 4BVYA 3HA9A 3UBKA 14GSA 4XS4A 4O32A 3ZVJD 3LXZA 2B3SA 2ON7A 3TRXA 4BVXB 1FB6A 2XBIA 2IN3A 1PRXA 1GLQA 5AISA 5C00A 3MIXA 5A4UA 2VD0A 1AXDA 3M8NA 2LNTA 5G30A 3TKSC 5J9BA 3DVWA 3IHQA 2FUG1 1F6MC 3QFBC 5LCZA 2XTRA 1XXUA 1OKDA 2F8AA 2C3NA 5KN3A 4EVMA 3FZ4A 1GULA 4OCEA 3C1RA 3WGDA 5J9CA 3M9KA 1TRVA 4MF6A 4WXTA 1SKSB 4PL5A 2H6XA 2IL3A 3CMIA 3GKMA 1JFUA 4F0CA 5KOWA 2V32A 3R3EA 4KNDA 5HQPA 1SD9A 1XCCA 1QMVA 2OACA 1Z7PA 1SK0A 1SJZA 4GLTA 1TDIA 2B7JA 4OO4A 4XCSA 2PVOC 1V40A 5DAKB 1JZOA 5HGIA 2MBSA 2LRCA 2D2ZA 5FT3A 4I6XA 4OO5A 5DQYA 5ID2A 4KX4A 5KN1A 2X99A 3GMFA 3KTBA 4V2MA 1X9MB 1OC3A 4NAXA 3ERFA 1OAZA 4POLA 2F66B 2H71A 1DE1A 2H76A 2CA8A 2OE0A 2GLRA 1SKRB 3GH6A 1GUMA 3UEMA 3LGCA 5D73A 4O1OA 4F82A 3MWHA 3HVVA 2IP6A 3IC8A 4L0WA 1QUWA 3JSBA 5IIZA 5D93A 4LL4B 3IPZA 2JZRA 5DJLA 3K8NA 1TK8B 1TOFA 2VLUA 5ECMB 4OWYA 1SJ6A 2FWHA 4TKYA 2H66A 1ACVA 5EPFA 3TJFA 4PXOA 3CTGA 1E6BA 5HFGA 4YAVA 4RQXA 4KAEA 1WWJA 3LWAA 5IMVA 2VCVA 3H79A 5D96A 4EIPA 1O8XA 3Q19A 4FO5A 2P22B 4J56E 4ECBA 3TB2A 3C7MA 2CZ2A 5DVBA 2GQLA 4DSRA 2CVBA 2OBKA 1NSWA 4KA0A 4K2DA 4G2EA 3MYDA 4MF5A 5CRGA 1WPIA 3Q8DA 5AN1A 2GZYA 1QQ2A 4PUFC 3IRAA 3VI7A 2PBJA 2JZSA 3A5IA 5DCHA 1SD8A 19GSA 4ECCA 3UL3A 4MDCA 3P90A 3HVSA 2H19A 3H93A 3F4TA 2NTOA 1K0CA 4HJMA 1A2JA 3KIJA 2LRNA 3EWLA 3D4MA 1WIKA 2JL4A 3KXOA 1R4WA 3APQA 1FHEA 2CZ3A 1B9YC 1RK4A 2C80A 3ISOA 2GSTA 4AS2A 1OVNA 4PTSA 5G5EA 3HYPA 2VOCA 4K8MA 1PKWA 1QK8A 3ZREA 5GAND 2F6MB 4O5UA 2HFDA 4NV2A 3FYGA 4G0IA 2GQMA 2O8VB 2R0CA 3LQ7A 3GYKA 1BJXA 2N5FA 4MZWA 2ZRRA 3BBYA 3TKSA 3L0HA 1KEBA 2PU9C 5IO2A 3FW2A 2F9SA 2IMEA 1ABAA 3GTUB 2LJRA 2L1LB 1A2MA 3RAZA 4I1TA 3A5WA 5CNWA 1GL8A 4JZQA 2GT5A 1G6YA 2DKHA 1M2AA 2PVQA 2ZCTA 1GSFA 3BOAA 2K9FA 3UMAA 2V2GA 4PX1A 5ECRB 1OC8A 2YWOA 3SBCA 3HJMA 4IQAA 3P8WA 4LMWA 3DVXA 2XTQA 3HD5A 1ERWA 1O73A 2VM2A 1K0NA 4BPYA 3F0IA 4JCVE 4V1Ap 1G7EA 6GSXA 1BX9A 1Z6NA 1XWGA 3BCIA 2VCZA 1ERTA 2AUVA 3I43A 5G1KA 1ZGNA 4JR6A 1YEXA 2EIRA 5F05A 1GNWA 1HD2A 2YPMA 2YNXA 3LG6A 4PQHA 3TUEA 2LQQA 1K0AA 3M3MA 6GSSA 3I69A 3EVIA 2IFQA 4BWSA 3L4NA 2H30A 4KDXA 2CVKA 3D0ZA 2H0GA 4EDZA 4X43A 1TU8A 2L4CA 2BJXA 5HR2A 5DQSA 3TGZA 3GN3A 1U88A 4WR4A 2NBSA 1K3LA 1A0RP 1OC9A 3KJYA 4XHMA 3N5OA 4BL7A 3FY7A 1PL2A 3J7Yk 3GSSA 2CX4A 6GSYA 4TXOB 4PUAA 2YWMA 1EEMA 3GIXA 3IR4A 1SU9A 3ZMKA 3HHVA 1SKWB 4MH3A 2K8VA 4TR3A 2JB1A 1F9MA 1QXHA 1OE8A 2M46A 3GL5A 3M9JA 3HJPA 2A2CA 4K7IA 1S3DA 2E2MA 1LJRA 2H1BA 4HZ4A 4TVEA 1B48A 2R5GA 1TW9A 2FD3A 5AIVA 2X49A 2MYGA 4TR1B 4WEYA 3W8SA 3QAVA 9GSSA 1TJDA 3VLNA 3C1SA 3WGXA 2XMXA 1Z9HA 4K6XA 5ENUA 5F07A 4DSQA 4PNGA 5GZZB 4IGJA 1A23A 3RDWA 2GT6A 2EIOA 1UVZA 4WBRD 2KLXA 1FOHA 4YQVA 4KDUA 4NWYA 4QL7A 3Q18A 4JU5A 5D9XA 4Z7GA 2IJYA 3H4KA 2PWJA 2VLVA 2UZ8A 2VLTA 2B1LA 3GX8A 3CRTA 4K9ZA 2H6YA 1Z7RA 4OMVA 4MLYA 1G0TA 1GSDA 3HZ4A 2FA8A 5ECLB 2RIIA 1EWXA 1ST9A 1B4QA 2M80A 4MJEA 4GXZA 4EXJA 2CT6A 3KMOA 2TRCP 2LQOA 2GVPA 1AC1A 5D9WA 3UVHA 4I5QA 3E0UA 3I6AA 3FBVA 1YKAA 4AJ6A 4EDYA 1JZRA 1SL0B 2LJAA 3A2XA 2HRNA 3PH9A 1ZOFA 3QCPA 4BWQA 2YZHA 1I9DA 5DBQA 5KOXA 1SYXA 2H6ZA 5G1LA 4KCAA 4IELA 5DAKA 1Q4JA 3QFAC 4HU9A 4WR5A 4IQ1A 1BAYA 4FQUA 4F2IA 2YV7A 4FYCA 2ZUPA 3LYPA 4MZCA 3EPTA 3D21A 4ID0A 2KUCA 2EC4A 3IV4A 1A2LA 2CAIA 4K2XA 3NZNA 3MSZA 3CSJA 3KZQA 1GH2A 2K19A 3CSIA 5J4UA 2DIYA 3ED3A 3IAM2 1GWCA 1FO5A 4K7OA 2MZCA 2XPEA 5CRWA 4E8EA 3QDNA 4MMMA 11GSA 3S9FA 5JCWA 1GLPA 3EU3A 4KDYA 5COHA 2WZ9A 2FWGA 2HZEB 3DA3A 2A2PA 2JZTA 1Z6MA 1M7TA 20GSA 2C0EA 2XHFA 5LD0A 3L0IA 2IWTA 3L9UA 4ML1A 2MMNA 2NPBA 2DJ2A 3O76A 2P5RA 3KP9A 1W89A 2TRXA 3TKPA 2V6OA 4Z2RA 1B8XA 2YN1A 5DDLA 1PX6A 2HNLA 4EE0A 2VCXA 1SL1B 5KEJA 3F6FA 1DBYA 1V58A 1YO7A 4LLRA 4MJBA 3LJRA 1V98A 1PKZA 2R4VA 5AGYA 2X8GA 3F3RA 3L9VA 2WDUA 2E2GA 1ZYQB 2FCHA 4YZCA 1X9SB 4HUAA 4FH8A 3DMLA 1EP7A 4NHWA 3FEUA 4ZB6A 4FYBA 4ZL7A 1M9BA 2DLXA 4MP4A 1WJKA 4GF0A 4EIQA 1V2AA 5DALB 3DXBA 4O5QA 1F3AA 2N5BA 2H0HA 3DWVA 3TJJA 3PR8A 2R0PA 2PPTA 2JSZA 3LXTA 5KN2A 4JEDA 1WMJA 2CVDA 4DWLA 2FA4A 2DJ0A 1NHYA 3PINA 2QSIA 4XS6A 3VPTA 3DD3A 4HEA2 3TKRA 1GUHA 2DMMA 2VIMA 5KN0A 3LW9A 2O87A 4MPGA 1IYIA 4TN8A 5ECQB 3FKFA 3NOFA 2IIYA 3L9SA 3A2WA 4GTUA 4TR4A 5GSTA 4RQRA 1U87A 4FYUA 2HSHA 1W4VA 1X9WB 1PL1A 22GSA 4HQSA 1GSUA 2VCTA 3ZFLA 2HYXA 4YKFA 4DSSB 3ZIJA 2BMXA 5E59A 1J08A 1K0MA 5G2ZA 2VCQA 1M0UA 5IOWA 3MAKA 3GTUA 5HR0A 1TTZA 1USBA 1WOUA 1VF3A 2C0FA 4AJ8A 2WCIA 5DJMA 1XIYA 3EE2A 1Z3EA 4BVYB 3EC3A 3VWVA 5CREA 3L78A 5HR1A 4LA1A 1U3IA 2YJHA 3GSTA 4RUVA 2M72A 1TXXA 2X4AA 3F8UA 1XW6A 4GSSA 2OKAA 4ZBBA 2H74A 1FVKA 1PN0A 4O92A 4RI6A 3G7IA 1O6JA 2DJ3A 4OFMA 4XTSA 2GZPA 4HZ2A 4F0BA 4V2LA 2LV3A 4KUNA 4WBJA 4N0VA 4Z2UA 1K3YA 3HXSA 2E0QA 3SWLA 3TCOA 2YP6A 3KTLA 2L6DA 4MK3A 5CP1A 3ZRDA 3LYKA 3BCKA 6GSVA 2X64A 3KGKA 2WS2A 2K6VA 2QA1A 3F4SA 4MH2A 3G7YA 2NDOA 2PUKC 4NMUA 4GCIA 4L0UA 5IMCA 3FHKA 4Z7XA 2C0GA 1TK0B 3ZTLA 4XRAA 2VL2C 3GX0A 1F2EA 3GURA 1MDKA 1TP9A 3MDKA 1BG5A 4ECJA 3D22A 3CXGA 1ZYEA 3LORA 1TKDB 4OD7A 3LJ2A 4Q9VA 4WKWA 1ZCPA 1MEKA 2IMDA 5ABRA 4X1UA 2X8CA 2LTKA 3VPQA 3IAS1 4HOJA 2GQKA 1XWCA 2WB9A 4YZ9A 2I3YA 5GSSA 4QQ7A 4TR1A 5J41A 1RW1A 1W3SA 5HFKA 4WF5A 1X5DA 2YANA 5C04A 4IJ3A 2HLSA 2O89A 2RUEA 4OCFA 1NW2A 1FOVA 2KP2A 2OA7A 1U5KA 3QAGA 2LNSA 3TRQA 5B8AA 2DJKA 4IN0A 1TI3A 1X5CA 2MMOA 1LU4A 4KSOA 1H4OA 3FZ5A 2B6MA 4TXVA 4EL1A 3Q6OA 2HRAA 4WF4A 4MJAA 3AJFA 2H73A 4MNNA 1V9WA 1YKCA 3LFLA 3DEXA 4IP6A 1VF2A 2EIQA 1XVWA 1ZMAA 1PGTA 1Z5YE 1HNBA 1XOAA 3VFIA 3Q74A 3GKXA 3SDJA 4PL4A 4CW9A 4GRFA 1PN9A 3US3A 2R37A 3VA9A 2A2SA 4TOPA 3WT1A 1A8YA 2A2DA 4HDEA 1K0DA 1Y6EA 2I4AA 4G19A 4U6RA 3QD9A 5IO0A 2XC2A 4O1PA 3D5JA 2LKUA 3J7Yb 2R3XA 3F6DA 2GDRA 3UBLA 1Q98A 2J23A 4GSTA 4PQ1A 1A8LA 2OE1A 3F9UA 2G2QA 2PGTA 1F37A 2FUG2 4IJIA 2I9HA 4IHUA 1PSQA 5JWRB 2JADA 4PNFA 3ZIVA 2FWEA 3G9BA 4N30A 4NXIA 4G0KA 4ZIJA 1H75A 16GSA 1M2BA 5BRTA 2FHEA 2LUSA 1SYRA 5EY6A 1VGLA 5ELGA 2VD1A 4HU7A 4XS1A 2V6EA 4YAPA 2HE3A 3FK8A 4USSA 2VM1A 4K5RA 1BYEA 3HVXA 2OBIA 4ZL9A 13GSA 5HFIA 2HZFA 3HKRA 3KH7A 4N0ZA 4PGTA 4EF0A 1WE0A 1KNGA 2H75A 18GSA 3GHAA 3TJKA 2RUFA 3WD6A 3QR6A 5CYYA 2B5YA 2JU5A 3KP8A 3EYTA 2LJKA 1MDIA 4BVXA 4G10A 2B5EA 4ZB9A 3UIWA 3A2VA 2R0GA 4O5RA 2VL9A 1M99A 3CSHA 2LRTA 2B1KA 4I2TA 1XW5A 2VL2A 3FZ9A 1MD3A 4TW5A 4GXTA 1GSSA 4KB3A 1UN2A 2L6CA 3ZZXA 3VK9A 5ECKB 3ZLPA 4D73B 5CAXA 2A2RA 4KCEA 1XWAA 2F51A 2JB2A 1AAZA 5IMAA 3TDGA 2DBCA 2HXKA 2Z9SA 1NHOA 1JLWA 5A4VA 4POMA 1XWKA 3W8JA 1MDJA 2IPAA 4TR0A 4ACSA 1T1VA 2A4HA 4MZBA 5IMFA 2PERA 3F63A 1HNCA 1R5AA 1S3CA 2J9HA 3IXRA 2CX3A 1CQHA 2CV4A 5BMUA 1JLVA 3FR6A 2V6KA 2IMFA 3PPUA 2AYTA 1OE7A 2AB6A 1R7HA 5JWOB 1X0RA 2H01A 1NM3A 4YZDA 1T4ZA 1OC9B 2E7PA 1G6WA 4ZBAA 4NPBA 5JCUA 5F06A 3P2AA 1SJIA 1GTAA 1EOHA 3ZMLA 2YV9A 4KGIA 2MMAA 1PX7A 1R26A 2BTOT 4NV5A 2YCDA 4K7NA 4X4JA 