3KP9A

Structure of a bacterial homolog of vitamin k epoxide reductase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
259
Chain Sequence
QRHSRLILAILAGLGSLLTAYLTYTKLTEQPAAFCTGSDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood coagulation,oxidoreductase
molecule keywords VKORC1/thioredoxin domain protein
publication title Structure of a bacterial homologue of vitamin K epoxide reductase.
pubmed doi rcsb
source organism Synechococcus sp.
total genus 71
structure length 259
sequence length 264
ec nomenclature ec 1.1.4.2: Transferred entry: 1.17.4.5.
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3kp9A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kp9A02
17GSA 3F4SA 5EL8A 1GTUA 3GKNA 1ERTA 1Z7RA 1UC7A 3NIVA 4YAPA 3LWAA 3EINA 2C0GA 5DVBA 4YQUA 3TJFA 5G1KA 2TRXA 3HVXA 3D22A 4CHSA 5ECMB 1G6WA 5IOXA 3KTBA 2NVLA 1SD8A 1SL2B 3UBKA 2L6DA 2DJKA 1GSSA 2CZ2A 1X9MB 2CAIA 4GCIA 4MH2A 3C8EA 3J7Yb 4XS6A 3HVVA 3WGEA 1ZCPA 2DJ1A 5KN2A 1EEJA 1HYUA 4D73B 2HSYA 4V2NA 4MP4A 4TR1A 2FA4A 1KEBA 4OCEA 1UA5A 5GSTA 5KN3A 5DJMA 2VL9A 3ZMLA 1RW1A 4IQAA 2CVDA 1BQ7A 2X8HA 2FWFA 2N5BA 4MZBA 2H72A 1O7UA 3H1NA 5D8IA 3CXGA 4IS0A 3ISOA 1FOVA 4L8EA 2GQMA 6GSXA 1V9WA 5DALA 3H4KA 5ECOB 2LNSA 3GURA 2PU9C 1E6BA 3IXRA 2GT5A 4HDEA 4Q5QA 5ECRB 4YQMA 3EC3A 3RPPA 4DSSB 2L5LA 1WE0A 3H93A 2H0HA 5J3RA 5FT3A 4WKWA 2P0GA 1ML6A 2CVBA 2EC4A 2PN8A 5ELGA 1OAZA 2RM5A 4KA0A 5HR1A 3TKQA 3FY7A 1THXA 3HJOA 4EF0A 1DE1A 4V2MA 4V1Ap 5HR0A 2HI7A 1J9BA 2YP6A 4TXOB 3UOMA 1W4VA 5J5NA 5FHIA 3FZ5A 1FB0A 3TGZA 1YJ6A 2KP1A 3DYRA 2LUSA 1TRWA 2C1YA 1R7HA 2AAWA 4KUNA 1JFUA 5DQSA 1J08A 1XBSA 3DEXA 2H0GA 2IFQB 2AJQB 4G19A 1O73A 3TJJA 2MBTA 4NHZA 4YQVA 3NOFA 1F2EA 4EDYA 3KGKA 3TKPA 1Z9HA 4QL7A 1TK0B 2LRNA 5E59A 2V6KA 5LCZA 5KN1A 1TRSA 3L9UA 3MWHA 4XRAA 2YWNA 7GSSA 3TRQA 2B1LA 1B4QA 4MLYA 1QFNA 4FIWA 1JLVA 4K0NA 1EGRA 3GNJA 3Q18A 1PA3A 4O5RA 5JWOB 4JEDA 4GWRA 1ON4A 3L9SA 3LJRA 4NPBA 1M0UA 5CRDA 1PRXA 3EE2A 3WGDA 3EVIA 1TU7A 1XVQA 4TXVA 4Q5FA 5CP1A 5CRHA 1X9WB 2GTUA 2IWTA 1FG4A 3FR6A 1X9SB 3LQ7A 2HE3A 2R2JA 3BBYA 2GSRA 2FA8A 2WGRA 1XIYA 2VL2C 4AJ7A 4PNGA 2VCQA 6GSSA 4POMA 1AIUA 4P3YB 5A4WA 2F51A 3GL3A 2OE3A 4MPGA 1K0CA 2G2QA 5A4UA 4MMMA 4KGIA 2B3SA 1OC8A 2ZCTA 3F0IA 2VLUA 1PKWA 1WRYA 2VD1A 4EKZA 2LV3A 3M0FA 1QUWA 1YEPA 2OE1A 1TOFA 4XS1A 2FWEA 2LSTA 1SKRB 1Q4JA 2VM2A 4WXTA 3ME7A 1JZOA 1T1VA 4EUYA 4IBPA 5G31A 2DJ2A 3GSSA 2V1MA 4BA7A 1VF1A 1GTBA 3FR9A 3EYTA 2GSSA 5COHA 2K8VA 4KDYA 5JCWA 1Z3EA 3HA9A 3P8WA 2F3MA 3LYPA 3ZIJA 1AQWA 1A2JA 1MTCA 2RM6A 1EOHA 3HHVA 1AAZA 4LA1A 3WT2A 4NV2A 2CX3A 3VLNA 1QXHA 1SJZA 2P5QA 5EY6A 5AN1A 2K9FA 4MK3A 2VCWA 4GSSA 2DJ0A 5EPFA 2J9HA 4CDOA 1BX9A 6GSWA 1Z6MA 1S3CA 2MBSA 1GWCA 2FD3A 2WS2A 2IMKA 1H4OA 1XWAA 5CNWA 4ZIJA 1KBNA 4N0ZA 4WR4A 5KN0A 2DLXA 4HOJA 2HNLA 5C04A 3GN3A 1T00A 4TR0A 3VWVA 2YV9A 1ST9A 3D21A 3QOUA 1Y25A 1GNWA 2AV4A 1VF3A 3CSHA 4AJ6A 1FO5A 4F82A 1TKDB 4L5LA 2R37A 2YJHA 2V2GA 3IOSA 4KCAA 1DE2A 5G2ZA 5CREA 4ULXA 4ECBA 1N8JA 1AC1A 4FO5A 3GIXA 2CV4A 3RDWA 2H75A 3A2VA 1MDKA 1LBKA 1RQMA 4PURA 3F4RA 4JZQA 3D4TA 1EP8A 1PX7A 1EEMA 2R4VA 3PR8A 3Q74A 2O89A 3IR4A 1GLQA 4ACSA 2HSHA 1ERVA 1M99A 1G0TA 3FZAA 1PGTA 4N0VA 4ML6A 3FYGA 2LQOA 4KNDA 1MD4A 4MCUA 2XBQA 2K6VA 1YF0A 22GSA 2DMLA 2YZUA 2CX4A 4HEA2 1V40A 4OCFA 1F3BA 4BVXA 4GTUA 1TRVA 2OACA 3F3RA 2KLXA 1SJ6A 5ELAA 3QFBC 2AHEA 3BCIA 5HQPA 4I6XA 4ZXGA 3WGXA 1GP1A 1PMTA 3GTUA 3OR5A 2H19A 3KIJA 4MZCA 5J4UA 5J9BA 5GSSA 1ABAA 1BYEA 4OFNA 2B6MA 4GQFA 2HXKA 1EP7A 2JADA 11GSA 3LFLA 4HZ4A 3KMOA 5ECPB 1VRSD 1CQGA 2KOKA 2DMMA 3Q19A 3UAPA 3P2AA 4DEJA 1X0RA 3QAVA 4ILFA 3M9JA 4WBJA 1C72A 1XWBA 2F8AA 2L6CA 2H6YA 1X5EA 2TIRA 2V32A 4MDCA 3K8NA 5J9CA 2PERA 2FUG2 4JBBA 4L0UA 4OO4A 1F37A 2C8UA 2IPAA 2IMDA 2N5AA 3GKKA 4ZL9A 3EMXA 3QD9A 4F0BA 2ES7A 2E2MA 5IO2A 14GSA 4MJCA 1Z7PA 1IYHA 1K3LA 1FVJA 3LG6A 2C0FA 2R5GA 4HU7A 1OKDA 3WYWA 4BWQA 1YY7A 4MH3A 3UJ1A 4E8HA 2HYXA 2L57A 4JE1A 4XHMA 3GX8A 1Q98A 4EE0A 1A8YA 2VAFA 2YJ7A 4AJ8A 2GT6A 5IMCA 4NXIA 2WFCA 2YZHA 3RPNA 3P7XA 4IP6A 5IM9A 5EVOA 2H70A 3DVWA 1UVZA 1GSQA 4IGJA 3U6VA 3ZZXA 2GDRA 4FYCA 3BOAA 3GKMA 5AGYA 2RUFA 2YNXA 3HXSA 5IOWA 2H71A 4QQ7A 2VLVA 1HNBA 2MMOA 5ID2A 4TOPA 3CMIA 5ENUA 3HJMA 4WF4A 4ML1A 1OYJA 5F06A 1FVKA 5DJLA 4IN0A 1OKTA 4POBA 1GUMA 1RK4A 1YZXA 4ZBAA 2HZEA 1OC3A 2H01A 3IA1A 2H30A 2M80A 3HDCA 2EIOA 3L0HA 5ECLB 2L4QA 4TRXA 4O32A 2C3TA 3APSA 3Q6OA 4K2DA 4V1Ag 2C3QA 2VIMA 1GSYA 1OC9A 1V58A 1I5GA 1WMJA 3DD3A 1S3AA 4FH8A 2BMXA 2IMEA 4PX1A 4JRRA 4MPFA 3D4MA 5ECNB 13GSA 3DWVA 4KH7A 3IE3A 2OBKA 3VWXA 4MABA 1B9YC 2X99A 4K9ZA 2FLSA 1NSWA 2VL2A 3IK9A 4F0CA 3TRXA 2CT6A 2LTKA 1WP0A 3KEBA 1CQHA 2JL4A 2IMFA 2DJ3A 2H1AA 4YAVA 5LNKe 2PWJA 3E0UA 2LS5A 1U88A 2A4VA 2HZFA 4WEYA 3IAM2 4IKHA 4X0XA 1EWXA 2H0IA 2C4JA 2PUKC 5AIVA 3ZFLA 3ZTLA 5D9WA 4HQZA 4PQIA 1S3DA 1GSUA 2AB6A 5H5RA 2XC2A 2HT9A 3ZITA 2DBCA 3DKSA 1B4PA 2F8FA 3D5JA 3FKFA 5JCUA 1SU9A 5A5KA 4ZB6A 1MEKA 3KJYA 1TW9A 2FGXA 3DMLA 3HCZA 1SK0A 1G7OA 3G7IA 1EGOA 4EVMA 4IELA 5GZZB 4G10A 4IW9A 2WDUA 4J57E 2LJAA 1K0MA 3EMPA 1GTIA 5ECQB 3CSIA 16GSA 1TXXA 3QPMA 6GSYA 1M9BA 1GULA 2E2GA 2KP2A 2OBIA 1ZYQB 2GZPA 5F8BA 1YKAA 3G9BA 2GVPA 3CRTA 3L78A 5IO0A 1J0FA 5JCGA 2KHPA 