4Q5FA 5FWGA 4OAUC 3C73A 2GSSA 3ZVJA 3F4MA 3EU4A 2DMLA 5JWQB 2FNOA 1FG4A 2KP1A 1VRSD 2QKEA 2HRFA 1M2DA 2GTUA 5LNK1 4Q5NA 2A4VA 2KKMA 1J0FA 5F0GA 1QGVA 2AJQB 3HCZA 4O7HA 4ZBDA 4NHZA 2JACA 3C71A 3EMPA 1VF4A 3APSA 3IAS2 1SJ8A 5G5FA 4K0GA 4YQMA 1DSBA 3H8QA 2YFBA 2YWNA 2OJLA 3H1NA 1B9XC 1GTUA 2L59A 5AIXA 1EV9A 1G7OA 1GSYA 4HJ2A 4YH2A 1FAAA 3O6TA 3GL3A 3U5RE 5E4WA 2RM6A 1OYJA 2QA2A 2WRTA 4JBBA 3UARA 4IS0A 3KD0A 5G31A 4ZL8A 3FR9A 3IC4A 1XW9A 2NVLA 3KMNA 4EUYA 2L5OA 1I5GA 4ULXA 4HS1A 1JHBA 3ERWA 3QOUA 10GSA 1UA5A 1AIUA 3PGTA 4AF2A 1MTCA 1WP0A 1U6TA 1IYHA 2MMZA 2VUPA 1GTBA 5ECNB 5DCGA 2L57A 5IPGA 1YJ6A 3TJGA 3KH9A 4I8BA 2WJUA 4BA7A 3GKNA 1PD21 1SL2B 4MCUA 2YFAA 2LEGA 5J5NA 1T00A 2H72A 3WGEA 2KOKA 3LJ1A 4JE1A 5INYA 2HI7A 3TOTA 5LNKe 4EC0A 5B6MA 1ERUA 2H8LA 3KCMA 2N5AA 2ES7A 4XRDA 5B7CA 2LSTA 4ZB8A 4DVCA 2HT9A 1XFLA 2MJFB 5D8IA 3HJOA 4OFNA 5ECSA 5EVOA 3I9V1 1S3AA 3ZYWA 1VF1A 1TU7A 1FVJA 4XS4B 3UITA 2JB3A 3HZ8A 4XIHA 1THXA 1X5EA 2XBQA 1TRWA 2V1MA 2R2JA 2OADA 2C1YA 1N2AA 3RHCA 1JZDA 3GKKA 3ZITA 1GSEA 1EOGA 3UVTA 2WFCA 2H1GA 2REMA 6GSWA 1XZOA 4L5LA 3GRXA 3APOA 4ICYA 1GP1A 2C3QA 3LSZA 1XPVA 3A3TA 2YJ7A 2V41A 3G7JA 4K0NA 2HSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3B A;  5L71 A;  2YZU A;  1O8W A;  5A5K A;  1RQM A;  3EIN A;  2DJ1 A;  4CDO A;  3O3T A;  3JCM L;  2LS5 A;  2X8H A;  6GST A;  4F9Z A;  3D6I A;  2ON5 A;  3IDV A;  3ME8 A;  4I97 A;  5CRD A;  1Y25 A;  2H0I A;  5D9V A;  1ERV A;  2VO4 A;  1AW9 A;  2P5Q A;  3FR3 A;  3HY2 A;  4POK A;  4GSN A;  1K0B A;  5IMD A;  3D4T A;  5D9T A;  1EV4 A;  4TXO A;  5ID2 B;  5IQY A;  2OE3 A;  4ISD A;  4TRX A;  1QFN A;  1AQV A;  2RM5 A;  3DRN A;  3GNJ A;  5B6N A;  1BQ7 A;  2H70 A;  3V1W A;  1XVQ A;  1PQN A;  1O85 A;  1EP8 A;  1MD4 A;  4Q5Q A;  1YEP A;  2L4Q A;  1THO A;  5IOX A;  1TRS A;  2O7K A;  3F4R A;  3GFK A;  1AUC A;  1K0O A;  4AJ7 A;  3C8E A;  1A0F A;  4WET A;  5ECP B;  5IMZ A;  1YF0 A;  3EMX A;  4V2N A;  5ELA A;  5H5R A;  4L8E A;  2HSY A;  1PMT A;  1FW1 A;  2AHE A;  1UC7 A;  3VWW A;  3ERG A;  3E3E A;  3P7X A;  4JR4 A;  1AQX A;  1JZW A;  4I2U A;  1GUK A;  1O81 A;  4KSM A;  4N11 A;  4MJC A;  2XPD A;  4AGS A;  1HNA A;  3QPM A;  3TRP A;  1XBS A;  1YQ1 A;  2QC7 A;  1AQW A;  8GSS A;  2G0F A;  1N8J A;  3RPN A;  4IVF A;  1T7P B;  3RHB A;  4GQC A;  1F3B A;  3TJB A;  1GNE A;  3OR5 A;  4D73 A;  4E8H A;  3TKS E;  2VAF A;  5A4W A;  3VWU A;  3QMX A;  4QL9 A;  4IW9 A;  3KEB A;  1EZK A;  1BED A;  1E2Y A;  4N10 A;  3UAP A;  2WGR A;  3GUS A;  1J9B A;  2VL3 A;  5IM9 A;  2H1D A;  3MNG A;  5IPH A;  2MBT A;  5H5Q A;  3CYN A;  1TRU A;  1DE2 A;  1T4Y A;  2DIZ A;  1GTI A;  4ILF A;  1U3A A;  1YZX A;  2IMI A;  3ZFB A;  2QGV A;  1XWB A;  2VCW A;  1V57 A;  2TIR A;  4YQU A;  3NIV A;  4ZXG A;  2JSY A;  1YY7 A;  4DEJ A;  17GS A;  4PUR A;  1ON4 A;  2RLI A;  1HYU A;  1O7U A;  3GV1 A;  3IOS A;  4FIW A;  4V1A g;  4IKH A;  3VI5 A;  3N9J A;  5ECO B;  3F3Q A;  3UJ1 A;  4Q5R A;  1SK2 A;  4JRR A;  4GWR A;  2DJJ A;  1GSQ A;  2FWF A;  3W6G A;  5ECH B;  2GGT A;  5CO3 A;  2DC5 A;  3DIE A;  3IE3 A;  2HZE A;  3GH9 A;  4MPF A;  2YWI A;  3IBH A;  4GQF A;  12GS A;  1C72 A;  3DKS A;  2C4J A;  3VWX A;  4EO3 A;  2AV4 A;  1KTE A;  2O85 A;  2C3T A;  4H86 A;  2IMK A;  4RI7 A;  7GSS A;  4EKZ A;  3TKQ A;  2H1A A;  1M9A A;  4OFT A;  3IK9 A;  4ECI A;  1A24 A;  2ZNM A;  1XOB A;  2I1U A;  4P3Y B;  3WYW A;  5GAP D;  5J3R A;  4X0X A;  1CQG A;  4IP1 A;  4K1F A;  3HDC A;  2WUL A;  3BD2 A;  3QAW A;  3LEF A;  3VUR A;  1KBN A;  2P31 A;  4J57 E;  3RPP A;  2P0G A;  3CBU A;  1T8E B;  3ME7 A;  1EGO A;  5H5S A;  3I9V 2;  2YOI A;  5B8B A;  4IBP A;  1HQO A;  2R6K A;  4MA9 A;  2B7K A;  1GRX A;  4KW6 A;  2B5X A;  3CTF A;  4POB A;  1EEJ A;  3GA4 A;  3KM6 A;  4G9H A;  3FRC A;  1B4P A;  5JCG A;  1LBK A;  1SK1 A;  3E9J B;  6GSU A;  3M1G A;  3M0F A;  4ML6 A;  5DAL A;  2IFQ B;  2DSA A;  1OKT A;  2PMT A;  1PA3 A;  1FB0 A;  2FLS A;  4HI7 A;  2C8U A;  1SEN A;  3R2Q A;  1URM A;  2PN8 A;  2GS3 A;  2I81 A;  3ZL5 A;  3U6V A;  5CRH A;  1TK5 B;  2F8F A;  1ILO A;  5ECI B;  4LMV A;  2C0D A;  3IK7 A;  3UOM A;  3AY8 A;  1DUG A;  1YDK A;  1EGR A;  2AAW A;  4F03 A;  2GSQ A;  3CRU A;  3BJ5 A;  5F8B A;  1ZZY A;  4L5O A;  2K8S A;  1YF1 A;  1ZL9 A;  2FGX A;  1ML6 A;  3WT2 A;  1R5P A;  4CHS A;  5EL8 A;  4MAB A;  4KH7 A;  2F3M A;  2GSR A;  4MF7 A;  3IA1 A;  2CQ9 A;  4J2F A;  2KHP A;  4ZIL A;  5FHI A;  5HR3 A;  2K18 A;  4LL1 B;  2ALB A;  4DSS A;  4HQZ A;  3RBT A;  3DYR A;  3FZA A;  2L5L A;  3DGQ A;  1WRY A;  1TI1 A;  3TOU A;  2GZZ A;  2CAQ A;  2FY6 A;  4PQI A;  3EUR A;  1K3O A;  4KE3 A;  4BVY A;  3HA9 A;  3UBK A;  14GS A;  4XS4 A;  4O32 A;  3ZVJ D;  3LXZ A;  2B3S A;  2ON7 A;  3TRX A;  1FB6 A;  2XBI A;  2IN3 A;  1PRX A;  1GLQ A;  5AIS A;  5C00 A;  5A4U A;  2VD0 A;  1AXD A;  3M8N A;  2LNT A;  5G30 A;  3TKS C;  5J9B A;  3DVW A;  3IHQ A;  3QFB C;  1F6M C;  5LCZ A;  1XXU A;  1OKD A;  2F8A A;  2C3N A;  5KN3 A;  4EVM A;  3FZ4 A;  1GUL A;  4OCE A;  3C1R A;  3WGD A;  5J9C A;  3M9K A;  1TRV A;  4MF6 A;  4WXT A;  1SKS B;  2H6X A;  2IL3 A;  3CMI A;  3GKM A;  1JFU A;  4F0C A;  2V32 A;  4KND A;  5HQP A;  1SD9 A;  1XCC A;  1QMV A;  2OAC A;  1Z7P A;  1SK0 A;  1SJZ A;  4GLT A;  1TDI A;  2B7J A;  4OO4 A;  4XCS A;  2PVO C;  1V40 A;  5DAK B;  1JZO A;  2MBS A;  2LRC A;  2D2Z A;  5FT3 A;  4I6X A;  4OO5 A;  5DQY A;  5ID2 A;  4KX4 A;  5KN1 A;  2X99 A;  3GMF A;  3KTB A;  4V2M A;  1X9M B;  1OC3 A;  4NAX A;  3ERF A;  1OAZ A;  4POL A;  2H71 A;  1DE1 A;  2H76 A;  2CA8 A;  2OE0 A;  2GLR A;  1SKR B;  3GH6 A;  1GUM A;  3UEM A;  3LGC A;  5D73 A;  4F82 A;  3MWH A;  3HVV A;  4L0W A;  1QUW A;  5IIZ A;  5D93 A;  4LL4 B;  3IPZ A;  2JZR A;  5DJL A;  3K8N A;  1TK8 B;  1TOF A;  2VLU A;  5ECM B;  4OWY A;  1SJ6 A;  2FWH A;  4TKY A;  2H66 A;  1ACV A;  5EPF A;  3TJF A;  4PXO A;  3CTG A;  1E6B A;  5HFG A;  4YAV A;  4RQX A;  4KAE A;  1WWJ A;  3LWA A;  5IMV A;  2VCV A;  3H79 A;  5D96 A;  1O8X A;  3Q19 A;  4FO5 A;  4J56 E;  4ECB A;  3TB2 A;  3C7M A;  2CZ2 A;  5DVB A;  2GQL A;  4DSR A;  2CVB A;  2OBK A;  1NSW A;  4KA0 A;  4K2D A;  4G2E A;  4MF5 A;  5CRG A;  1WPI A;  5AN1 A;  2GZY A;  1QQ2 A;  4PUF C;  3IRA A;  3VI7 A;  2PBJ A;  2JZS A;  5DCH A;  1SD8 A;  19GS A;  4ECC A;  3UL3 A;  4MDC A;  3P90 A;  3HVS A;  2H19 A;  3H93 A;  3F4T A;  2NTO A;  1K0C A;  4HJM A;  1A2J A;  3KIJ A;  2LRN A;  3EWL A;  3D4M A;  1WIK A;  2JL4 A;  1R4W A;  3KXO A;  3APQ A;  1FHE A;  2CZ3 A;  1B9Y C;  1RK4 A;  2C80 A;  3ISO A;  2GST A;  1OVN A;  5G5E A;  3HYP A;  2VOC A;  4K8M A;  1PKW A;  1QK8 A;  3ZRE A;  5GAN D;  2HFD A;  4NV2 A;  3FYG A;  2GQM A;  2O8V B;  3LQ7 A;  3GYK A;  1BJX A;  2N5F A;  4MZW A;  3BBY A;  3TKS A;  