4POKA 3A2XA 2Z9SA 2MMAA 3WT1A 3LEFA 4RQXA 1WJKA 2GSQA 2GQLA 4WETA 1GTAA 2OE0A 2CQ9A 3ZVJD 1A8LA 4TKYA 3FR3A 1N2AA 5CYYA 2YOIA 4IHUA 1Y6EA 2WJUA 3KCMA 1EV4A 3MNGA 2VLTA 5ECSA 3HVSA 2IN3A 1TI3A 5B6NA 3WD6A 4KW6A 2H6ZA 2FWHA 3QAGA 1THOA 2VCVA 5B6MA 4D73A 2LEGA 1VF2A 4TR4A 3VWWA 2K8SA 4OD7A 4ZBDA 4GRFA 2RUEA 3FW2A 4XIHA 4I2TA 1GSDA 2M46A 4E8EA 1ZOFA 1QQ2A 1JZRA 1ZMAA 1SKSB 3O6TA 3ERFA 1SYRA 4MF6A 3H79A 1XOAA 2NBSA 3LXZA 5IPGA 4KE3A 2KUCA 4J2FA 1SL1B 1T4YA 2FWGA 1YEXA 1FAAA 2NPBA 4X43A 1DBYA 4DVCA 1MDIA 1A2MA 4PXOA 3KD0A 2QSIA 3O76A 1DUGA 4I5QA 5L71A 1I9DA 4RI6A 3F6DA 1NW2A 1T4ZA 2DIYA 5INYA 4KSOA 3GFKA 2MMZA 5D73A 3GYKA 2LKUA 1GSEA 4EC0A 5J41A 3DVXA 1YKCA 3RBTA 3F9UA 1T3BA 3PGTA 1GUHA 4GQCA 2I4AA 2I3YA 4TR1B 1LU4A 1K0OA 2LQQA 1M2AA 1GSFA 5IMFA 4F2IA 3QDNA 4GLTA 2C3NA 3VPTA 2I9HA 4TXOA 5HFIA 2B7KA 1VGLA 2JSZA 3APQA 1XWGA 5D96A 5ID2B 5DDLA 1V2AA 2PVOC 1R5AA 1KTEA 4LMWA 5DALB 5HFKA 1XW9A 2R3XA 2PVQA 2HZEB 1YDKA 3TKSA 3C73A 2XPEA 1T7PB 3TOUA 2GLRA 1XFLA 2X64A 4OO5A 3UL3A 1SYXA 4HQSA 4KB3A 1F6MC 4ECJA 3GX0A 3TB2A 4PGTA 5JWRB 4FYUA 1Z5YE 5F0GA 2VL3A 1SENA 2I1UA 3BJ5A 4LLRA 3UARA 1PX6A 3M9KA 1AUCA 2B5YA 1PN9A 4EDZA 3VK9A 3ME8A 4NV5A 20GSA 1XPVA 3GRXA 3GL5A 4N11A 1JHBA 3TJKA 3MDKA 1XCCA 1MD3A 3MSZA 2IL3A 12GSA 3UVHA 5HR3A 1O6JA 3C71A 3LGCA 3C7MA 2LJRA 3E9JB 5ECHB 3C1RA 3M1GA 2GQKA 2C80A 5C00A 3KXOA 1W89A 3BD2A 19GSA 4KAEA 3MAKA 2JU5A 3LXTA 4GSTA 2IMIA 5DQYA 1JZDA 1GLPA 3O3TA 2ON7A 6GSUA 1SK1A 3ERGA 5F05A 4N10A 2VO4A 4RQRA 3W6GA 2O8VB 4ZILA 9GSSA 1EOGA 2NDOA 3NZNA 3A3TA 2PBJA 2H73A 2YANA 1XWKA 3P90A 3HD5A 3L4NA 1TK8B 3SBCA 3ZYWA 4HZ2A 1U87A 2PMTA 1ILOA 1ZL9A 1GRXA 4ZL8A 3EU3A 4PQ1A 4AF2A 1R26A 2VCXA 4OFTA 5CAXA 1HD2A 1UN2A 3TJBA 2B1KA 1GNEA 4JU5A 4F9ZA 4EXJA 3KM6A 18GSA 1YQ1A 3A5WA 5IMDA 5KEJA 1A0FA 2GSTA 4KCEA 3LSZA 5E4WA 1QGVA 1X5DA 2EIRA 2VOCA 1OE7A 3GSTA 5DAKA 2C0EA 3GUSA 3FZ4A 4YH2A 2X8GA 2CZ3A 2JZTA 4K1FA 1AW9A 3IPZA 3KZQA 3UVTA 1TJDA 2FCHA 1V98A 4PUFC 4XRDA 1GL8A 3I6AA 3ZIVA 1PL2A 1NHOA 2WULA 3QCPA 4BVYA 2HLSA 4MZWA 2A2RA 3H8QA 4LL4B 2IJYA 2VCTA 1WWJA 2WRTA 2E7PA 1K0DA 3HZ8A 3IRAA 3ZL5A 1K0BA 3M8NA 4HI7A 4MJBA 2MMNA 3F6FA 3HZ4A 4K7OA 3TCOA 1SK2A 1PKZA 4DSRA 4AGSA 8GSSA 5B7CA 2YWMA 4NHWA 1ZYEA 3KH9A 2HRFA 4ECCA 2YV7A 4BPYA 4K6XA 3LORA 2YPMA 2ZUPA 4XS4A 3I43A 5B8BA 5D93A 2TRCP 5G5EA 2QKEA 4NAXA 4TN8A 3S9FA 5IMZA 3EWLA 4Q5NA 1SKWB 4JR4A 5A4VA 4BL7A 3D6IA 2V41A 1G7EA 5H5SA 2L5OA 3IAS2 2HFDA 2AYTA 4IJ3A 2HRNA 2FY6A 1YF1A 2WZ9A 2CA8A 1X5CA 3V1WA 2WCIA 1GH2A 2FNOA 1QMVA 3IK7A 4MJAA 3IBHA 2YCDA 4Z7XA 4OMVA 2H8LA 4ZB9A 1BG5A 3TJGA 2OA7A 3ERWA 4I8BA 1SD9A 2AUVA 1ACVA 2X8CA 1AQVA 5HR2A 3W8JA 1B48A 3CTGA 5GAND 3HKRA 1B9XC 4G2EA 3I9V2 4XCSA 1AXDA 2O7KA 1JLWA 4HS1A 2K18A 3IV4A 2L59A 2MZCA 10GSA 5G30A 2BTOT 4G9HA 5DBQA 1HNCA 3W8SA 5FWGA 2YWOA 1AQXA 1FB6A 4J56E 3CYNA 3F63A 4OWYA 3E3EA 1G6YA 2VUPA 1XW5A 1WPIA 2DSAA 3FRCA 1PSQA 1A23A 1BJXA 2MYGA 2ZNMA 3UEMA 4HJ2A 3TDGA 4NMUA 2WB9A 2H66A 5AISA 4HJMA 1O81A 5LD0A 2CAQA 2VM1A 3FHKA 1A24A 2P31A 2H1DA 1XXUA 1XWCA 3JCML 1VF4A 3KMNA 4ZL7A 1DSBA 1TI1A 1KNGA 3UMAA 5F07A 5G5FA 3CSJA 3GMFA 2F9SA 4JR6A 1Z6NA 1ZGNA 2H6XA 5G1LA 4WBRD 2B5XA 3DGQA 2XPDA 3R2QA 1EZKA 3QMXA 3US3A 2CVKA 4ECIA 4QL9A 1IYIA 2RLIA 2RIIA 5H5QA 4HU9A 4Q5RA 3M3MA 3UIWA 3LYKA 3TKSE 3GTUB 1M2BA 1A2LA 3G7YA 4TW5A 1URMA 3TRPA 4XTSA 4I2UA 3C1SA 4PUAA 4L5OA 3RAZA 4CW9A 2OKAA 1K3OA 3G7JA 4KDUA 1XOBA 4TR3A 4L0WA 4RUVA 4F03A 1M7TA 3F3QA 1OVNA 5GAPD 5DCHA 4OFMA 1OE8A 3VI7A 3HY2A 5JWQB 4PNFA 2FHEA 5HFGA 1O8WA 4ZB8A 4K7IA 2E0QA 2JSYA 1LJRA 1B8XA 3VFIA 4EO3A 2R6KA 5IIZA 1NHYA 3ZRDA 3IDVA 1R5PA 1ERWA 3FEUA 2ALBA 4I97A 4WR5A 5D9VA 3SWLA 1TK5B 4GXZA 5IQYA 4N30A 1R4WA 3FZ9A 3TKRA 1PL1A 3ZLPA 1H75A 2GZYA 1XZOA 3VURA 1MDJA 4GSNA 5CRWA 5ECKB 2L4CA 1EV9A 2H1BA 2OJLA 4K7NA 5DAKB 4O7HA 4RI7A 3APOA 1F3AA 3J7Yk 2B7JA 2H1GA 2O85A 3DIEA 3CBUA 3HYPA 4DSQA 1V57A 4LL1B 4BWSA 3GV1A 1HQOA 4X1UA 4IVFA 6GSVA 3ZREA 4K8MA 3QFAC 4KX4A 2NTOA 2XBIA 3KP8A 1BAYA 2A2SA 2GGTA 3VI5A 5AIXA 2M72A 1K0AA 1TU8A 4DSSA 2DC5A 2JZSA 2C0DA 2QGVA 4POLA 2YWIA 5D9TA 5ABRA 1ZZYA 3A2WA 4FYBA 3N5OA 2ON5A 5DCGA 5B8AA 2QC7A 2IIYA 1HNAA 5CRGA 3TUEA 1K0NA 3L9VA 2GS3A 4IQ1A 5D9XA 5IPHA 2BJXA 4MF5A 1USBA 2H74A 3EU4A 5IMVA 2H76A 1XW6A 1M9AA 1U6TA 2JZRA 2YN1A 4XS4B 4V2LA 1T8EB 4ISDA 3VPQA 2B5EA 1O8XA 3KP9A 2GZZA 3FK8A 2OADA 1FHEA 2IFQA 3D0ZA 1PD21 2VD0A 4WF5A 1TRUA 2PPTA 4KSMA 2I81A 1K3YA 1F9MA 2V6OA 3GKXA 3PH9A 1OC9B 4K0GA 4MF7A 4EL1A 3QR6A 2O87A 4O92A 4ZBBA 4HUAA 1TDIA 2LRCA 5IMAA 1NM3A 2EIQA 3EURA 1ERUA 1TP9A 3IC4A 3ZMKA 6GSTA 4H86A 3RHCA 2VCZA 2G0FA 3KTLA 2LRTA 3DXBA 2PGTA 1JZWA 3ED3A 2JACA 3U5RE 4IP1A 3GA4A 1A0RP 1SL0B 4KDXA 3I69A 1U3IA 1PQNA 1TTZA 3GH6A 2J23A 4MA9A 2DJJA 3RHBA 1E2YA 3TOTA 1U3AA 1WOUA 3KH7A 4IJIA 3HJPA 1SJIA 3VWUA 3N9JA 2N5FA 3UBLA 4PQHA 5CO3A 3GHAA 3BCKA 1O85A 2D2ZA 4MJEA 2P5RA 1QK8A 2REMA 3CRUA 3F8UA 4ID0A 3F4TA 1M2DA 3ZFBA 1FW1A 2DIZA 1GUKA 3ZVJA 2LJKA 2LNTA 4GF0A 1BEDA 1XVWA 2XHFA 3DRNA 4LMVA 3PINA 3CTFA 3QAWA 1WIKA 3TKSC 4NWYA 4TVEA 3IHQA 5ECIB 3AY8A 3GH9A
chains in the Genus database with same CATH superfamily
17GSA 3F4SA 2V6EA 5EL8A 1GTUA 3GKNA 3FBVA 1ERTA 1Z7RA 1UC7A 3NIVA 4YAPA 3UITA 3LWAA 3EINA 2C0GA 5DVBA 4YQUA 3TJFA 5G1KA 2TRXA 3HVXA 3D22A 4CHSA 5ECMB 1G6WA 5IOXA 3KTBA 2NVLA 1SD8A 1SL2B 4K2XA 3UBKA 2L6DA 2DJKA 1GSSA 2CZ2A 1X9MB 2CAIA 4GCIA 4MH2A 3P23A 3C8EA 3J7Yb 5BRTA 4XS6A 3HVVA 1FOHA 3WGEA 1ZCPA 4O1PA 2DJ1A 2L1LB 5KN2A 1EEJA 1HYUA 4D73B 2HSYA 4V2NA 4MP4A 4TR1A 2FA4A 1KEBA 4OCEA 1UA5A 5GSTA 5KN3A 5DJMA 2VL9A 3ZMLA 1RW1A 4IQAA 2CVDA 1BQ7A 2X8HA 2FWFA 2N5BA 4MZBA 2H72A 1O7UA 4K5SA 3H1NA 5D8IA 3CXGA 4IS0A 3ISOA 4YZDA 1FOVA 4L8EA 2GQMA 6GSXA 1V9WA 5DALA 3H4KA 5ECOB 2LNSA 3GURA 4KF9A 2PU9C 1E6BA 3IXRA 2GT5A 4HDEA 4Q5QA 5ECRB 4YQMA 3EC3A 3RPPA 4DSSB 4O5QA 2L5LA 1WE0A 3H93A 2H0HA 5J3RA 4G76A 5FT3A 4WKWA 2P0GA 1ML6A 2CVBA 4PL5A 1PN0A 2EC4A 2PN8A 5ELGA 1OAZA 4BIKA 2RM5A 4KA0A 5HR1A 3TKQA 3FY7A 1THXA 3HJOA 4EF0A 1DE1A 4V2MA 4V1Ap 5HR0A 2QGMA 2HI7A 1J9BA 2YP6A 4TXOB 3UOMA 1W4VA 4G75A 5J5NA 5FHIA 3FZ5A 1FB0A 3TGZA 1YJ6A 2KP1A 3DYRA 2LUSA 1TRWA 2C1YA 4YKGA 1R7HA 2AAWA 4KUNA 1JFUA 5DQSA 1J08A 1XBSA 3DEXA 2H0GA 2IFQB 2AJQB 2E8GA 4HEA1 4G19A 4Z7HA 1O73A 3TJJA 2MBTA 4NHZA 1PFOA 4YQVA 2DKHA 3NOFA 1F2EA 4EDYA 3KGKA 3TKPA 1Z9HA 2ZW3A 4QL7A 1TK0B 2LRNA 5E59A 2V6KA 5LCZA 5KN1A 1TRSA 3L9UA 3MWHA 4XRAA 2YWNA 7GSSA 3TRQA 2B1LA 1B4QA 4MLYA 1QFNA 4FIWA 1JLVA 4K0NA 1EGRA 3GNJA 3Q18A 1PA3A 4O5RA 5JWOB 4JEDA 4GWRA 1ON4A 3L9SA 3EPTA 3LJRA 4NPBA 1M0UA 4YZCA 5CRDA 1PRXA 3EE2A 3WGDA 4PL3A 3EVIA 1TU7A 1XVQA 4TXVA 3DA3A 4Q5FA 5CP1A 5CRHA 1X9WB 2GTUA 2IWTA 1FG4A 3FR6A 1X9SB 3LQ7A 2HE3A 2R2JA 3BBYA 2GSRA 2FA8A 2WGRA 1XIYA 2VL2C 4AJ7A 4PNGA 2VCQA 6GSSA 4POMA 1AIUA 4P3YB 5A4WA 2CAZB 2F51A 3GL3A 2OE3A 4MPGA 1K0CA 2G2QA 5A4UA 4MMMA 4KGIA 2B3SA 1OC8A 2ZCTA 3F0IA 2RLDA 2R0PA 2VLUA 1PKWA 1WRYA 2VD1A 2P22B 4EKZA 1M3IA 2LV3A 3M0FA 1QUWA 1YEPA 2OE1A 1TOFA 4XS1A 2FWEA 2LSTA 1SKRB 1Q4JA 2VM2A 4WXTA 3ME7A 1JZOA 1T1VA 4EUYA 4IBPA 5G31A 2DJ2A 3GSSA 2V1MA 4BA7A 1VF1A 1GTBA 3FR9A 3EYTA 2GSSA 5COHA 2K8VA 4KDYA 5JCWA 2HRKA 1Z3EA 3HA9A 3P8WA 2F3MA 3LYPA 3ZIJA 1AQWA 4BVYB 1A2JA 1MTCA 2RM6A 1EOHA 3HHVA 1AAZA 4LA1A 3WT2A 4NV2A 2CX3A 3VLNA 1QXHA 1SJZA 2P5QA 5EY6A 3B55A 5AN1A 2K9FA 4MK3A 2VCWA 4GSSA 2DJ0A 5EPFA 2J9HA 4CDOA 1BX9A 6GSWA 1Z6MA 1S3CA 2MBSA 1GWCA 2FD3A 2WS2A 2IMKA 1H4OA 1XWAA 5LNK1 5CNWA 4ZIJA 1KBNA 4N0ZA 4WR4A 5KN0A 2DLXA 4HOJA 2HNLA 5C04A 4O5UA 3GN3A 1T00A 4TR0A 3VWVA 2YV9A 1ST9A 3D21A 3QOUA 1Y25A 1GNWA 2AV4A 1VF3A 4BL7B 3CSHA 4AJ6A 1FO5A 4F82A 1TKDB 4L5LA 2R37A 1SJ8A 2V2GA 2YJHA 3IOSA 4KCAA 1DE2A 5G2ZA 5CREA 3IAM1 4CY6A 4ULXA 4ECBA 1N8JA 1AC1A 4FO5A 3GIXA 2CV4A 3RDWA 2H75A 3A2VA 1MDKA 1LBKA 1RQMA 4PURA 3F4RA 4JZQA 3D4TA 1EP8A 1PX7A 1EEMA 2R4VA 3PR8A 3Q74A 2O89A 3IR4A 1GLQA 4ACSA 2HSHA 1ERVA 4EIPA 1M99A 1G0TA 3FZAA 1PGTA 4N0VA 4ML6A 3FYGA 2LQOA 4KNDA 1MD4A 4MCUA 2XBQA 2K6VA 1YF0A 22GSA 2DMLA 2YZUA 2CX4A 4HEA2 1V40A 4OCFA 1F3BA 4BVXA 4GTUA 1TRVA 2OACA 3F3RA 2KLXA 1SJ6A 5ELAA 3QFBC 2AHEA 3BCIA 5HQPA 4I6XA 4ZXGA 3WGXA 4EIQA 1GP1A 1PMTA 3GTUA 3OR5A 2H19A 3KIJA 3MIXA 4MZCA 5J4UA 5J9BA 5GSSA 1ABAA 1BYEA 4OFNA 2B6MA 4GQFA 2HXKA 1EP7A 2JADA 11GSA 3LFLA 4HZ4A 3KMOA 5ECPB 1VRSD 1CQGA 2KOKA 3SDJA 2DMMA 3Q19A 3UAPA 3P2AA 4DEJA 1X0RA 3QAVA 4ILFA 3M9JA 4WBJA 1C72A 1XWBA 2F8AA 2L6CA 2H6YA 2ZRRA 4AS2A 1X5EA 2TIRA 2V32A 4MDCA 3K8NA 5J9CA 2PERA 5HGIA 2FUG2 4JBBA 4L0UA 4OO4A 1F37A 1ZYPA 2C8UA 2IPAA 2IMDA 2JBWA 2N5AA 3GKKA 4ZL9A 3EMXA 3QD9A 4F0BA 2ES7A 2E2MA 5IO2A 2YFAA 14GSA 4MJCA 1Z7PA 1IYHA 3DO9A 1FVJA 1K3LA 2C0FA 2R5GA 3LG6A 4HU7A 1OKDA 3WYWA 4BWQA 1YY7A 4MH3A 3UJ1A 4E8HA 2HYXA 1JQOA 2L57A 4Z2RA 4JE1A 4XHMA 3GX8A 1Q98A 4EE0A 1A8YA 3FVVA 2VAFA 2YJ7A 4AJ8A 2GT6A 5IMCA 4NXIA 2WFCA 2YZHA 3RPNA 3P7XA 4IP6A 2F66B 5IM9A 5EVOA 2H70A 3DVWA 1UVZA 1GSQA 4IGJA 3U6VA 3ZZXA 2GDRA 4FYCA 3BOAA 3GKMA 5AGYA 2RUFA 2YNXA 3HXSA 5IOWA 2H71A 4QQ7A 2VLVA 1HNBA 2MMOA 5ID2A 4TOPA 3CMIA 5ENUA 2A4HA 3HJMA 4WF4A 4ML1A 1OYJA 5F06A 1FVKA 5DJLA 4IN0A 1OKTA 4POBA 1GUMA 1RK4A 1YZXA 4ZBAA 2HZEA 1OC3A 2H01A 3IA1A 2H30A 2M80A 3HDCA 2EIOA 3L0HA 5ECLB 2L4QA 3IHGA 4TRXA 3LJ0A 4O32A 2C3TA 3APSA 3Q6OA 4K2DA 4V1Ag 2C3QA 2VIMA 1GSYA 1OC9A 1V58A 1I5GA 1WMJA 3DD3A 1S3AA 4FH8A 2BMXA 2IMEA 4PX1A 4JRRA 4MPFA 3D4MA 5ECNB 13GSA 3DWVA 4KH7A 3IE3A 2OBKA 3VWXA 4MABA 1B9YC 2X99A 4K9ZA 2FLSA 1NSWA 2VL2A 3IK9A 4F0CA 3TRXA 2CT6A 2LTKA 1WP0A 3KEBA 1CQHA 2JL4A 2IMFA 2DJ3A 2H1AA 3VA9A 4YAVA 5LNKe 2PWJA 3E0UA 2LS5A 1U88A 3LJ2A 2A4VA 2HZFA 4WEYA 3IAM2 2A2DA 4IKHA 4X0XA 2UZ8A 1EWXA 2H0IA 2C4JA 2PUKC 5AIVA 3ZFLA 3ZTLA 5D9WA 4HQZA 4PQIA 1S3DA 4MNNA 1GSUA 4YZ9A 2AB6A 5H5RA 2XC2A 2HT9A 3ZITA 2DBCA 3DKSA 2XTRA 1B4PA 2F8FA 3D5JA 3FKFA 3R3EA 5JCUA 1SU9A 5A5KA 4ZB6A 2JB3A 1MEKA 3KJYA 4Q9VA 1TW9A 4G0KA 2FGXA 3DMLA 3HCZA 1SK0A 1G7OA 3G7IA 1EGOA 4EVMA 4IELA 5GZZB 4G10A 4IW9A 2FUG1 2WDUA 4J57E 2LJAA 1K0MA 3EMPA 1GTIA 5ECQB 3CSIA 16GSA 1TXXA 3QPMA 6GSYA 1M9BA 1GULA 2E2GA 2KP2A 2OBIA 1ZYQB 4AS3A 2GZPA 5F8BA 1YKAA 3G9BA 2GVPA 3CRTA 3L78A 5IO0A 1J0FA 5JCGA 2KHPA 2R0CA 4POKA 3A2XA 2Z9SA 2MMAA 3WT1A 2DKIA 3LEFA 4RQXA 1WJKA 2GSQA 2GQLA 4WETA 1GTAA 2OE0A 2CQ9A 3ZVJD 1A8LA 4TKYA 3FR3A 1N2AA 5CYYA 2YOIA 4IHUA 1Y6EA 2WJUA 3KCMA 1EV4A 3MNGA 2VLTA 5ECSA 3HVSA 2IN3A 4HSCX 1TI3A 5B6NA 3WD6A 4KW6A 2H6ZA 2FWHA 3QAGA 1THOA 2VCVA 5B6MA 4D73A 2LEGA 1VF2A 4TR4A 3VWWA 2K8SA 4X4JA 4OD7A 4ZBDA 4GRFA 2RUEA 3FW2A 