3L0H A;  1KEB A;  2PU9 C;  5IO2 A;  3FW2 A;  2F9S A;  2IME A;  1ABA A;  3GTU B;  2LJR A;  1A2M A;  3RAZ A;  3A5W A;  5CNW A;  1GL8 A;  4JZQ A;  2GT5 A;  1G6Y A;  1M2A A;  2PVQ A;  2ZCT A;  1GSF A;  3BOA A;  2K9F A;  3UMA A;  2V2G A;  4PX1 A;  5ECR B;  1OC8 A;  2YWO A;  3SBC A;  3HJM A;  4IQA A;  3P8W A;  4LMW A;  3DVX A;  3HD5 A;  1ERW A;  1O73 A;  2VM2 A;  1K0N A;  4BPY A;  3F0I A;  4V1A p;  1G7E A;  6GSX A;  1BX9 A;  1Z6N A;  1XWG A;  3BCI A;  2VCZ A;  1ERT A;  2AUV A;  3I43 A;  5G1K A;  1ZGN A;  4JR6 A;  5F05 A;  1YEX A;  2EIR A;  1GNW A;  1HD2 A;  2YPM A;  2YNX A;  3LG6 A;  4PQH A;  3TUE A;  2LQQ A;  1K0A A;  3M3M A;  6GSS A;  3I69 A;  3EVI A;  2IFQ A;  4BWS A;  3L4N A;  2H30 A;  4KDX A;  2CVK A;  3D0Z A;  2H0G A;  4EDZ A;  4X43 A;  1TU8 A;  2L4C A;  2BJX A;  5HR2 A;  5DQS A;  3TGZ A;  3GN3 A;  1U88 A;  4WR4 A;  2NBS A;  1K3L A;  1A0R P;  1OC9 A;  3KJY A;  4XHM A;  3N5O A;  4BL7 A;  3FY7 A;  1PL2 A;  3J7Y k;  3GSS A;  2CX4 A;  6GSY A;  4TXO B;  4PUA A;  2YWM A;  1EEM A;  3GIX A;  3IR4 A;  1SU9 A;  3ZMK A;  3HHV A;  1SKW B;  4MH3 A;  2K8V A;  4TR3 A;  1F9M A;  1QXH A;  1OE8 A;  2M46 A;  3GL5 A;  3M9J A;  3HJP A;  4K7I A;  1S3D A;  2E2M A;  1LJR A;  2H1B A;  4HZ4 A;  4TVE A;  1B48 A;  2R5G A;  1TW9 A;  2FD3 A;  5AIV A;  2MYG A;  4TR1 B;  4WEY A;  3W8S A;  3QAV A;  9GSS A;  1TJD A;  3VLN A;  3C1S A;  3WGX A;  1Z9H A;  4K6X A;  5ENU A;  5F07 A;  4DSQ A;  4PNG A;  5GZZ B;  4IGJ A;  1A23 A;  3RDW A;  2GT6 A;  2EIO A;  1UVZ A;  4WBR D;  2KLX A;  4YQV A;  4KDU A;  4NWY A;  4QL7 A;  3Q18 A;  4JU5 A;  5D9X A;  2IJY A;  3H4K A;  2PWJ A;  2VLV A;  2VLT A;  2B1L A;  3GX8 A;  3CRT A;  4K9Z A;  2H6Y A;  1Z7R A;  4OMV A;  4MLY A;  1G0T A;  1GSD A;  3HZ4 A;  2FA8 A;  5ECL B;  2RII A;  1EWX A;  1ST9 A;  1B4Q A;  2M80 A;  4MJE A;  4GXZ A;  4EXJ A;  2CT6 A;  3KMO A;  2TRC P;  2LQO A;  2GVP A;  1AC1 A;  5D9W A;  3UVH A;  4I5Q A;  3E0U A;  3I6A A;  1YKA A;  4AJ6 A;  4EDY A;  1JZR A;  1SL0 B;  2LJA A;  3A2X A;  2HRN A;  3PH9 A;  1ZOF A;  3QCP A;  4BWQ A;  2YZH A;  1I9D A;  5DBQ A;  1SYX A;  2H6Z A;  5G1L A;  4KCA A;  4IEL A;  5DAK A;  1Q4J A;  3QFA C;  4HU9 A;  4WR5 A;  4IQ1 A;  1BAY A;  4F2I A;  2YV7 A;  4FYC A;  2ZUP A;  3LYP A;  4MZC A;  3D21 A;  4ID0 A;  2KUC A;  2EC4 A;  3IV4 A;  1A2L A;  2CAI A;  3NZN A;  3MSZ A;  3CSJ A;  3KZQ A;  1GH2 A;  3CSI A;  5J4U A;  2DIY A;  3ED3 A;  3IAM 2;  1GWC A;  1FO5 A;  4K7O A;  2MZC A;  2XPE A;  5CRW A;  4E8E A;  3QDN A;  4MMM A;  11GS A;  3S9F A;  5JCW A;  1GLP A;  3EU3 A;  4KDY A;  5COH A;  2WZ9 A;  2FWG A;  2HZE B;  2JZT A;  1Z6M A;  1M7T A;  20GS A;  2C0E A;  2XHF A;  5LD0 A;  2IWT A;  3L9U A;  4ML1 A;  2MMN A;  2NPB A;  2DJ2 A;  3O76 A;  2P5R A;  3KP9 A;  1W89 A;  2TRX A;  3TKP A;  2V6O A;  1B8X A;  2YN1 A;  5DDL A;  1PX6 A;  2HNL A;  4EE0 A;  2VCX A;  1SL1 B;  5KEJ A;  3F6F A;  1DBY A;  1V58 A;  4LLR A;  4MJB A;  3LJR A;  1V98 A;  1PKZ A;  2R4V A;  5AGY A;  2X8G A;  3F3R A;  3L9V A;  2WDU A;  2E2G A;  1ZYQ B;  2FCH A;  1X9S B;  4HUA A;  4FH8 A;  3DML A;  1EP7 A;  4NHW A;  3FEU A;  4ZB6 A;  4FYB A;  4ZL7 A;  1M9B A;  2DLX A;  4MP4 A;  1WJK A;  4GF0 A;  1V2A A;  5DAL B;  3DXB A;  1F3A A;  2N5B A;  2H0H A;  3DWV A;  3TJJ A;  3PR8 A;  2PPT A;  2JSZ A;  3LXT A;  5KN2 A;  4JED A;  1WMJ A;  2CVD A;  2FA4 A;  2DJ0 A;  1NHY A;  3PIN A;  2QSI A;  4XS6 A;  3VPT A;  3DD3 A;  4HEA 2;  3TKR A;  1GUH A;  2DMM A;  2VIM A;  5KN0 A;  2O87 A;  4MPG A;  1IYI A;  4TN8 A;  5ECQ B;  3FKF A;  3NOF A;  2IIY A;  3L9S A;  3A2W A;  4GTU A;  4TR4 A;  5GST A;  4RQR A;  1U87 A;  4FYU A;  2HSH A;  1W4V A;  1X9W B;  1PL1 A;  22GS A;  4HQS A;  1GSU A;  2VCT A;  3ZFL A;  2HYX A;  4DSS B;  3ZIJ A;  2BMX A;  5E59 A;  1J08 A;  1K0M A;  5G2Z A;  2VCQ A;  1M0U A;  5IOW A;  3MAK A;  3GTU A;  5HR0 A;  1TTZ A;  1USB A;  1WOU A;  1VF3 A;  2C0F A;  4AJ8 A;  2WCI A;  5DJM A;  1XIY A;  3EE2 A;  1Z3E A;  3EC3 A;  3VWV A;  5CRE A;  3L78 A;  5HR1 A;  4LA1 A;  1U3I A;  2YJH A;  3GST A;  4RUV A;  2M72 A;  1TXX A;  3F8U A;  1XW6 A;  4GSS A;  2OKA A;  4ZBB A;  2H74 A;  1FVK A;  4O92 A;  4RI6 A;  3G7I A;  1O6J A;  2DJ3 A;  4OFM A;  4XTS A;  2GZP A;  4HZ2 A;  4F0B A;  4V2L A;  2LV3 A;  4KUN A;  4WBJ A;  4N0V A;  1K3Y A;  3HXS A;  2E0Q A;  3SWL A;  3TCO A;  2YP6 A;  3KTL A;  2L6D A;  4MK3 A;  5CP1 A;  3ZRD A;  3LYK A;  3BCK A;  6GSV A;  2X64 A;  3KGK A;  2WS2 A;  2K6V A;  3F4S A;  4MH2 A;  3G7Y A;  2NDO A;  2PUK C;  4NMU A;  4GCI A;  4L0U A;  5IMC A;  3FHK A;  4Z7X A;  2C0G A;  1TK0 B;  3ZTL A;  4XRA A;  2VL2 C;  3GX0 A;  1F2E A;  3GUR A;  1MDK A;  1TP9 A;  3MDK A;  1BG5 A;  4ECJ A;  3D22 A;  3CXG A;  1ZYE A;  3LOR A;  1TKD B;  4OD7 A;  4WKW A;  1ZCP A;  1MEK A;  2IMD A;  5ABR A;  4X1U A;  2X8C A;  2LTK A;  3VPQ A;  4HOJ A;  2GQK A;  1XWC A;  2WB9 A;  2I3Y A;  5GSS A;  4QQ7 A;  4TR1 A;  5J41 A;  1RW1 A;  5HFK A;  4WF5 A;  1X5D A;  2YAN A;  5C04 A;  4IJ3 A;  2HLS A;  2O89 A;  2RUE A;  4OCF A;  1NW2 A;  1FOV A;  2KP2 A;  2OA7 A;  3QAG A;  2LNS A;  3TRQ A;  5B8A A;  2DJK A;  4IN0 A;  1TI3 A;  1X5C A;  2MMO A;  1LU4 A;  4KSO A;  1H4O A;  3FZ5 A;  2B6M A;  4TXV A;  4EL1 A;  3Q6O A;  4WF4 A;  4MJA A;  2H73 A;  1V9W A;  1YKC A;  3LFL A;  3DEX A;  4IP6 A;  1VF2 A;  2EIQ A;  1XVW A;  1ZMA A;  1PGT A;  1Z5Y E;  1HNB A;  1XOA A;  3VFI A;  3Q74 A;  3GKX A;  4CW9 A;  4GRF A;  1PN9 A;  3US3 A;  2R37 A;  2A2S A;  4TOP A;  3WT1 A;  1A8Y A;  4HDE A;  1K0D A;  1Y6E A;  2I4A A;  4G19 A;  3QD9 A;  5IO0 A;  2XC2 A;  3D5J A;  2LKU A;  3J7Y b;  2R3X A;  3F6D A;  2GDR A;  3UBL A;  1Q98 A;  2J23 A;  4GST A;  4PQ1 A;  1A8L A;  2OE1 A;  3F9U A;  2G2Q A;  2PGT A;  1F37 A;  2FUG 2;  4IJI A;  2I9H A;  4IHU A;  1PSQ A;  5JWR B;  2JAD A;  4PNF A;  3ZIV A;  2FWE A;  3G9B A;  4N30 A;  4NXI A;  4ZIJ A;  1H75 A;  16GS A;  1M2B A;  2FHE A;  2LUS A;  1SYR A;  5EY6 A;  1VGL A;  5ELG A;  2VD1 A;  4HU7 A;  4XS1 A;  4YAP A;  2HE3 A;  3FK8 A;  2VM1 A;  1BYE A;  3HVX A;  2OBI A;  4ZL9 A;  13GS A;  5HFI A;  2HZF A;  3HKR A;  3KH7 A;  4N0Z A;  4PGT A;  4EF0 A;  1WE0 A;  1KNG A;  2H75 A;  18GS A;  3GHA A;  3TJK A;  2RUF A;  3WD6 A;  3QR6 A;  5CYY A;  2B5Y A;  2JU5 A;  3KP8 A;  3EYT A;  2LJK A;  1MDI A;  4BVX A;  4G10 A;  2B5E A;  4ZB9 A;  3UIW A;  3A2V A;  4O5R A;  2VL9 A;  1M99 A;  3CSH A;  2LRT A;  2B1K A;  4I2T A;  1XW5 A;  2VL2 A;  3FZ9 A;  1MD3 A;  4TW5 A;  1GSS A;  4KB3 A;  1UN2 A;  2L6C A;  3ZZX A;  3VK9 A;  5ECK B;  3ZLP A;  4D73 B;  5CAX A;  2A2R A;  4KCE A;  1XWA A;  2F51 A;  1AAZ A;  5IMA A;  3TDG A;  2DBC A;  2HXK A;  2Z9S A;  1NHO A;  1JLW A;  5A4V A;  4POM A;  1XWK A;  3W8J A;  4TR0 A;  1MDJ A;  2IPA A;  4ACS A;  1T1V A;  4MZB A;  5IMF A;  2PER A;  3F63 A;  1HNC A;  1R5A A;  1S3C A;  2J9H A;  3IXR A;  2CX3 A;  1CQH A;  2CV4 A;  1JLV A;  3FR6 A;  2V6K A;  2IMF A;  2AYT A;  1OE7 A;  2AB6 A;  1R7H A;  5JWO B;  1X0R A;  2H01 A;  1NM3 A;  1T4Z A;  1OC9 B;  2E7P A;  1G6W A;  4ZBA A;  4NPB A;  5JCU A;  5F06 A;  3P2A A;  1SJI A;  1GTA A;  1EOH A;  3ZML A;  2YV9 A;  4KGI A;  2MMA A;  1PX7 A;  1R26 A;  2BTO T;  4NV5 A;  2YCD A;  4K7N A;  4Q5F A;  5FWG A;  3C73 A;  2GSS A;  3ZVJ A;  3EU4 A;  2DML A;  5JWQ B;  2FNO A;  1FG4 A;  2KP1 A;  1VRS D;  2QKE A;  2HRF A;  1M2D A;  2GTU A;  4Q5N A;  2A4V A;  1J0F A;  5F0G A;  1QGV A;  2AJQ B;  3HCZ A;  4O7H A;  4ZBD A;  4NHZ A;  2JAC A;  3C71 A;  3EMP A;  1VF4 A;  3APS A;  3IAS 2;  5G5F A;  4K0G A;  4YQM A;  1DSB A;  3H8Q A;  2YWN A;  2OJL A;  3H1N A;  1B9X C;  1GTU A;  2L59 A;  5AIX A;  1EV9 A;  1G7O A;  1GSY A;  4HJ2 A;  4YH2 A;  1FAA A;  3O6T A;  3GL3 A;  3U5R E;  5E4W A;  2RM6 A;  1OYJ A;  2WRT A;  4JBB A;  3UAR A;  4IS0 A;  3KD0 A;  5G31 A;  4ZL8 A;  3FR9 A;  3IC4 A;  1XW9 A;  2NVL A;  3KMN A;  4EUY A;  2L5O A;  1I5G A;  4ULX A;  4HS1 A;  1JHB A;  3ERW A;  3QOU A;  10GS A;  1UA5 A;  1AIU A;  3PGT A;  4AF2 A;  1MTC A;  1WP0 A;  1U6T A;  1IYH A;  2MMZ A;  2VUP A;  1GTB A;  5ECN B;  5DCG A;  2L57 A;  5IPG A;  1YJ6 A;  3TJG A;  3KH9 A;  4I8B A;  2WJU A;  4BA7 A;  3GKN A;  1PD2 1;  1SL2 B;  4MCU A;  2LEG A;  5J5N A;  1T00 A;  2H72 A;  3WGE A;  2KOK A;  4JE1 A;  5INY A;  2HI7 A;  3TOT A;  5LNK e;  4EC0 A;  5B6M A;  1ERU A;  2H8L A;  3KCM A;  2N5A A;  2ES7 A;  4XRD A;  5B7C A;  2LST A;  4ZB8 A;  4DVC A;  2HT9 A;  1XFL A;  5D8I A;  3HJO A;  4OFN A;  5ECS A;  5EVO A;  1S3A A;  3ZYW A;  1VF1 A;  1TU7 A;  1FVJ A;  4XS4 B;  3HZ8 A;  4XIH A;  1THX A;  1X5E A;  2XBQ A;  1TRW A;  2V1M A;  2R2J A;  2OAD A;  2C1Y A;  1N2A A;  3RHC A;  1JZD A;  3GKK A;  3ZIT A;  1GSE A;  1EOG A;  3UVT A;  2WFC A;  2H1G A;  2REM A;  6GSW A;  1XZO A;  4L5L A;  3GRX A;  3APO A;  1GP1 A;  2C3Q A;  3LSZ A;  1XPV A;  3A3T A;  2YJ7 A;  2V41 A;  3G7J A;  4K0N A; 
#chains in the Genus database with same CATH topology
 1T3B A;  5L71 A;  2YZU A;  1O8W A;  5A5K A;  1RQM A;  3EIN A;  4A5P A;  2DJ1 A;  4CDO A;  2DKI A;  1ZYP A;  3O3T A;  3JCM L;  2LS5 A;  2X8H A;  6GST A;  4F9Z A;  3D6I A;  4CY8 A;  2ON5 A;  3IDV A;  3ME8 A;  4I97 A;  5CRD A;  1Y25 A;  2H0I A;  4BIK A;  5D9V A;  1ERV A;  2VO4 A;  1AW9 A;  2P5Q A;  3FR3 A;  3HY2 A;  4POK A;  3IAM 1;  4GSN A;  1K0B A;  5IMD A;  3D4T A;  5D9T A;  1EV4 A;  4TXO A;  5ID2 B;  5IQY A;  2OE3 A;  4ISD A;  4TRX A;  1QFN A;  1AQV A;  2RM5 A;  3DRN A;  3GNJ A;  5B6N A;  1BQ7 A;  2H70 A;  3V1W A;  1XVQ A;  1PQN A;  1O85 A;  1EP8 A;  1MD4 A;  4Q5Q A;  1YEP A;  2L4Q A;  1THO A;  5IOX A;  1TRS A;  2O7K A;  3F4R A;  2V1C C;  3GFK A;  1AUC A;  1K0O A;  4AJ7 A;  3C8E A;  1A0F A;  4WET A;  5ECP B;  5IMZ A;  1YF0 A;  3EMX A;  4V2N A;  5ELA A;  5H5R A;  4OAV B;  4L8E A;  2HSY A;  1PMT A;  1FW1 A;  1ZYN A;  2AHE A;  1UC7 A;  3VWW A;  3ERG A;  3E3E A;  3P7X A;  4JR4 A;  1AQX A;  1JZW A;  4I2U A;  4HFV A;  1GUK A;  1O81 A;  4KSM A;  4N11 A;  4MJC A;  2XPD A;  4AGS A;  1HNA A;  3QPM A;  3TRP A;  1XBS A;  1YQ1 A;  2QC7 A;  1AQW A;  8GSS A;  2G0F A;  1N8J A;  3RPN A;  4IVF A;  1T7P B;  3RHB A;  4GQC A;  1F3B A;  3TJB A;  1GNE A;  3OR5 A;  4D73 A;  4E8H A;  3TKS E;  2VAF A;  4Z2T A;  5A4W A;  4G75 A;  3VWU A;  3QMX A;  4QL9 A;  4IW9 A;  3KEB A;  1EZK A;  1BED A;  1E2Y A;  4N10 A;  3UAP A;  2WGR A;  3GUS A;  1J9B A;  2VL3 A;  2RLD A;  2HRK A;  5IM9 A;  2H1D A;  3MNG A;  4HEA 1;  5IPH A;  2MBT A;  5H5Q A;  3CYN A;  1TRU A;  1DE2 A;  1T4Y A;  2CAZ B;  2DIZ A;  1GTI A;  4ILF A;  1U3A A;  1YZX A;  4Z7H A;  2IMI A;  3ZFB A;  4YKG A;  2QGV A;  1XWB A;  2VCW A;  1V57 A;  2TIR A;  4YQU A;  3NIV A;  4ZXG A;  2JSY A;  1YY7 A;  4DEJ A;  17GS A;  4PUR A;  1ON4 A;  2RLI A;  1HYU A;  1O7U A;  3GV1 A;  3IOS A;  4FIW A;  4V1A g;  4IKH A;  3VI5 A;  3N9J A;  5ECO B;  3F3Q A;  3UJ1 A;  4Q5R A;  1SK2 A;  4JRR A;  4GWR A;  2DJJ A;  4K5S A;  1GSQ A;  2FWF A;  3W6G A;  3FMW A;  5ECH B;  2GGT A;  5CO3 A;  2DC5 A;  3DIE A;  3IE3 A;  2HZE A;  3GH9 A;  4MPF A;  2YWI A;  3IBH A;  4GQF A;  12GS A;  1C72 A;  3DKS A;  2C4J A;  3VWX A;  4EO3 A;  2AV4 A;  4PL3 A;  4G76 A;  1KTE A;  2E8G A;  2O85 A;  2C3T A;  3HVN A;  4H86 A;  2IMK A;  4RI7 A;  7GSS A;  4EKZ A;  3TKQ A;  3LJ0 A;  2JAE A;  2H1A A;  1M9A A;  4OFT A;  3IK9 A;  4ECI A;  1A24 A;  2ZNM A;  1XOB A;  2I1U A;  4P3Y B;  3WYW A;  5GAP D;  5J3R A;  4X0X A;  1CQG A;  4IP1 A;  4K1F A;  4KF9 A;  3HDC A;  2WUL A;  3BD2 A;  3QAW A;  3LEF A;  3VUR A;  1KBN A;  2P31 A;  4J57 E;  3RPP A;  2P0G A;  3CBU A;  1T8E B;  3ME7 A;  1EGO A;  5H5S A;  3I9V 2;  2YOI A;  5B8B A;  4IBP A;  1HQO A;  2R6K A;  4MA9 A;  2B7K A;  1GRX A;  4KW6 A;  2B5X A;  3CTF A;  4POB A;  1EEJ A;  3GA4 A;  3KM6 A;  4G9H A;  3DA4 A;  3FRC A;  1B4P A;  5JCG A;  1LBK A;  1SK1 A;  3E9J B;  6GSU A;  3M1G A;  3M0F A;  4ML6 A;  5DAL A;  2IFQ B;  2DSA A;  1OKT A;  2PMT A;  2RIO A;  1PA3 A;  1FB0 A;  2FLS A;  4HI7 A;  2C8U A;  1SEN A;  3R2Q A;  1URM A;  2PN8 A;  2GS3 A;  2I81 A;  3ZL5 A;  4CY6 A;  3U6V A;  5CRH A;  1TK5 B;  2F8F A;  1ILO A;  5ECI B;  4LMV A;  2C0D A;  3IK7 A;  3UOM A;  3AY8 A;  3IHG A;  1DUG A;  1YDK A;  4BL7 B;  1EGR A;  2AAW A;  4F03 A;  2GSQ A;  3CRU A;  3BJ5 A;  5F8B A;  3P23 A;  1ZZY A;  4L5O A;  2K8S A;  1YF1 A;  1ZL9 A;  2FGX A;  1ML6 A;  3WT2 A;  1R5P A;  4CHS A;  5EL8 A;  4MAB A;  4KH7 A;  2F3M A;  2GSR A;  4MF7 A;  3IA1 A;  2CQ9 A;  4J2F A;  2KHP A;  4AS3 A;  4ZIL A;  5FHI A;  5HR3 A;  2K18 A;  4LL1 B;  2ALB A;  1TDP A;  4DSS A;  4HQZ A;  3RBT A;  3DYR A;  3FZA A;  2L5L A;  3DGQ A;  3DO9 A;  1WRY A;  1TI1 A;  3TOU A;  2GZZ A;  2ETD A;  2CAQ A;  2FY6 A;  4PQI A;  3EUR A;  1K3O A;  4KE3 A;  4G0L A;  4BVY A;  3HA9 A;  3UBK A;  14GS A;  4XS4 A;  4O32 A;  3ZVJ D;  3LXZ A;  2B3S A;  2ON7 A;  3TRX A;  4BVX B;  1FB6 A;  2XBI A;  2IN3 A;  1PRX A;  1GLQ A;  5AIS A;  5C00 A;  3MIX A;  5A4U A;  2VD0 A;  1AXD A;  3M8N A;  2LNT A;  5G30 A;  3TKS C;  5J9B A;  3DVW A;  3IHQ A;  2FUG 1;  1F6M C;  3QFB C;  5LCZ A;  2XTR A;  1XXU A;  1OKD A;  2F8A A;  2C3N A;  5KN3 A;  4EVM A;  3FZ4 A;  1GUL A;  4OCE A;  3C1R A;  3WGD A;  5J9C A;  3M9K A;  1TRV A;  4MF6 A;  4WXT A;  1SKS B;  4PL5 A;  2H6X A;  2IL3 A;  3CMI A;  3GKM A;  1JFU A;  4F0C A;  5KOW A;  2V32 A;  3R3E A;  4KND A;  5HQP A;  1SD9 A;  1XCC A;  1QMV A;  2OAC A;  1Z7P A;  1SK0 A;  1SJZ A;  4GLT A;  1TDI A;  2B7J A;  4OO4 A;  4XCS A;  2PVO C;  1V40 A;  5DAK B;  1JZO A;  5HGI A;  2MBS A;  2LRC A;  2D2Z A;  5FT3 A;  4I6X A;  4OO5 A;  5DQY A;  5ID2 A;  4KX4 A;  5KN1 