4XIHA 4I2TA 1GSDA 2M46A 4E8EA 1ZOFA 1QQ2A 1JZRA 1ZMAA 1SKSB 3O6TA 3ERFA 1SYRA 4MF6A 2X49A 1XOAA 3H79A 2NBSA 3LXZA 5IPGA 4KE3A 2KUCA 4J2FA 1SL1B 1T4YA 2FWGA 1YEXA 1FAAA 2NPBA 4X43A 1DBYA 4DVCA 1MDIA 1A2MA 4PXOA 3KD0A 2QSIA 3O76A 1DUGA 4I5QA 5L71A 5KOXA 1I9DA 4RI6A 3F6DA 1NW2A 1T4ZA 3IAS1 2DIYA 5INYA 4KSOA 3GFKA 2MMZA 5D73A 3GYKA 2ETDA 2LKUA 1GSEA 4EC0A 5J41A 3DVXA 1YKCA 3RBTA 3F9UA 1T3BA 4Z7GA 3PGTA 1GUHA 2JAEA 2YFBA 4GQCA 2I4AA 2I3YA 4TR1B 1LU4A 1K0OA 2LQQA 1M2AA 1GSFA 5IMFA 4F2IA 4G0LA 3QDNA 4GLTA 2C3NA 3VPTA 4Z2TA 2I9HA 4TXOA 5HFIA 2B7KA 1VGLA 3I9V1 2JSZA 3APQA 1XWGA 5D96A 5ID2B 5DDLA 1V2AA 2PVOC 1R5AA 1KTEA 4LMWA 5DALB 5HFKA 1XW9A 2R3XA 2PVQA 2HZEB 1YDKA 3TKSA 3C73A 2XPEA 1T7PB 3TOUA 2GLRA 1XFLA 2X64A 4OO5A 3UL3A 1SYXA 4HQSA 4KB3A 1F6MC 4ECJA 3GX0A 3TB2A 4PGTA 5JWRB 4FYUA 1Z5YE 2QZGA 5F0GA 2GSCA 2VL3A 1SENA 2I1UA 3BJ5A 4LLRA 3UARA 1PX6A 3M9KA 1AUCA 2B5YA 2QA2A 4PTSA 1PN9A 4EDZA 3VK9A 3ME8A 4NV5A 20GSA 2MJFB 1XPVA 3GRXA 3GL5A 4N11A 1JHBA 3TJKA 3MDKA 1XCCA 4OAVB 1MD3A 3MSZA 2IL3A 12GSA 3UVHA 5HR3A 3CQFA 1O6JA 3C71A 3LGCA 3C7MA 2LJRA 3E9JB 5ECHB 3C1RA 3M1GA 2GQKA 2C80A 5C00A 1YO7A 3KXOA 1W89A 3BD2A 19GSA 4KAEA 3MAKA 2JU5A 3LXTA 4GSTA 2IMIA 5DQYA 1JZDA 2BL7A 1GLPA 3O3TA 2ON7A 6GSUA 1SK1A 3ERGA 5F05A 4N10A 2VO4A 4RQRA 3W6GA 2O8VB 4ZILA 9GSSA 1EOGA 2NDOA 3NZNA 3A3TA 4JCVE 2PBJA 2H73A 2YANA 1XWKA 3P90A 3HD5A 3L4NA 1TK8B 2X4AA 3SBCA 3ZYWA 3LJ1A 4HZ2A 1U87A 2PMTA 1ILOA 1ZL9A 1GRXA 4ZL8A 3EU3A 3FMWA 4PQ1A 4AF2A 1R26A 2VCXA 4OFTA 5CAXA 1HD2A 1UN2A 3TJBA 2B1KA 1GNEA 4JU5A 4F9ZA 4EXJA 3KM6A 18GSA 1YQ1A 3A5WA 5IMDA 5KEJA 1A0FA 2GSTA 4KCEA 3LSZA 1QGVA 1X5DA 2EIRA 2VOCA 5E4WA 1OE7A 1S3RA 3GSTA 5DAKA 2C0EA 3GUSA 3FZ4A 4YH2A 2X8GA 2CZ3A 2JZTA 4K1FA 1AW9A 3IPZA 3KZQA 3UVTA 1TJDA 2FCHA 1V98A 4PUFC 4XRDA 1GL8A 3I6AA 3ZIVA 1PL2A 1NHOA 2WULA 3QCPA 4BVYA 2HLSA 4MZWA 2A2RA 3H8QA 4LL4B 2IJYA 2VCTA 1WWJA 2WRTA 2E7PA 1K0DA 3HZ8A 3IRAA 3ZL5A 1K0BA 3M8NA 4HI7A 4MJBA 2MMNA 3F6FA 3HZ4A 4HFVA 3A5IA 4K7OA 3TCOA 1SK2A 1PKZA 4DSRA 4AGSA 8GSSA 4DWLA 5B7CA 2YWMA 4NHWA 1ZYEA 3KH9A 2HRFA 4ECCA 2YV7A 4BPYA 4K6XA 3LORA 3FNBA 2YPMA 2ZUPA 4XS4A 3AJFA 3I43A 3IC8A 5B8BA 5D93A 2FEFA 2TRCP 5G5EA 2QKEA 4NAXA 4TN8A 3S9FA 5IMZA 3EWLA 4Q5NA 1SKWB 4JR4A 5A4VA 4BL7A 3D6IA 2V41A 1XG8A 1G7EA 5H5SA 2L5OA 3IAS2 2HFDA 2AYTA 4IJ3A 2HRNA 2FY6A 1YF1A 2WZ9A 2CA8A 4PL4A 1X5CA 4GXTA 3V1WA 2WCIA 4USSA 1GH2A 2A2CA 2FNOA 1QMVA 3IK7A 4O1OA 4MJAA 3IBHA 2YCDA 4Z7XA 2K19A 2JB1A 4OMVA 2H8LA 4ZB9A 1BG5A 3TJGA 2OA7A 3ERWA 4I8BA 1SD9A 2AUVA 1ACVA 2X8CA 1AQVA 5HR2A 3W8JA 1B48A 3CTGA 5GAND 3HKRA 1B9XC 4G2EA 3I9V2 4XCSA 1AXDA 2O7KA 1JLWA 2XMXA 3L0IA 4HS1A 2K18A 3IV4A 2L59A 2MZCA 10GSA 5G30A 2BTOT 3DA4A 4G9HA 5DBQA 1HNCA 3W8SA 5FWGA 2YWOA 4A5PA 1AQXA 1FB6A 4J56E 3CYNA 3PPUA 3F63A 4OWYA 3Q8DA 3E3EA 1TDPA 1G6YA 1W3SA 2VUPA 4K5RA 1XW5A 1WPIA 2DSAA 3FRCA 1PSQA 1A23A 1BJXA 2MYGA 2ZNMA 3UEMA 4HJ2A 3TDGA 4NMUA 2WB9A 2H66A 5AISA 4HJMA 1O81A 2KKMA 4OAUC 5LD0A 2CAQA 2VM1A 3FHKA 1A24A 2P31A 2H1DA 1XXUA 1XWCA 3JCML 1VF4A 3KMNA 4ZL7A 1DSBA 1TI1A 1KNGA 3UMAA 5F07A 5G5FA 3CSJA 3GMFA 2F9SA 4JR6A 1Z6NA 1ZGNA 2H6XA 5G1LA 4WBRD 2B5XA 3DGQA 2XPDA 3R2QA 1EZKA 4BVXB 3QMXA 3US3A 2CVKA 4ECIA 4QL9A 1IYIA 2RLIA 2RIIA 5H5QA 4HU9A 4Q5RA 3M3MA 3UIWA 3LYKA 3TKSE 3GTUB 1M2BA 2HGKA 3HVNA 1A2LA 2RIOA 3G7YA 1URMA 4TW5A 3TRPA 1M3JA 4XTSA 4I2UA 3C1SA 2F6MB 4PUAA 4L5OA 3RAZA 4CW9A 2OKAA 1K3OA 3G7JA 4KDUA 1XOBA 3F4MA 4TR3A 4L0WA 4RUVA 4F03A 1M7TA 3F3QA 1OVNA 5GAPD 5DCHA 4OFMA 1OE8A 3VI7A 3HY2A 5JWQB 4PNFA 2FHEA 5HFGA 1O8WA 4ZB8A 4K7IA 2E0QA 2QA1A 2JSYA 1LJRA 1B8XA 4ICYA 3VFIA 4EO3A 2R6KA 5IIZA 1NHYA 3ZRDA 3IDVA 1R5PA 3MYDA 1ERWA 3FEUA 2ALBA 4I97A 4WR5A 5D9VA 3SWLA 1TK5B 4GXZA 5IQYA 4N30A 1R4WA 3FZ9A 3TKRA 1PL1A 3ZLPA 1H75A 2GZYA 1XZOA 3VURA 1MDJA 2HSMA 4GSNA 5CRWA 5ECKB 1ZYNA 2L4CA 1EV9A 2H1BA 2OJLA 4K7NA 5DAKB 4O7HA 4RI7A 3APOA 4U6RA 1F3AA 3J7Yk 2B7JA 2H1GA 2O85A 3DIEA 1U5KA 3CBUA 2HRAA 3HYPA 4DSQA 1V57A 4LL1B 4BWSA 3GV1A 1HQOA 4X1UA 4IVFA 6GSVA 3ZREA 4K8MA 3QFAC 4KX4A 2NTOA 2XBIA 3KP8A 1BAYA 2A2SA 2GGTA 3VI5A 5AIXA 2M72A 1K0AA 1TU8A 4DSSA 2DC5A 4YKFA 2JZSA 2C0DA 2QGVA 4POLA 2YWIA 5D9TA 5ABRA 1ZZYA 3A2WA 4FYBA 3N5OA 2ON5A 5DCGA 5B8AA 2QC7A 2IIYA 1HNAA 5CRGA 3TUEA 2V1CC 1K0NA 3L9VA 2GS3A 2R0GA 4IQ1A 5D9XA 5IPHA 2BJXA 4MF5A 1USBA 2H74A 3EU4A 5IMVA 2H76A 1XW6A 1M9AA 1U6TA 2JZRA 2YN1A 4XS4B 4V2LA 1T8EB 4ISDA 3VPQA 2B5EA 1O8XA 3KP9A 2GZZA 3FK8A 2OADA 2FU2A 1FHEA 2IFQA 3D0ZA 3JSBA 1PD21 2VD0A 4WF5A 1TRUA 2PPTA 4KSMA 2I81A 1K3YA 1F9MA 2V6OA 3GKXA 3PH9A 1OC9B 4K0GA 4MF7A 4EL1A 3QR6A 2O87A 4O92A 2IP6A 4ZBBA 4HUAA 1TDIA 2LRCA 5IMAA 1NM3A 2EIQA 3EURA 1ERUA 1TP9A 3IC4A 3ZMKA 6GSTA 4H86A 3RHCA 2VCZA 2G0FA 3KTLA 2LRTA 3DXBA 2XTQA 1JZWA 2PGTA 3ED3A 4CY8A 2JACA 3U5RE 4IP1A 3GA4A 1A0RP 1SL0B 4KDXA 3I69A 1U3IA 1PQNA 1TTZA 3GH6A 2J23A 4MA9A 2DJJA 3RHBA 4FQUA 2RADA 1E2YA 3TOTA 1U3AA 1WOUA 3KH7A 4IJIA 3HJPA 1SJIA 3VWUA 3N9JA 2N5FA 3UBLA 4PQHA 5CO3A 3GHAA 3BCKA 1O85A 2D2ZA 4MJEA 2P5RA 1QK8A 2REMA 5KOWA 3CRUA 5BMUA 3F8UA 4ID0A 3F4TA 1M2DA 3ZFBA 2BL8A 1FW1A 2DIZA 1GUKA 3ZVJA 2LJKA 2LNTA 4GF0A 1BEDA 2JB2A 2QSBA 2A2PA 1XVWA 2XHFA 3DRNA 4LMVA 3PINA 3CTFA 3LW9A 1WIKA 3QAWA 4G0IA 3TKSC 4Z2UA 4NWYA 4I1TA 4TVEA 3IHQA 5ECIB 3AY8A 3GH9A