A;  2X99 A;  3GMF A;  3KTB A;  4V2M A;  1X9M B;  1OC3 A;  4NAX A;  3ERF A;  2BL7 A;  1OAZ A;  4POL A;  2F66 B;  2H71 A;  1DE1 A;  2H76 A;  2CA8 A;  2OE0 A;  2GLR A;  1SKR B;  3GH6 A;  1GUM A;  3UEM A;  3LGC A;  5D73 A;  4O1O A;  4F82 A;  3MWH A;  3HVV A;  2IP6 A;  3IC8 A;  4L0W A;  1QUW A;  3JSB A;  5IIZ A;  5D93 A;  4LL4 B;  3IPZ A;  2JZR A;  5DJL A;  3K8N A;  1TK8 B;  1TOF A;  2VLU A;  5ECM B;  4OWY A;  1SJ6 A;  2FWH A;  4TKY A;  2H66 A;  1ACV A;  2FU2 A;  5EPF A;  3TJF A;  4PXO A;  3CTG A;  1E6B A;  5HFG A;  4YAV A;  4RQX A;  4KAE A;  1WWJ A;  3LWA A;  5IMV A;  2VCV A;  3H79 A;  5D96 A;  4EIP A;  1O8X A;  3Q19 A;  4FO5 A;  2P22 B;  4J56 E;  4ECB A;  3TB2 A;  3C7M A;  2CZ2 A;  5DVB A;  2GQL A;  4DSR A;  2CVB A;  2OBK A;  1NSW A;  4KA0 A;  4K2D A;  4G2E A;  3MYD A;  4MF5 A;  5CRG A;  2GSC A;  1WPI A;  3Q8D A;  5AN1 A;  2GZY A;  1QQ2 A;  4PUF C;  3IRA A;  3VI7 A;  2PBJ A;  2JZS A;  3A5I A;  5DCH A;  1SD8 A;  2FEF A;  19GS A;  4ECC A;  3UL3 A;  4MDC A;  3P90 A;  3HVS A;  2H19 A;  3H93 A;  3F4T A;  2NTO A;  1K0C A;  4HJM A;  3FVV A;  1A2J A;  3KIJ A;  2LRN A;  3EWL A;  3D4M A;  1WIK A;  2JL4 A;  3KXO A;  1R4W A;  3APQ A;  1FHE A;  2CZ3 A;  1B9Y C;  1RK4 A;  2C80 A;  3ISO A;  2GST A;  4AS2 A;  1OVN A;  4PTS A;  5G5E A;  3HYP A;  2VOC A;  4K8M A;  1PKW A;  1QK8 A;  3ZRE A;  5GAN D;  2F6M B;  4O5U A;  2HFD A;  4NV2 A;  3FYG A;  4G0I A;  2GQM A;  2O8V B;  2R0C A;  3LQ7 A;  3GYK A;  1BJX A;  2N5F A;  4MZW A;  2ZRR A;  1PFO A;  3BBY A;  3TKS A;  3L0H A;  1KEB A;  2PU9 C;  5IO2 A;  3FW2 A;  3B55 A;  2F9S A;  2IME A;  1ABA A;  3GTU B;  2LJR A;  2L1L B;  1A2M A;  3RAZ A;  4I1T A;  3A5W A;  5CNW A;  1GL8 A;  4JZQ A;  2GT5 A;  1G6Y A;  2DKH A;  3CQF A;  1M2A A;  2PVQ A;  2ZCT A;  1GSF A;  3BOA A;  2K9F A;  3UMA A;  2V2G A;  4PX1 A;  5ECR B;  1OC8 A;  2YWO A;  3SBC A;  3HJM A;  4IQA A;  3P8W A;  4LMW A;  3DVX A;  2XTQ A;  3HD5 A;  1ERW A;  1O73 A;  2VM2 A;  1K0N A;  4BPY A;  3F0I A;  4JCV E;  4V1A p;  1G7E A;  6GSX A;  1BX9 A;  1Z6N A;  1XWG A;  3BCI A;  2VCZ A;  1ERT A;  2AUV A;  3I43 A;  5G1K A;  1ZGN A;  4JR6 A;  2JBW A;  1YEX A;  2EIR A;  5F05 A;  1GNW A;  1HD2 A;  2YPM A;  2YNX A;  3LG6 A;  4PQH A;  3TUE A;  2LQQ A;  1K0A A;  3M3M A;  6GSS A;  3I69 A;  3EVI A;  2IFQ A;  4BWS A;  3L4N A;  2H30 A;  4KDX A;  2CVK A;  3D0Z A;  2H0G A;  4EDZ A;  4X43 A;  1TU8 A;  2L4C A;  2BJX A;  5HR2 A;  5DQS A;  3TGZ A;  3GN3 A;  1U88 A;  4WR4 A;  2NBS A;  1K3L A;  1A0R P;  1OC9 A;  3KJY A;  4XHM A;  3N5O A;  4BL7 A;  3FY7 A;  1PL2 A;  3J7Y k;  3GSS A;  2CX4 A;  6GSY A;  4TXO B;  4PUA A;  2YWM A;  1EEM A;  3GIX A;  3IR4 A;  1SU9 A;  3ZMK A;  3HHV A;  1SKW B;  4MH3 A;  2K8V A;  4TR3 A;  2JB1 A;  1M3J A;  1JQO A;  1F9M A;  1QXH A;  1OE8 A;  2M46 A;  3GL5 A;  3M9J A;  3HJP A;  2A2C A;  4K7I A;  1S3D A;  2E2M A;  1LJR A;  2H1B A;  4HZ4 A;  4TVE A;  1B48 A;  2R5G A;  1TW9 A;  2FD3 A;  5AIV A;  2X49 A;  2MYG A;  4TR1 B;  4WEY A;  3W8S A;  3QAV A;  9GSS A;  1TJD A;  3VLN A;  3C1S A;  3WGX A;  2XMX A;  1Z9H A;  4K6X A;  5ENU A;  5F07 A;  4DSQ A;  4PNG A;  5GZZ B;  4IGJ A;  1A23 A;  3RDW A;  2GT6 A;  2EIO A;  1UVZ A;  4WBR D;  2KLX A;  1FOH A;  4YQV A;  4KDU A;  4NWY A;  4QL7 A;  3Q18 A;  4JU5 A;  5D9X A;  4Z7G A;  2IJY A;  3H4K A;  2PWJ A;  2VLV A;  2UZ8 A;  2VLT A;  2B1L A;  3GX8 A;  3CRT A;  4K9Z A;  2H6Y A;  1Z7R A;  4OMV A;  4MLY A;  1G0T A;  1GSD A;  3HZ4 A;  2FA8 A;  5ECL B;  2RII A;  1EWX A;  1ST9 A;  1B4Q A;  2M80 A;  4MJE A;  4GXZ A;  4EXJ A;  2CT6 A;  3KMO A;  2TRC P;  2LQO A;  2GVP A;  1AC1 A;  5D9W A;  3UVH A;  4I5Q A;  3E0U A;  3I6A A;  3FBV A;  1YKA A;  4AJ6 A;  4EDY A;  1JZR A;  1SL0 B;  2LJA A;  3A2X A;  2HRN A;  3PH9 A;  1ZOF A;  3QCP A;  4BWQ A;  2YZH A;  1I9D A;  5DBQ A;  5KOX A;  1SYX A;  2H6Z A;  5G1L A;  4KCA A;  4IEL A;  5DAK A;  1Q4J A;  3QFA C;  4HU9 A;  4WR5 A;  4IQ1 A;  1BAY A;  4FQU A;  4F2I A;  2YV7 A;  4FYC A;  2ZUP A;  3LYP A;  4MZC A;  3EPT A;  3D21 A;  4ID0 A;  2KUC A;  2EC4 A;  3IV4 A;  1A2L A;  2CAI A;  4K2X A;  3NZN A;  3MSZ A;  4HSC X;  3CSJ A;  3KZQ A;  1GH2 A;  2K19 A;  3CSI A;  5J4U A;  2DIY A;  3ED3 A;  3IAM 2;  1GWC A;  1FO5 A;  4K7O A;  2MZC A;  2XPE A;  5CRW A;  4E8E A;  3QDN A;  4MMM A;  11GS A;  3S9F A;  5JCW A;  1GLP A;  3EU3 A;  4KDY A;  5COH A;  2WZ9 A;  2FWG A;  2HZE B;  3DA3 A;  2A2P A;  2JZT A;  1Z6M A;  1M7T A;  20GS A;  2C0E A;  2XHF A;  5LD0 A;  3L0I A;  2IWT A;  3L9U A;  4ML1 A;  2MMN A;  2NPB A;  2DJ2 A;  3O76 A;  2P5R A;  3KP9 A;  1W89 A;  2TRX A;  3TKP A;  2V6O A;  4Z2R A;  1B8X A;  2YN1 A;  5DDL A;  1PX6 A;  2HNL A;  4EE0 A;  2VCX A;  1SL1 B;  5KEJ A;  3F6F A;  1DBY A;  1V58 A;  1YO7 A;  4LLR A;  4MJB A;  3LJR A;  1V98 A;  1PKZ A;  2R4V A;  5AGY A;  2X8G A;  3F3R A;  3L9V A;  2WDU A;  2E2G A;  1ZYQ B;  2FCH A;  4YZC A;  1X9S B;  4HUA A;  4FH8 A;  3DML A;  1EP7 A;  4NHW A;  3FEU A;  4ZB6 A;  4FYB A;  4ZL7 A;  1M9B A;  2DLX A;  4MP4 A;  1WJK A;  4GF0 A;  4EIQ A;  1V2A A;  5DAL B;  3DXB A;  2HGK A;  4O5Q A;  1F3A A;  2N5B A;  2H0H A;  3DWV A;  3TJJ A;  3PR8 A;  2R0P A;  2PPT A;  2JSZ A;  3LXT A;  5KN2 A;  4JED A;  1WMJ A;  2CVD A;  4DWL A;  2FA4 A;  2DJ0 A;  1NHY A;  3PIN A;  2QSI A;  4XS6 A;  3VPT A;  3DD3 A;  4HEA 2;  3TKR A;  1GUH A;  2DMM A;  2VIM A;  5KN0 A;  3LW9 A;  2O87 A;  4MPG A;  1IYI A;  4TN8 A;  5ECQ B;  3FKF A;  3NOF A;  2IIY A;  3L9S A;  3A2W A;  4GTU A;  4TR4 A;  5GST A;  4RQR A;  1U87 A;  4FYU A;  2BL8 A;  2HSH A;  1W4V A;  1X9W B;  1PL1 A;  22GS A;  4HQS A;  1GSU A;  2VCT A;  3ZFL A;  2HYX A;  4YKF A;  4DSS B;  3ZIJ A;  2BMX A;  5E59 A;  1J08 A;  1K0M A;  5G2Z A;  2VCQ A;  1M0U A;  5IOW A;  3MAK A;  3GTU A;  5HR0 A;  1TTZ A;  1USB A;  1WOU A;  1VF3 A;  2C0F A;  4AJ8 A;  2WCI A;  5DJM A;  1XIY A;  3EE2 A;  1Z3E A;  4BVY B;  3EC3 A;  3VWV A;  5CRE A;  3L78 A;  5HR1 A;  4LA1 A;  1U3I A;  2YJH A;  3GST A;  4RUV A;  2M72 A;  1TXX A;  2X4A A;  3F8U A;  1XW6 A;  4GSS A;  2OKA A;  4ZBB A;  2H74 A;  1FVK A;  1PN0 A;  4O92 A;  4RI6 A;  3G7I A;  1O6J A;  2DJ3 A;  4OFM A;  4XTS A;  2GZP A;  4HZ2 A;  4F0B A;  4V2L A;  2LV3 A;  4KUN A;  4WBJ A;  4N0V A;  4Z2U A;  1K3Y A;  3HXS A;  2E0Q A;  3SWL A;  3TCO A;  2YP6 A;  3KTL A;  2L6D A;  4MK3 A;  5CP1 A;  3ZRD A;  3LYK A;  3BCK A;  6GSV A;  2X64 A;  3KGK A;  2WS2 A;  2K6V A;  2QA1 A;  3F4S A;  4MH2 A;  3G7Y A;  2NDO A;  2PUK C;  4NMU A;  4GCI A;  4L0U A;  5IMC A;  3FHK A;  4Z7X A;  2C0G A;  1TK0 B;  1XG8 A;  3ZTL A;  4XRA A;  2VL2 C;  3GX0 A;  1F2E A;  3GUR A;  1MDK A;  1TP9 A;  3MDK A;  1BG5 A;  4ECJ A;  3D22 A;  3CXG A;  1ZYE A;  3LOR A;  1TKD B;  4OD7 A;  3LJ2 A;  2QGM A;  4Q9V A;  4WKW A;  1ZCP