chains in the Genus database with same CATH topology
17GSA 3F4SA 2V6EA 5EL8A 1GTUA 3GKNA 3FBVA 1ERTA 1Z7RA 1UC7A 3NIVA 4YAPA 3UITA 3LWAA 3EINA 2C0GA 5DVBA 4YQUA 3TJFA 5G1KA 2TRXA 3HVXA 3D22A 4CHSA 5ECMB 1G6WA 5IOXA 3KTBA 2NVLA 1SD8A 1SL2B 4K2XA 3UBKA 2L6DA 2DJKA 1GSSA 2CZ2A 1X9MB 2CAIA 4GCIA 4MH2A 3P23A 3C8EA 3J7Yb 5BRTA 4XS6A 3HVVA 1FOHA 3WGEA 1ZCPA 4O1PA 2DJ1A 2L1LB 5KN2A 1EEJA 1HYUA 4D73B 2HSYA 4V2NA 4MP4A 4TR1A 2FA4A 1KEBA 4OCEA 1UA5A 5GSTA 5KN3A 5DJMA 2VL9A 3ZMLA 1RW1A 4IQAA 2CVDA 1BQ7A 2X8HA 2FWFA 2N5BA 4MZBA 2H72A 1O7UA 4K5SA 3H1NA 5D8IA 3CXGA 4IS0A 3ISOA 4YZDA 1FOVA 4L8EA 2GQMA 6GSXA 1V9WA 5DALA 3H4KA 5ECOB 2LNSA 3GURA 4KF9A 2PU9C 1E6BA 3IXRA 2GT5A 4HDEA 4Q5QA 5ECRB 4YQMA 3EC3A 3RPPA 4DSSB 4O5QA 2L5LA 1WE0A 3H93A 2H0HA 5J3RA 4G76A 5FT3A 4WKWA 2P0GA 1ML6A 2CVBA 4PL5A 1PN0A 2EC4A 2PN8A 5ELGA 1OAZA 2RM5A 4KA0A 5HR1A 3TKQA 3FY7A 1THXA 3HJOA 4EF0A 1DE1A 4V2MA 4V1Ap 5HR0A 2HI7A 1J9BA 2YP6A 4TXOB 3UOMA 1W4VA 4G75A 5J5NA 5FHIA 3FZ5A 1FB0A 3TGZA 1YJ6A 2KP1A 3DYRA 2LUSA 1TRWA 2C1YA 4YKGA 1R7HA 2AAWA 4KUNA 1JFUA 5DQSA 1J08A 1XBSA 3DEXA 2H0GA 2IFQB 2AJQB 2E8GA 4HEA1 4G19A 4Z7HA 1O73A 3TJJA 2MBTA 4NHZA 4YQVA 2DKHA 3NOFA 1F2EA 4EDYA 3KGKA 3TKPA 1Z9HA 4QL7A 1TK0B 2LRNA 5E59A 2V6KA 5LCZA 5KN1A 1TRSA 3L9UA 3MWHA 4XRAA 2YWNA 7GSSA 3TRQA 2B1LA 1B4QA 4MLYA 1QFNA 4FIWA 1JLVA 4K0NA 1EGRA 3GNJA 3Q18A 1PA3A 4O5RA 5JWOB 4JEDA 4GWRA 1ON4A 3L9SA 3EPTA 3LJRA 4NPBA 1M0UA 4YZCA 5CRDA 1PRXA 3EE2A 3WGDA 4PL3A 3EVIA 1TU7A 1XVQA 4TXVA 3DA3A 4Q5FA 5CP1A 5CRHA 1X9WB 2GTUA 2IWTA 1FG4A 3FR6A 1X9SB 3LQ7A 2HE3A 2R2JA 3BBYA 2GSRA 2FA8A 2WGRA 1XIYA 2VL2C 4AJ7A 4PNGA 2VCQA 6GSSA 4POMA 1AIUA 4P3YB 5A4WA 2CAZB 2F51A 3GL3A 2OE3A 4MPGA 1K0CA 2G2QA 5A4UA 4MMMA 4KGIA 2B3SA 1OC8A 2ZCTA 3F0IA 2R0PA 2VLUA 1PKWA 1WRYA 2VD1A 2P22B 4EKZA 2LV3A 3M0FA 1QUWA 1YEPA 2OE1A 1TOFA 4XS1A 2FWEA 2LSTA 1SKRB 1Q4JA 2VM2A 4WXTA 3ME7A 1JZOA 1T1VA 4EUYA 4IBPA 5G31A 2DJ2A 3GSSA 2V1MA 4BA7A 1VF1A 1GTBA 3FR9A 3EYTA 2GSSA 5COHA 2K8VA 4KDYA 5JCWA 2HRKA 1Z3EA 3HA9A 3P8WA 2F3MA 3LYPA 3ZIJA 1AQWA 4BVYB 1A2JA 1MTCA 2RM6A 1EOHA 3HHVA 1AAZA 4LA1A 3WT2A 4NV2A 2CX3A 3VLNA 1QXHA 1SJZA 2P5QA 5EY6A 5AN1A 2K9FA 4MK3A 2VCWA 4GSSA 2DJ0A 5EPFA 2J9HA 4CDOA 1BX9A 6GSWA 1Z6MA 1S3CA 2MBSA 1GWCA 2FD3A 2WS2A 2IMKA 1H4OA 1XWAA 5LNK1 5CNWA 4ZIJA 1KBNA 4N0ZA 4WR4A 5KN0A 2DLXA 4HOJA 2HNLA 5C04A 4O5UA 3GN3A 1T00A 4TR0A 3VWVA 2YV9A 1ST9A 3D21A 3QOUA 1Y25A 1GNWA 2AV4A 1VF3A 4BL7B 3CSHA 4AJ6A 1FO5A 4F82A 1TKDB 4L5LA 2R37A 1SJ8A 2V2GA 2YJHA 3IOSA 4KCAA 1DE2A 5G2ZA 5CREA 3IAM1 4CY6A 4ULXA 4ECBA 1N8JA 1AC1A 4FO5A 3GIXA 2CV4A 3RDWA 2H75A 3A2VA 1MDKA 1LBKA 1RQMA 4PURA 3F4RA 4JZQA 3D4TA 1EP8A 1PX7A 1EEMA 2R4VA 3PR8A 3Q74A 2O89A 3IR4A 1GLQA 4ACSA 2HSHA 1ERVA 4EIPA 1M99A 1G0TA 3FZAA 1PGTA 4N0VA 4ML6A 3FYGA 2LQOA 4KNDA 1MD4A 4MCUA 2XBQA 2K6VA 1YF0A 22GSA 2DMLA 2YZUA 2CX4A 4HEA2 1V40A 4OCFA 1F3BA 4BVXA 4GTUA 1TRVA 2OACA 3F3RA 2KLXA 1SJ6A 5ELAA 3QFBC 2AHEA 3BCIA 5HQPA 4I6XA 4ZXGA 3WGXA 4EIQA 1GP1A 1PMTA 3GTUA 3OR5A 2H19A 3KIJA 3MIXA 4MZCA 5J4UA 5J9BA 5GSSA 1ABAA 1BYEA 4OFNA 2B6MA 4GQFA 2HXKA 1EP7A 2JADA 11GSA 3LFLA 4HZ4A 3KMOA 5ECPB 1VRSD 1CQGA 2KOKA 3SDJA 2DMMA 3Q19A 3UAPA 3P2AA 4DEJA 1X0RA 3QAVA 4ILFA 3M9JA 4WBJA 1C72A 1XWBA 2F8AA 2L6CA 2H6YA 2ZRRA 4AS2A 1X5EA 2TIRA 2V32A 4MDCA 3K8NA 5J9CA 2PERA 5HGIA 2FUG2 4JBBA 4L0UA 4OO4A 1F37A 1ZYPA 2C8UA 2IPAA 2IMDA 2N5AA 3GKKA 4ZL9A 3EMXA 3QD9A 4F0BA 2ES7A 2E2MA 5IO2A 2YFAA 14GSA 4MJCA 1Z7PA 1IYHA 3DO9A 1FVJA 1K3LA 2C0FA 2R5GA 3LG6A 4HU7A 1OKDA 3WYWA 4BWQA 1YY7A 4MH3A 3UJ1A 4E8HA 2HYXA 2L57A 4Z2RA 4JE1A 4XHMA 3GX8A 1Q98A 4EE0A 1A8YA 2VAFA 2YJ7A 4AJ8A 2GT6A 5IMCA 4NXIA 2WFCA 2YZHA 3RPNA 3P7XA 4IP6A 2F66B 5IM9A 5EVOA 2H70A 3DVWA 1UVZA 1GSQA 4IGJA 3U6VA 3ZZXA 2GDRA 4FYCA 3BOAA 3GKMA 5AGYA 2RUFA 2YNXA 3HXSA 5IOWA 2H71A 4QQ7A 2VLVA 1HNBA 2MMOA 5ID2A 4TOPA 3CMIA 5ENUA 2A4HA 3HJMA 4WF4A 4ML1A 1OYJA 5F06A 1FVKA 5DJLA 4IN0A 1OKTA 4POBA 1GUMA 1RK4A 1YZXA 4ZBAA 2HZEA 1OC3A 2H01A 3IA1A 2H30A 2M80A 3HDCA 2EIOA 3L0HA 5ECLB 2L4QA 3IHGA 4TRXA 3LJ0A 4O32A 2C3TA 3APSA 3Q6OA 4K2DA 4V1Ag 2C3QA 2VIMA 1GSYA 1OC9A 1V58A 1I5GA 1WMJA 3DD3A 1S3AA 4FH8A 2BMXA 2IMEA 4PX1A 4JRRA 4MPFA 3D4MA 5ECNB 13GSA 3DWVA 4KH7A 3IE3A 2OBKA 3VWXA 4MABA 1B9YC 2X99A 4K9ZA 2FLSA 1NSWA 2VL2A 3IK9A 4F0CA 3TRXA 2CT6A 2LTKA 1WP0A 3KEBA 1CQHA 2JL4A 2IMFA 2DJ3A 2H1AA 3VA9A 4YAVA 5LNKe 2PWJA 3E0UA 2LS5A 1U88A 3LJ2A 2A4VA 2HZFA 4WEYA 3IAM2 2A2DA 4IKHA 4X0XA 2UZ8A 1EWXA 2H0IA 2C4JA 2PUKC 5AIVA 3ZFLA 3ZTLA 5D9WA 4HQZA 4PQIA 1S3DA 4MNNA 1GSUA 4YZ9A 2AB6A 5H5RA 2XC2A 2HT9A 3ZITA 2DBCA 3DKSA 2XTRA 1B4PA 2F8FA 3D5JA 3FKFA 3R3EA 5JCUA 1SU9A 5A5KA 4ZB6A 2JB3A 1MEKA 3KJYA 4Q9VA 1TW9A 4G0KA 2FGXA 3DMLA 3HCZA 1SK0A 1G7OA 3G7IA 1EGOA 4EVMA 4IELA 5GZZB 4G10A 4IW9A 2FUG1 2WDUA 4J57E 2LJAA 1K0MA 3EMPA 1GTIA 5ECQB 3CSIA 16GSA 1TXXA 3QPMA 6GSYA 1M9BA 1GULA 2E2GA 2KP2A 2OBIA 1ZYQB 4AS3A 2GZPA 5F8BA 1YKAA 3G9BA 2GVPA 3CRTA 3L78A 5IO0A 1J0FA 5JCGA 2KHPA 2R0CA 4POKA 3A2XA 2Z9SA 2MMAA 3WT1A 2DKIA 3LEFA 4RQXA 1WJKA 2GSQA 2GQLA 4WETA 1GTAA 2OE0A 2CQ9A 3ZVJD 1A8LA 4TKYA 3FR3A 1N2AA 5CYYA 2YOIA 4IHUA 1Y6EA 2WJUA 3KCMA 1EV4A 3MNGA 2VLTA 5ECSA 3HVSA 2IN3A 1TI3A 5B6NA 3WD6A 4KW6A 2H6ZA 2FWHA 3QAGA 1THOA 2VCVA 5B6MA 4D73A 2LEGA 1VF2A 4TR4A 3VWWA 2K8SA 4X4JA 4OD7A 4ZBDA 4GRFA 2RUEA 3FW2A 4XIHA 4I2TA 1GSDA 2M46A 4E8EA 1ZOFA 1QQ2A 1JZRA 1ZMAA 1SKSB 3O6TA 3ERFA 1SYRA 4MF6A 2X49A 1XOAA 3H79A 2NBSA 3LXZA 5IPGA 4KE3A 2KUCA 4J2FA 1SL1B 1T4YA 2FWGA 1YEXA 1FAAA 2NPBA 4X43A 1DBYA 4DVCA 1MDIA 1A2MA 4PXOA 3KD0A 2QSIA 3O76A 1DUGA 4I5QA 5L71A 5KOXA 1I9DA 4RI6A 3F6DA 1NW2A 1T4ZA 3IAS1 2DIYA 5INYA 4KSOA 3GFKA 2MMZA 5D73A 3GYKA 2LKUA 1GSEA 4EC0A 5J41A 3DVXA 1YKCA 3RBTA 3F9UA 1T3BA 4Z7GA 3PGTA 1GUHA 2JAEA 2YFBA 4GQCA 2I4AA 2I3YA 4TR1B 1LU4A 1K0OA 2LQQA 1M2AA 1GSFA 5IMFA 4F2IA 4G0LA 3QDNA 4GLTA 2C3NA 3VPTA 4Z2TA 2I9HA 4TXOA 5HFIA 2B7KA 1VGLA 3I9V1 2JSZA 3APQA 1XWGA 5D96A 5ID2B 5DDLA 1V2AA 2PVOC 1R5AA 1KTEA 4LMWA 5DALB 5HFKA 1XW9A 2R3XA 2PVQA 2HZEB 1YDKA 3TKSA 3C73A 2XPEA 1T7PB 3TOUA 2GLRA 1XFLA 2X64A 4OO5A 3UL3A 1SYXA 4HQSA 4KB3A 1F6MC 4ECJA 3GX0A 3TB2A 4PGTA 5JWRB 4FYUA 1Z5YE 5F0GA 2VL3A 1SENA 2I1UA 3BJ5A 4LLRA 3UARA 1PX6A 3M9KA 1AUCA 2B5YA 2QA2A 4PTSA 1PN9A 4EDZA 3VK9A 3ME8A 4NV5A 20GSA 2MJFB 1XPVA 3GRXA 3GL5A 4N11A 1JHBA 3TJKA 3MDKA 1XCCA 4OAVB 1MD3A 3MSZA 2IL3A 12GSA 3UVHA 5HR3A 1O6JA 3C71A 3LGCA 3C7MA 2LJRA 3E9JB 5ECHB 3C1RA 3M1GA 2GQKA 2C80A 5C00A 1YO7A 3KXOA 1W89A 3BD2A 19GSA 4KAEA 3MAKA 2JU5A 3LXTA 4GSTA 2IMIA 5DQYA 1JZDA 1GLPA 3O3TA 2ON7A 6GSUA 1SK1A 3ERGA 5F05A 4N10A 2VO4A 4RQRA 3W6GA 2O8VB 4ZILA 9GSSA 1EOGA 2NDOA 3NZNA 3A3TA 4JCVE 2PBJA 2H73A 2YANA 1XWKA 3P90A 3HD5A 3L4NA 1TK8B 2X4AA 3SBCA 3ZYWA 3LJ1A 4HZ2A 1U87A 2PMTA 1ILOA 1ZL9A 1GRXA 4ZL8A 3EU3A 3FMWA 4PQ1A 4AF2A 1R26A 2VCXA 4OFTA 5CAXA 1HD2A 1UN2A 3TJBA 2B1KA 1GNEA 4JU5A 4F9ZA 4EXJA 3KM6A 18GSA 1YQ1A 3A5WA 5IMDA 5KEJA 1A0FA 2GSTA 4KCEA 3LSZA 1QGVA 1X5DA 2EIRA 2VOCA 5E4WA 1OE7A 3GSTA 5DAKA 2C0EA 3GUSA 3FZ4A 4YH2A 2X8GA 2CZ3A 2JZTA 4K1FA 1AW9A 3IPZA 3KZQA 3UVTA 1TJDA 2FCHA 1V98A 4PUFC 4XRDA 1GL8A 3I6AA 3ZIVA 1PL2A 1NHOA 2WULA 3QCPA 4BVYA 2HLSA 4MZWA 2A2RA 3H8QA 4LL4B 2IJYA 2VCTA 1WWJA 2WRTA 2E7PA 1K0DA 3HZ8A 3IRAA 3ZL5A 1K0BA 3M8NA 4HI7A 4MJBA 2MMNA 3F6FA 3HZ4A 4HFVA 3A5IA 4K7OA 3TCOA 1SK2A 1PKZA 4DSRA 4AGSA 8GSSA 4DWLA 5B7CA 2YWMA 4NHWA 1ZYEA 3KH9A 2HRFA 4ECCA 2YV7A 4BPYA 4K6XA 3LORA 2YPMA 2ZUPA 4XS4A 3AJFA 3I43A 3IC8A 5B8BA 5D93A 2TRCP 5G5EA 2QKEA 4NAXA 4TN8A 3S9FA 5IMZA 3EWLA 4Q5NA 1SKWB 4JR4A 5A4VA 4BL7A 3D6IA 2V41A 1G7EA 5H5SA 2L5OA 3IAS2 2HFDA 2AYTA 4IJ3A 2HRNA 2FY6A 1YF1A 2WZ9A 2CA8A 4PL4A 1X5CA 4GXTA 3V1WA 2WCIA 4USSA 1GH2A 2A2CA 2FNOA 1QMVA 3IK7A 4O1OA 4MJAA 3IBHA 2YCDA 4Z7XA 2K19A 2JB1A 4OMVA 2H8LA 4ZB9A 1BG5A 3TJGA 2OA7A 3ERWA 4I8BA 1SD9A 2AUVA 1ACVA 2X8CA 1AQVA 5HR2A 3W8JA 1B48A 3CTGA 5GAND 3HKRA 1B9XC 4G2EA 3I9V2 4XCSA 1AXDA 2O7KA 1JLWA 2XMXA 3L0IA 4HS1A 2K18A 3IV4A 2L59A 2MZCA 10GSA 5G30A 2BTOT 3DA4A 4G9HA 5DBQA 1HNCA 3W8SA 5FWGA 2YWOA 4A5PA 1AQXA 1FB6A 4J56E 3CYNA 3PPUA 3F63A 4OWYA 3Q8DA 3E3EA 1G6YA 1W3SA 2VUPA 4K5RA 1XW5A 1WPIA 2DSAA 3FRCA 1PSQA 1A23A 1BJXA 2MYGA 2ZNMA 3UEMA 4HJ2A 3TDGA 4NMUA 2WB9A 2H66A 5AISA 4HJMA 1O81A 2KKMA 4OAUC 5LD0A 2CAQA 2VM1A 3FHKA 1A24A 2P31A 2H1DA 1XXUA 1XWCA 3JCML 1VF4A 3KMNA 4ZL7A 1DSBA 1TI1A 1KNGA 3UMAA 5F07A 5G5FA 3CSJA 3GMFA 2F9SA 4JR6A 1Z6NA 1ZGNA 2H6XA 5G1LA 4WBRD 2B5XA 3DGQA 2XPDA 3R2QA 1EZKA 4BVXB 3QMXA 3US3A 2CVKA 4ECIA 4QL9A 1IYIA 2RLIA 2RIIA 5H5QA 4HU9A 4Q5RA 3M3MA 3UIWA 3LYKA 3TKSE 3GTUB 1M2BA 1A2LA 2RIOA 3G7YA 1URMA 4TW5A 3TRPA 4XTSA 4I2UA 3C1SA 2F6MB 4PUAA 4L5OA 3RAZA 4CW9A 2OKAA 1K3OA 3G7JA 4KDUA 1XOBA 3F4MA 4TR3A 4L0WA 4RUVA 4F03A 1M7TA 3F3QA 1OVNA 5GAPD 5DCHA 4OFMA 1OE8A 3VI7A 3HY2A 5JWQB 4PNFA 2FHEA 5HFGA 1O8WA 4ZB8A 4K7IA 2E0QA 2QA1A 2JSYA 1LJRA 1B8XA 4ICYA 3VFIA 4EO3A 2R6KA 5IIZA 1NHYA 3ZRDA 3IDVA 1R5PA 3MYDA 1ERWA 3FEUA 2ALBA 4I97A 4WR5A 5D9VA 3SWLA 1TK5B 4GXZA 5IQYA 4N30A 1R4WA 3FZ9A 3TKRA 1PL1A 3ZLPA 1H75A 2GZYA 1XZOA 3VURA 1MDJA 2HSMA 4GSNA 5CRWA 5ECKB 1ZYNA 2L4CA 1EV9A 2H1BA 2OJLA 4K7NA 5DAKB 4O7HA 4RI7A 3APOA 4U6RA 1F3AA 3J7Yk 2B7JA 2H1GA 2O85A 3DIEA 1U5KA 3CBUA 2HRAA 3HYPA 4DSQA 1V57A 4LL1B 4BWSA 3GV1A 1HQOA 4X1UA 4IVFA 6GSVA 3ZREA 4K8MA 3QFAC 4KX4A 2NTOA 2XBIA 3KP8A 1BAYA 2A2SA 2GGTA 3VI5A 5AIXA 2M72A 1K0AA 1TU8A 4DSSA 2DC5A 4YKFA 2JZSA 2C0DA 2QGVA 4POLA 2YWIA 5D9TA 5ABRA 1ZZYA 3A2WA 4FYBA 3N5OA 2ON5A 5DCGA 5B8AA 2QC7A 2IIYA 1HNAA 5CRGA 3TUEA 2V1CC 1K0NA 3L9VA 2GS3A 2R0GA 4IQ1A 5D9XA 5IPHA 2BJXA 4MF5A 1USBA 2H74A 3EU4A 5IMVA 2H76A 1XW6A 1M9AA 1U6TA 2JZRA 2YN1A 4XS4B 4V2LA 1T8EB 4ISDA 3VPQA 2B5EA 1O8XA 3KP9A 2GZZA 3FK8A 2OADA 1FHEA 2IFQA 3D0ZA 3JSBA 1PD21 2VD0A 4WF5A 1TRUA 2PPTA 4KSMA 2I81A 1K3YA 1F9MA 2V6OA 3GKXA 3PH9A 1OC9B 4K0GA 4MF7A 4EL1A 3QR6A 2O87A 4O92A 2IP6A 4ZBBA 4HUAA 1TDIA 2LRCA 5IMAA 1NM3A 2EIQA 3EURA 1ERUA 1TP9A 3IC4A 3ZMKA 6GSTA 4H86A 3RHCA 2VCZA 2G0FA 3KTLA 2LRTA 3DXBA 2XTQA 1JZWA 2PGTA 3ED3A 4CY8A 2JACA 3U5RE 4IP1A 3GA4A 1A0RP 1SL0B 4KDXA 3I69A 1U3IA 1PQNA 1TTZA 3GH6A 2J23A 4MA9A 2DJJA 3RHBA 4FQUA 1E2YA 3TOTA 1U3AA 1WOUA 3KH7A 4IJIA 3HJPA 1SJIA 3VWUA 3N9JA 2N5FA 3UBLA 4PQHA 5CO3A 3GHAA 3BCKA 1O85A 2D2ZA 4MJEA 2P5RA 1QK8A 2REMA 5KOWA 3CRUA 5BMUA 3F8UA 4ID0A 3F4TA 1M2DA 3ZFBA 1FW1A 2DIZA 1GUKA 3ZVJA 2LJKA 2LNTA 4GF0A 1BEDA 2JB2A 2A2PA 1XVWA 2XHFA 3DRNA 4LMVA 3PINA 3CTFA 3LW9A 