A;  1MEK A;  2IMD A;  5ABR A;  4X1U A;  2X8C A;  2LTK A;  3VPQ A;  3IAS 1;  4HOJ A;  2GQK A;  1XWC A;  2WB9 A;  4YZ9 A;  2I3Y A;  5GSS A;  4QQ7 A;  4TR1 A;  5J41 A;  1RW1 A;  1W3S A;  5HFK A;  4WF5 A;  1X5D A;  2YAN A;  5C04 A;  4IJ3 A;  2HLS A;  2O89 A;  2RUE A;  4OCF A;  1NW2 A;  1FOV A;  2KP2 A;  2OA7 A;  1U5K A;  3QAG A;  2LNS A;  3TRQ A;  5B8A A;  2DJK A;  4IN0 A;  1TI3 A;  1X5C A;  2MMO A;  1LU4 A;  4KSO A;  1H4O A;  3FZ5 A;  2B6M A;  4TXV A;  4EL1 A;  3Q6O A;  2HRA A;  4WF4 A;  4MJA A;  3AJF A;  2H73 A;  4MNN A;  1V9W A;  1YKC A;  3LFL A;  3DEX A;  4IP6 A;  1VF2 A;  2EIQ A;  1XVW A;  1ZMA A;  1PGT A;  1Z5Y E;  1HNB A;  1XOA A;  3VFI A;  3Q74 A;  3GKX A;  3SDJ A;  4PL4 A;  4CW9 A;  4GRF A;  1PN9 A;  3US3 A;  2R37 A;  3VA9 A;  2A2S A;  4TOP A;  3WT1 A;  1A8Y A;  2A2D A;  4HDE A;  1K0D A;  1Y6E A;  2I4A A;  4G19 A;  4U6R A;  3QD9 A;  5IO0 A;  2XC2 A;  4O1P A;  3D5J A;  2LKU A;  3J7Y b;  2R3X A;  3F6D A;  2GDR A;  3UBL A;  1Q98 A;  2J23 A;  4GST A;  4PQ1 A;  1A8L A;  2QSB A;  2OE1 A;  3F9U A;  2G2Q A;  2PGT A;  1F37 A;  2FUG 2;  4IJI A;  2I9H A;  4IHU A;  1PSQ A;  5JWR B;  2JAD A;  4PNF A;  3ZIV A;  2FWE A;  3G9B A;  4N30 A;  4NXI A;  4G0K A;  4ZIJ A;  2RAD A;  1H75 A;  16GS A;  1M2B A;  5BRT A;  2FHE A;  2LUS A;  1SYR A;  5EY6 A;  1VGL A;  5ELG A;  2VD1 A;  4HU7 A;  4XS1 A;  2V6E A;  4YAP A;  2HE3 A;  3FK8 A;  4USS A;  2VM1 A;  4K5R A;  1BYE A;  3HVX A;  2OBI A;  4ZL9 A;  13GS A;  5HFI A;  2HZF A;  3HKR A;  3KH7 A;  4N0Z A;  4PGT A;  4EF0 A;  1WE0 A;  1KNG A;  2H75 A;  18GS A;  1M3I A;  3GHA A;  3TJK A;  2RUF A;  3WD6 A;  3QR6 A;  5CYY A;  2B5Y A;  2JU5 A;  3KP8 A;  3EYT A;  2LJK A;  1MDI A;  4BVX A;  4G10 A;  2B5E A;  4ZB9 A;  3UIW A;  3A2V A;  2R0G A;  4O5R A;  2VL9 A;  1M99 A;  3CSH A;  2LRT A;  2B1K A;  4I2T A;  1XW5 A;  2VL2 A;  3FZ9 A;  1MD3 A;  4TW5 A;  4GXT A;  1GSS A;  4KB3 A;  1UN2 A;  2L6C A;  3ZZX A;  3VK9 A;  5ECK B;  3ZLP A;  4D73 B;  5CAX A;  2A2R A;  4KCE A;  1XWA A;  2F51 A;  2JB2 A;  1AAZ A;  5IMA A;  3TDG A;  2DBC A;  2HXK A;  2Z9S A;  1NHO A;  1JLW A;  5A4V A;  4POM A;  1XWK A;  3W8J A;  1MDJ A;  2IPA A;  4TR0 A;  4ACS A;  1T1V A;  2A4H A;  4MZB A;  5IMF A;  2PER A;  3F63 A;  1HNC A;  1R5A A;  1S3C A;  2J9H A;  3IXR A;  2CX3 A;  1CQH A;  2CV4 A;  5BMU A;  1JLV A;  3FR6 A;  2V6K A;  2IMF A;  3PPU A;  2AYT A;  1OE7 A;  2AB6 A;  1R7H A;  5JWO B;  1X0R A;  2H01 A;  1NM3 A;  4YZD A;  1T4Z A;  1OC9 B;  2E7P A;  1G6W A;  4ZBA A;  4NPB A;  5JCU A;  5F06 A;  3P2A A;  1SJI A;  1GTA A;  1EOH A;  3ZML A;  2YV9 A;  4KGI A;  2MMA A;  1PX7 A;  1R26 A;  2BTO T;  4NV5 A;  2YCD A;  4K7N A;  4X4J A;  4Q5F A;  5FWG A;  4OAU C;  3C73 A;  2GSS A;  3ZVJ A;  3F4M A;  3EU4 A;  2DML A;  5JWQ B;  2FNO A;  1FG4 A;  2KP1 A;  1VRS D;  2QKE A;  2HRF A;  1M2D A;  2GTU A;  5LNK 1;  4Q5N A;  2A4V A;  2KKM A;  1J0F A;  2ZW3 A;  5F0G A;  1QGV A;  2AJQ B;  3HCZ A;  4O7H A;  4ZBD A;  4NHZ A;  2JAC A;  3C71 A;  3EMP A;  3FNB A;  1VF4 A;  3APS A;  3IAS 2;  1SJ8 A;  5G5F A;  4K0G A;  4YQM A;  1S3R A;  1DSB A;  3H8Q A;  2YFB A;  2YWN A;  2OJL A;  3H1N A;  1B9X C;  1GTU A;  2L59 A;  5AIX A;  1EV9 A;  1G7O A;  1GSY A;  4HJ2 A;  4YH2 A;  1FAA A;  3O6T A;  2QZG A;  3GL3 A;  3U5R E;  5E4W A;  2RM6 A;  1OYJ A;  2QA2 A;  2WRT A;  4JBB A;  3UAR A;  4IS0 A;  3KD0 A;  5G31 A;  4ZL8 A;  3FR9 A;  3IC4 A;  1XW9 A;  2NVL A;  3KMN A;  4EUY A;  2L5O A;  1I5G A;  4ULX A;  4HS1 A;  1JHB A;  3ERW A;  3QOU A;  10GS A;  1UA5 A;  1AIU A;  3PGT A;  4AF2 A;  1MTC A;  1WP0 A;  1U6T A;  1IYH A;  2MMZ A;  2VUP A;  1GTB A;  5ECN B;  5DCG A;  2L57 A;  5IPG A;  1YJ6 A;  3TJG A;  3KH9 A;  4I8B A;  2WJU A;  4BA7 A;  3GKN A;  1PD2 1;  1SL2 B;  4MCU A;  2YFA A;  2LEG A;  5J5N A;  1T00 A;  2H72 A;  3WGE A;  2KOK A;  3LJ1 A;  4JE1 A;  5INY A;  2HI7 A;  3TOT A;  5LNK e;  4EC0 A;  5B6M A;  1ERU A;  2H8L A;  3KCM A;  2N5A A;  2ES7 A;  4XRD A;  5B7C A;  2LST A;  4ZB8 A;  4DVC A;  2HT9 A;  1XFL A;  2MJF B;  5D8I A;  3HJO A;  4OFN A;  5ECS A;  5EVO A;  3I9V 1;  1S3A A;  3ZYW A;  1VF1 A;  1TU7 A;  1FVJ A;  4XS4 B;  3UIT A;  2JB3 A;  3HZ8 A;  4XIH A;  1THX A;  1X5E A;  2XBQ A;  1TRW A;  2V1M A;  2R2J A;  2OAD A;  2C1Y A;  1N2A A;  3RHC A;  1JZD A;  3GKK A;  3ZIT A;  1GSE A;  1EOG A;  3UVT A;  2WFC A;  2H1G A;  2REM A;  6GSW A;  1XZO A;  4L5L A;  3GRX A;  3APO A;  4ICY A;  1GP1 A;  2C3Q A;  3LSZ A;  1XPV A;  3A3T A;  2YJ7 A;  2V41 A;  3G7J A;  4K0N A;  2HSM A; 
#chains in the Genus database with same CATH homology
 1T3B A;  5L71 A;  2YZU A;  1O8W A;  5A5K A;  1RQM A;  3EIN A;  4A5P A;  2DJ1 A;  4CDO A;  2DKI A;  1ZYP A;  3O3T A;  3JCM L;  2LS5 A;  2X8H A;  6GST A;  4F9Z A;  3D6I A;  4CY8 A;  2ON5 A;  3IDV A;  3ME8 A;  4I97 A;  5CRD A;  1Y25 A;  2H0I A;  5D9V A;  1ERV A;  2VO4 A;  1AW9 A;  2P5Q A;  3FR3 A;  3HY2 A;  4POK A;  3IAM 1;  4GSN A;  1K0B A;  5IMD A;  3D4T A;  5D9T A;  1EV4 A;  4TXO A;  5ID2 B;  5IQY A;  2OE3 A;  4ISD A;  4TRX A;  1QFN A;  1AQV A;  2RM5 A;  3DRN A;  3GNJ A;  5B6N A;  1BQ7 A;  2H70 A;  3V1W A;  1XVQ A;  1PQN A;  1O85 A;  1EP8 A;  1MD4 A;  4Q5Q A;  1YEP A;  2L4Q A;  1THO A;  5IOX A;  1TRS A;  2O7K A;  3F4R A;  2V1C C;  3GFK A;  1AUC A;  1K0O A;  4AJ7 A;  3C8E A;  1A0F A;  4WET A;  5ECP B;  5IMZ A;  1YF0 A;  3EMX A;  4V2N A;  5ELA A;  5H5R A;  4OAV B;  4L8E A;  2HSY A;  1PMT A;  1FW1 A;  1ZYN A;  2AHE A;  1UC7 A;  3VWW A;  3ERG A;  3E3E A;  3P7X A;  4JR4 A;  1AQX A;  1JZW A;  4I2U A;  4HFV A;  1GUK A;  1O81 A;  4KSM A;  4N11 A;  4MJC A;  2XPD A;  4AGS A;  1HNA A;  3QPM A;  3TRP A;  1XBS A;  1YQ1 A;  2QC7 A;  1AQW A;  8GSS A;  2G0F A;  1N8J A;  3RPN A;  4IVF A;  1T7P B;  3RHB A;  4GQC A;  1F3B A;  3TJB A;  1GNE A;  3OR5 A;  4D73 A;  4E8H A;  3TKS E;  2VAF A;  4Z2T A;  5A4W A;  4G75 A;  3VWU A;  3QMX A;  4QL9 A;  4IW9 A;  3KEB A;  1EZK A;  1BED A;  1E2Y A;  4N10 A;  3UAP A;  2WGR A;  3GUS A;  1J9B A;  2VL3 A;  2HRK A;  5IM9 A;  2H1D A;  3MNG A;  4HEA 1;  5IPH A;  2MBT A;  5H5Q A;  3CYN A;  1TRU A;  1DE2 A;  1T4Y A;  2CAZ B;  2DIZ A;  1GTI A;  4ILF A;  1U3A A;  1YZX A;  4Z7H A;  2IMI A;  3ZFB A;  4YKG A;  2QGV A;  1XWB A;  2VCW A;  1V57 A;  2TIR A;  4YQU A;  3NIV A;  4ZXG A;  2JSY A;  1YY7 A;  4DEJ A;  17GS A;  4PUR A;  1ON4 A;  2RLI A;  1HYU A;  1O7U A;  3GV1 A;  3IOS A;  4FIW A;  4V1A g;  4IKH A;  3VI5 A;  3N9J A;  5ECO B;  3F3Q A;  3UJ1 A;  4Q5R A;  1SK2 A;  4JRR A;  4GWR A;  2DJJ A;  4K5S A;  1GSQ A;  2FWF A;  3W6G A;  3FMW A;  5ECH B;  2GGT A;  5CO3 A;  2DC5 A;  3DIE A;  3IE3 A;  2HZE A;  3GH9 A;  4MPF A;  2YWI A;  3IBH A;  4GQF A;  12GS A;  1C72 A;  3DKS A;  2C4J A;  3VWX A;  4EO3 A;  2AV4 A;  4PL3 A;  4G76 A;  1KTE A;  2E8G A;  2O85 A;  2C3T A;  4H86 A;  2IMK A;  4RI7 A;  7GSS A;  4EKZ A;  3TKQ A;  3LJ0 A;  2JAE A;  2H1A A;  1M9A A;  4OFT A;  3IK9 A;  4ECI A;  1A24 A;  2ZNM A;  1XOB A;  2I1U A;  4P3Y B;  3WYW A;  5GAP D;  5J3R A;  4X0X A;  1CQG A;  4IP1 A;  4K1F A;  4KF9 A;  3HDC A;  2WUL A;  3BD2 A;  3QAW A;  3LEF A;  3VUR A;  1KBN A;  2P31 A;  4J57 E;  3RPP A;  2P0G A;  3CBU A;  1T8E B;  3ME7 A;  1EGO A;  5H5S A;  3I9V 2;  2YOI A;  5B8B A;  4IBP A;  1HQO A;  2R6K A;  4MA9 A;  2B7K A;  1GRX A;  4KW6 A;  2B5X A;  3CTF A;  4POB A;  1EEJ A;  3GA4 A;  3KM6 A;  4G9H A;  3DA4 A;  3FRC A;  1B4P A;  5JCG A;  1LBK A;  1SK1 A;  3E9J B;  6GSU A;  3M1G A;  3M0F A;  4ML6 A;  5DAL A;  2IFQ B;  2DSA A;  1OKT A;  2PMT A;  2RIO A;  1PA3 A;  1FB0 A;  2FLS A;  4HI7 A;  2C8U A;  1SEN A;  3R2Q A;  1URM A;  2PN8 A;  2GS3 A;  2I81 A;  3ZL5 A;  4CY6 A;  3U6V A;  5CRH A;  1TK5 B;  2F8F A;  1ILO A;  5ECI B;  4LMV A;  2C0D A;  3IK7 A;  3UOM A;  3AY8 A;  3IHG A;  1DUG A;  1YDK A;  4BL7 B;  1EGR A;  2AAW A;  4F03 A;  2GSQ A;  3CRU A;  3BJ5 A;  5F8B A;  3P23 A;  1ZZY A;  4L5O A;  2K8S A;  1YF1 A;  1ZL9 A;  2FGX A;  1ML6 A;  3WT2 A;  1R5P A;  4CHS A;  5EL8 A;  4MAB A;  4KH7 A;  2F3M A;  2GSR A;  4MF7 A;  3IA1 A;  2CQ9 A;  4J2F A;  2KHP A;  4AS3 A;  4ZIL A;  5FHI A;  5HR3 A;  2K18 A;  4LL1 B;  2ALB A;  4DSS A;  4HQZ A;  3RBT A;  3DYR A;  3FZA A;  2L5L A;  3DGQ A;  3DO9 A;  1WRY A;  1TI1 A;  3TOU A;  2GZZ A;  2CAQ A;  2FY6 A;  4PQI A;  3EUR A;  1K3O A;  4KE3 A;  4G0L A;  4BVY A;  3HA9 A;  3UBK A;  14GS A;  4XS4 A;  4O32 A;  3ZVJ D;  3LXZ A;  2B3S A;  2ON7 A;  3TRX A;  4BVX B;  1FB6 A;  2XBI A;  2IN3 A;  1PRX A;  1GLQ A;  5AIS A;  5C00 A;  3MIX A;  5A4U A;  2VD0 A;  1AXD A;  3M8N A;  2LNT A;  5G30 A;  3TKS C;  5J9B A;  3DVW A;  3IHQ A;  2FUG 1;  1F6M C;  3QFB C;  5LCZ A;  2XTR A;  1XXU A;  1OKD A;  2F8A A;  2C3N A;  5KN3 A;  4EVM A;  3FZ4 A;  1GUL A;  4OCE A;  3C1R A;  3WGD A;  5J9C A;  3M9K A;  1TRV A;  4MF6 A;  4WXT A;  1SKS B;  4PL5 A;  2H6X A;  2IL3 A;  3CMI A;  3GKM A;  1JFU A;  4F0C A;  5KOW A;  2V32 A;  3R3E A;  4KND A;  5HQP A;  1SD9 A;  1XCC A;  1QMV A;  2OAC A;  1Z7P A;  1SK0 A;  1SJZ A;  4GLT A;  1TDI A;  2B7J A;  4OO4 A;  4XCS A;  2PVO C;  1V40 A;  5DAK B;  1JZO A;  5HGI A;  2MBS A;  2LRC A;  2D2Z A;  5FT3 A;  4I6X A;  4OO5 A;  5DQY A;  5ID2 A;  4KX4 A;  5KN1 A;  2X99 A;  3GMF A;  3KTB A;  4V2M A;  1X9M B;  1OC3 A;  4NAX A;  3ERF A;  1OAZ A;  4POL A;  2F66 B;  2H71 A;  1DE1 A;  2H76 A;  2CA8 A;  2OE0 A;  2GLR A;  1SKR B;  3GH6 A;  1GUM A;  3UEM A;  3LGC A;  5D73 A;  4O1O A;  4F82 A;  3MWH A;  3HVV A;  2IP6 A;  3IC8 A;  4L0W A;  1QUW A;  3JSB A;  5IIZ A;  5D93 A;  4LL4 B;  3IPZ A;  2JZR A;  5DJL A;  3K8N A;  1TK8 B;  1TOF A;  2VLU A;  5ECM B;  4OWY A;  1SJ6 A;  2FWH A;  4TKY A;  2H66 A;  1ACV A;  5EPF A;  3TJF A;  4PXO A;  3CTG A;  1E6B A;  5HFG A;  4YAV A;  4RQX A;  4KAE A;  1WWJ A;  3LWA A;  5IMV A;  2VCV A;  3H79 A;  5D96 A;  4EIP A;  1O8X A;  3Q19 A;  4FO5 A;  2P22 B;  4J56 E;  4ECB A;  3TB2 A;  3C7M A;  2CZ2 A;  5DVB A;  2GQL A;  4DSR A;  2CVB A;  2OBK A;  1NSW A;  4KA0 A;  4K2D A;  4G2E A;  3MYD A;  4MF5 A;  5CRG A;  1WPI A;  3Q8D A;  5AN1 A;  2GZY A;  1QQ2 A;  4PUF C;  3IRA A;  3VI7 A;  2PBJ A;  2JZS A;  3A5I A;  5DCH A;  1SD8 A;  19GS A;  4ECC A;  3UL3 A;  4MDC A;  3P90 A;  3HVS A;  2H19 A;  3H93 A;  3F4T A;  2NTO A;  1K0C A;  4HJM A;  1A2J A;  3KIJ A;  2LRN A;  3EWL A;  3D4M A;  1WIK A;  2JL4 A;  3KXO A;  1R4W A;  3APQ A;  1FHE A;  2CZ3 A;  1B9Y C;  1RK4 A;  2C80 A;  3ISO A;  2GST A;  4AS2 A;  1OVN A;  4PTS A;  5G5E A;  3HYP A;  2VOC A;  4K8M A;  1PKW A;  1QK8 A;  3ZRE A;  5GAN D;  2F6M B;  4O5U A;  2HFD A;  4NV2 A;  3FYG A;  4G0I A;  2GQM A;  2O8V B;  2R0C A;  3LQ7 A;  3GYK A;  1BJX A;  2N5F A;  4MZW A;  2ZRR A;  3BBY A;  3TKS A;  3L0H A;  1KEB A;  2PU9 C;  5IO2 A;  3FW2 A;  2F9S A;  2IME A;  1ABA A;  3GTU B;  2LJR A;  2L1L B;  1A2M A;  3RAZ A;  4I1T A;  3A5W A;  5CNW A;  1GL8 A;  4JZQ A;  2GT5 A;  1G6Y A;  2DKH A;  1M2A A;  2PVQ A;  2ZCT A;  1GSF A;  3BOA A;  2K9F A;  3UMA A;  2V2G A;  4PX1 A;  5ECR B;  1OC8 A;  2YWO A;  3SBC A;  3HJM A;  4IQA A;  3P8W A;  4LMW A;  3DVX A;  2XTQ A;  3HD5 A;  1ERW A;  1O73 A;  2VM2 A;  1K0N A;  4BPY A;  3F0I A;  4JCV E;  4V1A p;  1G7E A;  6GSX A;  1BX9 A;  1Z6N A;  1XWG A;  3BCI A;  2VCZ A;  1ERT A;  2AUV A;  3I43 A;  5G1K A;  1ZGN A;  4JR6 A;  1YEX A;  2EIR A;  5F05 A;  1GNW A;  1HD2 A;  2YPM A;  2YNX A;  3LG6 A;  4PQH A;  3TUE A;  2LQQ A;  1K0A A;  3M3M A;  6GSS A;  3I69 A;  3EVI A;  2IFQ A;  4BWS A;  3L4N A;  2H30 A;  4KDX A;  2CVK A;  3D0Z A;  2H0G A;  4EDZ A;  4X43 A;  1TU8 A;  2L4C A;  2BJX A;  5HR2 A;  5DQS A;  3TGZ A;  3GN3 A;  1U88 A;  4WR4 A;  2NBS A;  1K3L A;  1A0R P;  1OC9 A;  3KJY A;  4XHM A;  3N5O A;  4BL7 A;  3FY7 A;  1PL2 A;  3J7Y k;  3GSS A;  2CX4 A;  6GSY A;  4TXO B;  4PUA A;  2YWM A;  1EEM A;  3GIX A;  3IR4 A;  1SU9 A;  3ZMK A;  3HHV A;  1SKW B;  4MH3 A;  2K8V A;  4TR3 A;  2JB1 A;  1F9M A;  1QXH A;  1OE8 A;  2M46 A;  3GL5 A;  3M9J A;  3HJP A;  2A2C A;  4K7I A;  1S3D A;  2E2M A;  1LJR A;  2H1B A;  4HZ4 A;  4TVE A;  1B48 A;  2R5G A;  1TW9 A;  2FD3 A;  5AIV A;  2X49 A;  2MYG A;  4TR1 B;  4WEY A;  3W8S A;  3QAV A;  9GSS A;  1TJD A;  3VLN A;  3C1S A;  3WGX A;  2XMX A;  1Z9H A;  4K6X A;  5ENU A;  5F07 A;  4DSQ A;  4PNG A;  5GZZ B;  4IGJ A;  1A23 A;  3RDW A;  2GT6 A;  2EIO A;  1UVZ A;  4WBR D;  2KLX A;  1FOH A;  4YQV A;  4KDU A;  4NWY A;  4QL7 A;  3Q18 A;  4JU5 A;  5D9X A;  4Z7G A;  2IJY A;  3H4K A;  2PWJ A;  2VLV A;  2UZ8 A;  2VLT A;  2B1L A;  3GX8 A;  3CRT A;  4K9Z A;  2H6Y A;  1Z7R A;  4OMV A;  4MLY A;  1G0T A;  1GSD A;  3HZ4 A;  2FA8 A;  5ECL B;  2RII A;  1EWX A;  1ST9 A;  1B4Q A;  2M80 A;  4MJE A;  4GXZ A;  4EXJ A;  2CT6 A;  3KMO A;  2TRC P;  2LQO A;  2GVP A;  1AC1 A;  5D9W A;  3UVH A;  4I5Q A;  3E0U A;  3I6A A;  3FBV A;  1YKA A;  4AJ6 A;  4EDY A;  1JZR A;  1SL0 B;  2LJA A;  3A2X A;  2HRN A;  3PH9 A;  1ZOF A;  3QCP A;  4BWQ A;  2YZH A;  1I9D A;  5DBQ A;  5KOX A;  1SYX A;  2H6Z A;  5G1L A;  4KCA A;  4IEL A;  5DAK A;  1Q4J A;  3QFA C;  4HU9 A;  4WR5 A;  4IQ1 A;  1BAY A;  4FQU A;  4F2I A;  2YV7 A;  4FYC A;  2ZUP A;  3LYP A;  4MZC A;  3EPT A;  3D21 A;  4ID0 A;  2KUC A;  2EC4 A;  3IV4 A;  1A2L A;  2CAI A;  4K2X A;  3NZN A;  3MSZ A;  3CSJ A;  3KZQ A;  1GH2 A;  2K19 A;  3CSI A;  5J4U A;  2DIY A;  3ED3 A;  3IAM 2;  1GWC A;  1FO5 A;  4K7O A;  2MZC A;  2XPE A;  5CRW A;  4E8E A;  3QDN A;  4MMM A;  11GS A;  3S9F A;  5JCW A;  1GLP A;  3EU3 A;  4KDY A;  5COH A;  2WZ9 A;  2FWG A;  2HZE B;  3DA3 A;  2A2P A;  2JZT A;  1Z6M A;  1M7T A;  20GS A;  2C0E A;  