1WIKA 3QAWA 4G0IA 3TKSC 4Z2UA 4NWYA 4I1TA 4TVEA 3IHQA 5ECIB 3AY8A 3GH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 17GS A;  3F4S A;  5EL8 A;  1GTU A;  3GKN A;  1ERT A;  1Z7R A;  1UC7 A;  3NIV A;  4YAP A;  3LWA A;  3EIN A;  2C0G A;  5DVB A;  4YQU A;  3TJF A;  5G1K A;  2TRX A;  3HVX A;  3D22 A;  4CHS A;  5ECM B;  1G6W A;  5IOX A;  3KTB A;  2NVL A;  1SD8 A;  1SL2 B;  3UBK A;  2L6D A;  2DJK A;  1GSS A;  2CZ2 A;  1X9M B;  2CAI A;  4GCI A;  4MH2 A;  3C8E A;  3J7Y b;  4XS6 A;  3HVV A;  3WGE A;  1ZCP A;  2DJ1 A;  5KN2 A;  1EEJ A;  1HYU A;  4D73 B;  2HSY A;  4V2N A;  4MP4 A;  4TR1 A;  2FA4 A;  1KEB A;  4OCE A;  1UA5 A;  5GST A;  5KN3 A;  5DJM A;  2VL9 A;  3ZML A;  1RW1 A;  4IQA A;  2CVD A;  1BQ7 A;  2X8H A;  2FWF A;  2N5B A;  4MZB A;  2H72 A;  1O7U A;  3H1N A;  5D8I A;  3CXG A;  4IS0 A;  3ISO A;  1FOV A;  4L8E A;  2GQM A;  6GSX A;  1V9W A;  5DAL A;  3H4K A;  5ECO B;  2LNS A;  3GUR A;  2PU9 C;  1E6B A;  3IXR A;  2GT5 A;  4HDE A;  4Q5Q A;  5ECR B;  4YQM A;  3EC3 A;  3RPP A;  4DSS B;  2L5L A;  1WE0 A;  3H93 A;  2H0H A;  5J3R A;  5FT3 A;  4WKW A;  2P0G A;  1ML6 A;  2CVB A;  2EC4 A;  2PN8 A;  5ELG A;  1OAZ A;  2RM5 A;  4KA0 A;  5HR1 A;  3TKQ A;  3FY7 A;  1THX A;  3HJO A;  4EF0 A;  1DE1 A;  4V2M A;  4V1A p;  5HR0 A;  2HI7 A;  1J9B A;  2YP6 A;  4TXO B;  3UOM A;  1W4V A;  5J5N A;  5FHI A;  3FZ5 A;  1FB0 A;  3TGZ A;  1YJ6 A;  2KP1 A;  3DYR A;  2LUS A;  1TRW A;  2C1Y A;  1R7H A;  2AAW A;  4KUN A;  1JFU A;  5DQS A;  1J08 A;  1XBS A;  3DEX A;  2H0G A;  2IFQ B;  2AJQ B;  4G19 A;  1O73 A;  3TJJ A;  2MBT A;  4NHZ A;  4YQV A;  3NOF A;  1F2E A;  4EDY A;  3KGK A;  3TKP A;  1Z9H A;  4QL7 A;  1TK0 B;  2LRN A;  5E59 A;  2V6K A;  5LCZ A;  5KN1 A;  1TRS A;  3L9U A;  3MWH A;  4XRA A;  2YWN A;  7GSS A;  3TRQ A;  2B1L A;  1B4Q A;  4MLY A;  1QFN A;  4FIW A;  1JLV A;  4K0N A;  1EGR A;  3GNJ A;  3Q18 A;  1PA3 A;  4O5R A;  5JWO B;  4JED A;  4GWR A;  1ON4 A;  3L9S A;  3LJR A;  4NPB A;  1M0U A;  5CRD A;  1PRX A;  3EE2 A;  3WGD A;  3EVI A;  1TU7 A;  1XVQ A;  4TXV A;  4Q5F A;  5CP1 A;  5CRH A;  1X9W B;  2GTU A;  2IWT A;  1FG4 A;  3FR6 A;  1X9S B;  3LQ7 A;  2HE3 A;  2R2J A;  3BBY A;  2GSR A;  2FA8 A;  2WGR A;  1XIY A;  2VL2 C;  4AJ7 A;  4PNG A;  2VCQ A;  6GSS A;  4POM A;  1AIU A;  4P3Y B;  5A4W A;  2F51 A;  3GL3 A;  2OE3 A;  4MPG A;  1K0C A;  2G2Q A;  5A4U A;  4MMM A;  4KGI A;  2B3S A;  1OC8 A;  2ZCT A;  3F0I A;  2VLU A;  1PKW A;  1WRY A;  2VD1 A;  4EKZ A;  2LV3 A;  3M0F A;  1QUW A;  1YEP A;  2OE1 A;  1TOF A;  4XS1 A;  2FWE A;  2LST A;  1SKR B;  1Q4J A;  2VM2 A;  4WXT A;  3ME7 A;  1JZO A;  1T1V A;  4EUY A;  4IBP A;  5G31 A;  2DJ2 A;  3GSS A;  2V1M A;  4BA7 A;  1VF1 A;  1GTB A;  3FR9 A;  3EYT A;  2GSS A;  5COH A;  2K8V A;  4KDY A;  5JCW A;  1Z3E A;  3HA9 A;  3P8W A;  2F3M A;  3LYP A;  3ZIJ A;  1AQW A;  1A2J A;  1MTC A;  2RM6 A;  1EOH A;  3HHV A;  1AAZ A;  4LA1 A;  3WT2 A;  4NV2 A;  2CX3 A;  3VLN A;  1QXH A;  1SJZ A;  2P5Q A;  5EY6 A;  5AN1 A;  2K9F A;  4MK3 A;  2VCW A;  4GSS A;  2DJ0 A;  5EPF A;  2J9H A;  4CDO A;  1BX9 A;  6GSW A;  1Z6M A;  1S3C A;  2MBS A;  1GWC A;  2FD3 A;  2WS2 A;  2IMK A;  1H4O A;  1XWA A;  5CNW A;  4ZIJ A;  1KBN A;  4N0Z A;  4WR4 A;  5KN0 A;  2DLX A;  4HOJ A;  2HNL A;  5C04 A;  3GN3 A;  1T00 A;  4TR0 A;  3VWV A;  2YV9 A;  1ST9 A;  3D21 A;  3QOU A;  1Y25 A;  1GNW A;  2AV4 A;  1VF3 A;  3CSH A;  4AJ6 A;  1FO5 A;  4F82 A;  1TKD B;  4L5L A;  2R37 A;  2YJH A;  2V2G A;  3IOS A;  4KCA A;  1DE2 A;  5G2Z A;  5CRE A;  4ULX A;  4ECB A;  1N8J A;  1AC1 A;  4FO5 A;  3GIX A;  2CV4 A;  3RDW A;  2H75 A;  3A2V A;  1MDK A;  1LBK A;  1RQM A;  4PUR A;  3F4R A;  4JZQ A;  3D4T A;  1EP8 A;  1PX7 A;  1EEM A;  2R4V A;  3PR8 A;  3Q74 A;  2O89 A;  3IR4 A;  1GLQ A;  4ACS A;  2HSH A;  1ERV A;  1M99 A;  1G0T A;  3FZA A;  1PGT A;  4N0V A;  4ML6 A;  3FYG A;  2LQO A;  4KND A;  1MD4 A;  4MCU A;  2XBQ A;  2K6V A;  1YF0 A;  22GS A;  2DML A;  2YZU A;  2CX4 A;  4HEA 2;  1V40 A;  4OCF A;  1F3B A;  4BVX A;  4GTU A;  1TRV A;  2OAC A;  3F3R A;  2KLX A;  1SJ6 A;  5ELA A;  3QFB C;  2AHE A;  3BCI A;  5HQP A;  4I6X A;  4ZXG A;  3WGX A;  1GP1 A;  1PMT A;  3GTU A;  3OR5 A;  2H19 A;  3KIJ A;  4MZC A;  5J4U A;  5J9B A;  5GSS A;  1ABA A;  1BYE A;  4OFN A;  2B6M A;  4GQF A;  2HXK A;  1EP7 A;  2JAD A;  11GS A;  3LFL A;  4HZ4 A;  3KMO A;  5ECP B;  1VRS D;  1CQG A;  2KOK A;  2DMM A;  3Q19 A;  3UAP A;  3P2A A;  4DEJ A;  1X0R A;  3QAV A;  4ILF A;  3M9J A;  4WBJ A;  1C72 A;  1XWB A;  2F8A A;  2L6C A;  2H6Y A;  1X5E A;  2TIR A;  2V32 A;  4MDC A;  3K8N A;  5J9C A;  2PER A;  2FUG 2;  4JBB A;  4L0U A;  4OO4 A;  1F37 A;  2C8U A;  2IPA A;  2IMD A;  2N5A A;  3GKK A;  4ZL9 A;  3EMX A;  3QD9 A;  4F0B A;  2ES7 A;  2E2M A;  5IO2 A;  14GS A;  4MJC A;  1Z7P A;  1IYH A;  1K3L A;  1FVJ A;  3LG6 A;  2C0F A;  2R5G A;  4HU7 A;  1OKD A;  3WYW A;  4BWQ A;  1YY7 A;  4MH3 A;  3UJ1 A;  4E8H A;  2HYX A;  2L57 A;  4JE1 A;  4XHM A;  3GX8 A;  1Q98 A;  4EE0 A;  1A8Y A;  2VAF A;  2YJ7 A;  4AJ8 A;  2GT6 A;  5IMC A;  4NXI A;  2WFC A;  2YZH A;  3RPN A;  3P7X A;  4IP6 A;  5IM9 A;  5EVO A;  2H70 A;  3DVW A;  1UVZ A;  1GSQ A;  4IGJ A;  3U6V A;  3ZZX A;  2GDR