2XHF A;  5LD0 A;  3L0I A;  2IWT A;  3L9U A;  4ML1 A;  2MMN A;  2NPB A;  2DJ2 A;  3O76 A;  2P5R A;  3KP9 A;  1W89 A;  2TRX A;  3TKP A;  2V6O A;  4Z2R A;  1B8X A;  2YN1 A;  5DDL A;  1PX6 A;  2HNL A;  4EE0 A;  2VCX A;  1SL1 B;  5KEJ A;  3F6F A;  1DBY A;  1V58 A;  1YO7 A;  4LLR A;  4MJB A;  3LJR A;  1V98 A;  1PKZ A;  2R4V A;  5AGY A;  2X8G A;  3F3R A;  3L9V A;  2WDU A;  2E2G A;  1ZYQ B;  2FCH A;  4YZC A;  1X9S B;  4HUA A;  4FH8 A;  3DML A;  1EP7 A;  4NHW A;  3FEU A;  4ZB6 A;  4FYB A;  4ZL7 A;  1M9B A;  2DLX A;  4MP4 A;  1WJK A;  4GF0 A;  4EIQ A;  1V2A A;  5DAL B;  3DXB A;  4O5Q A;  1F3A A;  2N5B A;  2H0H A;  3DWV A;  3TJJ A;  3PR8 A;  2R0P A;  2PPT A;  2JSZ A;  3LXT A;  5KN2 A;  4JED A;  1WMJ A;  2CVD A;  4DWL A;  2FA4 A;  2DJ0 A;  1NHY A;  3PIN A;  2QSI A;  4XS6 A;  3VPT A;  3DD3 A;  4HEA 2;  3TKR A;  1GUH A;  2DMM A;  2VIM A;  5KN0 A;  3LW9 A;  2O87 A;  4MPG A;  1IYI A;  4TN8 A;  5ECQ B;  3FKF A;  3NOF A;  2IIY A;  3L9S A;  3A2W A;  4GTU A;  4TR4 A;  5GST A;  4RQR A;  1U87 A;  4FYU A;  2HSH A;  1W4V A;  1X9W B;  1PL1 A;  22GS A;  4HQS A;  1GSU A;  2VCT A;  3ZFL A;  2HYX A;  4YKF A;  4DSS B;  3ZIJ A;  2BMX A;  5E59 A;  1J08 A;  1K0M A;  5G2Z A;  2VCQ A;  1M0U A;  5IOW A;  3MAK A;  3GTU A;  5HR0 A;  1TTZ A;  1USB A;  1WOU A;  1VF3 A;  2C0F A;  4AJ8 A;  2WCI A;  5DJM A;  1XIY A;  3EE2 A;  1Z3E A;  4BVY B;  3EC3 A;  3VWV A;  5CRE A;  3L78 A;  5HR1 A;  4LA1 A;  1U3I A;  2YJH A;  3GST A;  4RUV A;  2M72 A;  1TXX A;  2X4A A;  3F8U A;  1XW6 A;  4GSS A;  2OKA A;  4ZBB A;  2H74 A;  1FVK A;  1PN0 A;  4O92 A;  4RI6 A;  3G7I A;  1O6J A;  2DJ3 A;  4OFM A;  4XTS A;  2GZP A;  4HZ2 A;  4F0B A;  4V2L A;  2LV3 A;  4KUN A;  4WBJ A;  4N0V A;  4Z2U A;  1K3Y A;  3HXS A;  2E0Q A;  3SWL A;  3TCO A;  2YP6 A;  3KTL A;  2L6D A;  4MK3 A;  5CP1 A;  3ZRD A;  3LYK A;  3BCK A;  6GSV A;  2X64 A;  3KGK A;  2WS2 A;  2K6V A;  2QA1 A;  3F4S A;  4MH2 A;  3G7Y A;  2NDO A;  2PUK C;  4NMU A;  4GCI A;  4L0U A;  5IMC A;  3FHK A;  4Z7X A;  2C0G A;  1TK0 B;  3ZTL A;  4XRA A;  2VL2 C;  3GX0 A;  1F2E A;  3GUR A;  1MDK A;  1TP9 A;  3MDK A;  1BG5 A;  4ECJ A;  3D22 A;  3CXG A;  1ZYE A;  3LOR A;  1TKD B;  4OD7 A;  3LJ2 A;  4Q9V A;  4WKW A;  1ZCP A;  1MEK A;  2IMD A;  5ABR A;  4X1U A;  2X8C A;  2LTK A;  3VPQ A;  3IAS 1;  4HOJ A;  2GQK A;  1XWC A;  2WB9 A;  4YZ9 A;  2I3Y A;  5GSS A;  4QQ7 A;  4TR1 A;  5J41 A;  1RW1 A;  1W3S A;  5HFK A;  4WF5 A;  1X5D A;  2YAN A;  5C04 A;  4IJ3 A;  2HLS A;  2O89 A;  2RUE A;  4OCF A;  1NW2 A;  1FOV A;  2KP2 A;  2OA7 A;  1U5K A;  3QAG A;  2LNS A;  3TRQ A;  5B8A A;  2DJK A;  4IN0 A;  1TI3 A;  1X5C A;  2MMO A;  1LU4 A;  4KSO A;  1H4O A;  3FZ5 A;  2B6M A;  4TXV A;  4EL1 A;  3Q6O A;  2HRA A;  4WF4 A;  4MJA A;  3AJF A;  2H73 A;  4MNN A;  1V9W A;  1YKC A;  3LFL A;  3DEX A;  4IP6 A;  1VF2 A;  2EIQ A;  1XVW A;  1ZMA A;  1PGT A;  1Z5Y E;  1HNB A;  1XOA A;  3VFI A;  3Q74 A;  3GKX A;  3SDJ A;  4PL4 A;  4CW9 A;  4GRF A;  1PN9 A;  3US3 A;  2R37 A;  3VA9 A;  2A2S A;  4TOP A;  3WT1 A;  1A8Y A;  2A2D A;  4HDE A;  1K0D A;  1Y6E A;  2I4A A;  4G19 A;  4U6R A;  3QD9 A;  5IO0 A;  2XC2 A;  4O1P A;  3D5J A;  2LKU A;  3J7Y b;  2R3X A;  3F6D A;  2GDR A;  3UBL A;  1Q98 A;  2J23 A;  4GST A;  4PQ1 A;  1A8L A;  2OE1 A;  3F9U A;  2G2Q A;  2PGT A;  1F37 A;  2FUG 2;  4IJI A;  2I9H A;  4IHU A;  1PSQ A;  5JWR B;  2JAD A;  4PNF A;  3ZIV A;  2FWE A;  3G9B A;  4N30 A;  4NXI A;  4G0K A;  4ZIJ A;  1H75 A;  16GS A;  1M2B A;  5BRT A;  2FHE A;  2LUS A;  1SYR A;  5EY6 A;  1VGL A;  5ELG A;  2VD1 A;  4HU7 A;  4XS1 A;  2V6E A;  4YAP A;  2HE3 A;  3FK8 A;  4USS A;  2VM1 A;  4K5R A;  1BYE A;  3HVX A;  2OBI A;  4ZL9 A;  13GS A;  5HFI A;  2HZF A;  3HKR A;  3KH7 A;  4N0Z A;  4PGT A;  4EF0 A;  1WE0 A;  1KNG A;  2H75 A;  18GS A;  3GHA A;  3TJK A;  2RUF A;  3WD6 A;  3QR6 A;  5CYY A;  2B5Y A;  2JU5 A;  3KP8 A;  3EYT A;  2LJK A;  1MDI A;  4BVX A;  4G10 A;  2B5E A;  4ZB9 A;  3UIW A;  3A2V A;  2R0G A;  4O5R A;  2VL9 A;  1M99 A;  3CSH A;  2LRT A;  2B1K A;  4I2T A;  1XW5 A;  2VL2 A;  3FZ9 A;  1MD3 A;  4TW5 A;  4GXT A;  1GSS A;  4KB3 A;  1UN2 A;  2L6C A;  3ZZX A;  3VK9 A;  5ECK B;  3ZLP A;  4D73 B;  5CAX A;  2A2R A;  4KCE A;  1XWA A;  2F51 A;  2JB2 A;  1AAZ A;  5IMA A;  3TDG A;  2DBC A;  2HXK A;  2Z9S A;  1NHO A;  1JLW A;  5A4V A;  4POM A;  1XWK A;  3W8J A;  1MDJ A;  2IPA A;  4TR0 A;  4ACS A;  1T1V A;  2A4H A;  4MZB A;  5IMF A;  2PER A;  3F63 A;  1HNC A;  1R5A A;  1S3C A;  2J9H A;  3IXR A;  2CX3 A;  1CQH A;  2CV4 A;  5BMU A;  1JLV A;  3FR6 A;  2V6K A;  2IMF A;  3PPU A;  2AYT A;  1OE7 A;  2AB6 A;  1R7H A;  5JWO B;  1X0R A;  2H01 A;  1NM3 A;  4YZD A;  1T4Z A;  1OC9 B;  2E7P A;  1G6W A;  4ZBA A;  4NPB A;  5JCU A;  5F06 A;  3P2A A;  1SJI A;  1GTA A;  1EOH A;  3ZML A;  2YV9 A;  4KGI A;  2MMA A;  1PX7 A;  1R26 A;  2BTO T;  4NV5 A;  2YCD A;  4K7N A;  4X4J A;  4Q5F A;  5FWG A;  4OAU C;  3C73 A;  2GSS A;  3ZVJ A;  3F4M A;  3EU4 A;  2DML A;  5JWQ B;  2FNO A;  1FG4 A;  2KP1 A;  1VRS D;  2QKE A;  2HRF A;  1M2D A;  2GTU A;  5LNK 1;  4Q5N A;  2A4V A;  2KKM A;  1J0F A;  5F0G A;  1QGV A;  2AJQ B;  3HCZ A;  4O7H A;  4ZBD A;  4NHZ A;  2JAC A;  3C71 A;  3EMP A;  1VF4 A;  3APS A;  3IAS 2;  1SJ8 A;  5G5F A;  4K0G A;  4YQM A;  1DSB A;  3H8Q A;  2YFB A;  2YWN A;  2OJL A;  3H1N A;  1B9X C;  1GTU A;  2L59 A;  5AIX A;  1EV9 A;  1G7O A;  1GSY A;  4HJ2 A;  4YH2 A;  1FAA A;  3O6T A;  3GL3 A;  3U5R E;  5E4W A;  2RM6 A;  1OYJ A;  2QA2 A;  2WRT A;  4JBB A;  3UAR A;  4IS0 A;  3KD0 A;  5G31 A;  4ZL8 A;  3FR9 A;  3IC4 A;  1XW9 A;  2NVL A;  3KMN A;  4EUY A;  2L5O A;  1I5G A;  4ULX A;  4HS1 A;  1JHB A;  3ERW A;  3QOU A;  10GS A;  1UA5 A;  1AIU A;  3PGT A;  4AF2 A;  1MTC A;  1WP0 A;  1U6T A;  1IYH A;  2MMZ A;  2VUP A;  1GTB A;  5ECN B;  5DCG A;  2L57 A;  5IPG A;  1YJ6 A;  3TJG A;  3KH9 A;  4I8B A;  2WJU A;  4BA7 A;  3GKN A;  1PD2 1;  1SL2 B;  4MCU A;  2YFA A;  2LEG A;  5J5N A;  1T00 A;  2H72 A;  3WGE A;  2KOK A;  3LJ1 A;  4JE1 A;  5INY A;  2HI7 A;  3TOT A;  5LNK e;  4EC0 A;  5B6M A;  1ERU A;  2H8L A;  3KCM A;  2N5A A;  2ES7 A;  4XRD A;  5B7C A;  2LST A;  4ZB8 A;  4DVC A;  2HT9 A;  1XFL A;  2MJF B;  5D8I A;  3HJO A;  4OFN A;  5ECS A;  5EVO A;  3I9V 1;  1S3A A;  3ZYW A;  1VF1 A;  1TU7 A;  1FVJ A;  4XS4 B;  3UIT A;  2JB3 A;  3HZ8 A;  4XIH A;  1THX A;  1X5E A;  2XBQ A;  1TRW A;  2V1M A;  2R2J A;  2OAD A;  2C1Y A;  1N2A A;  3RHC A;  1JZD A;  3GKK A;  3ZIT A;  1GSE A;  1EOG A;  3UVT A;  2WFC A;  2H1G A;  2REM A;  6GSW A;  1XZO A;  4L5L A;  3GRX A;  3APO A;  4ICY A;  1GP1 A;  2C3Q A;  3LSZ A;  1XPV A;  3A3T A;  2YJ7 A;  2V41 A;  3G7J A;  4K0N A;  2HSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...