A;  4FYC A;  3BOA A;  3GKM A;  5AGY A;  2RUF A;  2YNX A;  3HXS A;  5IOW A;  2H71 A;  4QQ7 A;  2VLV A;  1HNB A;  2MMO A;  5ID2 A;  4TOP A;  3CMI A;  5ENU A;  3HJM A;  4WF4 A;  4ML1 A;  1OYJ A;  5F06 A;  1FVK A;  5DJL A;  4IN0 A;  1OKT A;  4POB A;  1GUM A;  1RK4 A;  1YZX A;  4ZBA A;  2HZE A;  1OC3 A;  2H01 A;  3IA1 A;  2H30 A;  2M80 A;  3HDC A;  2EIO A;  3L0H A;  5ECL B;  2L4Q A;  4TRX A;  4O32 A;  2C3T A;  3APS A;  3Q6O A;  4K2D A;  4V1A g;  2C3Q A;  2VIM A;  1GSY A;  1OC9 A;  1V58 A;  1I5G A;  1WMJ A;  3DD3 A;  1S3A A;  4FH8 A;  2BMX A;  2IME A;  4PX1 A;  4JRR A;  4MPF A;  3D4M A;  5ECN B;  13GS A;  3DWV A;  4KH7 A;  3IE3 A;  2OBK A;  3VWX A;  4MAB A;  1B9Y C;  2X99 A;  4K9Z A;  2FLS A;  1NSW A;  2VL2 A;  3IK9 A;  4F0C A;  3TRX A;  2CT6 A;  2LTK A;  1WP0 A;  3KEB A;  1CQH A;  2JL4 A;  2IMF A;  2DJ3 A;  2H1A A;  4YAV A;  5LNK e;  2PWJ A;  3E0U A;  2LS5 A;  1U88 A;  2A4V A;  2HZF A;  4WEY A;  3IAM 2;  4IKH A;  4X0X A;  1EWX A;  2H0I A;  2C4J A;  2PUK C;  5AIV A;  3ZFL A;  3ZTL A;  5D9W A;  4HQZ A;  4PQI A;  1S3D A;  1GSU A;  2AB6 A;  5H5R A;  2XC2 A;  2HT9 A;  3ZIT A;  2DBC A;  3DKS A;  1B4P A;  2F8F A;  3D5J A;  3FKF A;  5JCU A;  1SU9 A;  5A5K A;  4ZB6 A;  1MEK A;  3KJY A;  1TW9 A;  2FGX A;  3DML A;  3HCZ A;  1SK0 A;  1G7O A;  3G7I A;  1EGO A;  4EVM A;  4IEL A;  5GZZ B;  4G10 A;  4IW9 A;  2WDU A;  4J57 E;  2LJA A;  1K0M A;  3EMP A;  1GTI A;  5ECQ B;  3CSI A;  16GS A;  1TXX A;  3QPM A;  6GSY A;  1M9B A;  1GUL A;  2E2G A;  2KP2 A;  2OBI A;  1ZYQ B;  2GZP A;  5F8B A;  1YKA A;  3G9B A;  2GVP A;  3CRT A;  3L78 A;  5IO0 A;  1J0F A;  5JCG A;  2KHP A;  4POK A;  3A2X A;  2Z9S A;  2MMA A;  3WT1 A;  3LEF A;  4RQX A;  1WJK A;  2GSQ A;  2GQL A;  4WET A;  1GTA A;  2OE0 A;  2CQ9 A;  3ZVJ D;  1A8L A;  4TKY A;  3FR3 A;  1N2A A;  5CYY A;  2YOI A;  4IHU A;  1Y6E A;  2WJU A;  3KCM A;  1EV4 A;  3MNG A;  2VLT A;  5ECS A;  3HVS A;  2IN3 A;  1TI3 A;  5B6N A;  3WD6 A;  4KW6 A;  2H6Z A;  2FWH A;  3QAG A;  1THO A;  2VCV A;  5B6M A;  4D73 A;  2LEG A;  1VF2 A;  4TR4 A;  3VWW A;  2K8S A;  4OD7 A;  4ZBD A;  4GRF A;  2RUE A;  3FW2 A;  4XIH A;  4I2T A;  1GSD A;  2M46 A;  4E8E A;  1ZOF A;  1QQ2 A;  1JZR A;  1ZMA A;  1SKS B;  3O6T A;  3ERF A;  1SYR A;  4MF6 A;  3H79 A;  1XOA A;  2NBS A;  3LXZ A;  5IPG A;  4KE3 A;  2KUC A;  4J2F A;  1SL1 B;  1T4Y A;  2FWG A;  1YEX A;  1FAA A;  2NPB A;  4X43 A;  1DBY A;  4DVC A;  1MDI A;  1A2M A;  4PXO A;  3KD0 A;  2QSI A;  3O76 A;  1DUG A;  4I5Q A;  5L71 A;  1I9D A;  4RI6 A;  3F6D A;  1NW2 A;  1T4Z A;  2DIY A;  5INY A;  4KSO A;  3GFK A;  2MMZ A;  5D73 A;  3GYK A;  2LKU A;  1GSE A;  4EC0 A;  5J41 A;  3DVX A;  1YKC A;  3RBT A;  3F9U A;  1T3B A;  3PGT A;  1GUH A;  4GQC A;  2I4A A;  2I3Y A;  4TR1 B;  1LU4 A;  1K0O A;  2LQQ A;  1M2A A;  1GSF A;  5IMF A;  4F2I A;  3QDN A;  4GLT A;  2C3N A;  3VPT A;  2I9H A;  4TXO A;  5HFI A;  2B7K A;  1VGL A;  2JSZ A;  3APQ A;  1XWG A;  5D96 A;  5ID2 B;  5DDL A;  1V2A A;  2PVO C;  1R5A A;  1KTE A;  4LMW A;  5DAL B;  5HFK A;  1XW9 A;  2R3X A;  2PVQ A;  2HZE B;  1YDK A;  3TKS A;  3C73 A;  2XPE A;  1T7P B;  3TOU A;  2GLR A;  1XFL A;  2X64 A;  4OO5 A;  3UL3 A;  1SYX A;  4HQS A;  4KB3 A;  1F6M C;  4ECJ A;  3GX0 A;  3TB2 A;  4PGT A;  5JWR B;  4FYU A;  1Z5Y E;  5F0G A;  2VL3 A;  1SEN A;  2I1U A;  3BJ5 A;  4LLR A;  3UAR A;  1PX6 A;  3M9K A;  1AUC A;  2B5Y A;  1PN9 A;  4EDZ A;  3VK9 A;  3ME8 A;  4NV5 A;  20GS A;  1XPV A;  3GRX A;  3GL5 A;  4N11 A;  1JHB A;  3TJK A;  3MDK A;  1XCC A;  1MD3 A;  3MSZ A;  2IL3 A;  12GS A;  3UVH A;  5HR3 A;  1O6J A;  3C71 A;  3LGC A;  3C7M A;  2LJR A;  3E9J B;  5ECH B;  3C1R A;  3M1G A;  2GQK A;  2C80 A;  5C00 A;  3KXO A;  1W89 A;  3BD2 A;  19GS A;  4KAE A;  3MAK A;  2JU5 A;  3LXT A;  4GST A;  2IMI A;  5DQY A;  1JZD A;  1GLP A;  3O3T A;  2ON7 A;  6GSU A;  1SK1 A;  3ERG A;  5F05 A;  4N10 A;  2VO4 A;  4RQR A;  3W6G A;  2O8V B;  4ZIL A;  9GSS A;  1EOG A;  2NDO A;  3NZN A;  3A3T A;  2PBJ A;  2H73 A;  2YAN A;  1XWK A;  3P90 A;  3HD5 A;  3L4N A;  1TK8 B;  3SBC A;  3ZYW A;  4HZ2 A;  1U87 A;  2PMT A;  1ILO A;  1ZL9 A;  1GRX A;  4ZL8 A;  3EU3 A;  4PQ1 A;  4AF2 A;  1R26 A;  2VCX A;  4OFT A;  5CAX A;  1HD2 A;  1UN2 A;  3TJB A;  2B1K A;  1GNE A;  4JU5 A;  4F9Z A;  4EXJ A;  3KM6 A;  18GS A;  1YQ1 A;  3A5W A;  5IMD A;  5KEJ A;  1A0F A;  2GST A;  4KCE A;  3LSZ A;  5E4W A;  1QGV A;  1X5D A;  2EIR A;  2VOC A;  1OE7 A;  3GST A;  5DAK A;  2C0E A;  3GUS A;  3FZ4 A;  4YH2 A;  2X8G A;  2CZ3 A;  2JZT A;  4K1F A;  1AW9 A;  3IPZ A;  3KZQ A;  3UVT A;  1TJD A;  2FCH A;  1V98 A;  4PUF C;  4XRD A;  1GL8 A;  3I6A A;  3ZIV A;  1PL2 A;  1NHO A;  2WUL A;  3QCP A;  4BVY A;  2HLS A;  4MZW A;  2A2R A;  3H8Q A;  4LL4 B;  2IJY A;  2VCT A;  1WWJ A;  2WRT A;  2E7P A;  1K0D A;  3HZ8 A;  3IRA A;  3ZL5 A;  1K0B A;  3M8N A;  4HI7 A;  4MJB A;  2MMN A;  3F6F A;  3HZ4 A;  4K7O A;  3TCO A;  1SK2 A;  1PKZ A;  4DSR A;  4AGS A;  8GSS A;  5B7C A;  2YWM A;  4NHW A;  1ZYE A;  3KH9 A;  2HRF A;  4ECC A;  2YV7 A;  4BPY A;  4K6X A;  3LOR A;  2YPM A;  2ZUP A;  4XS4 A;  3I43 A;  5B8B A;  5D93 A;  2TRC P;  5G5E A;  2QKE A;  4NAX A;  4TN8 A;  3S9F A;  5IMZ A;  3EWL A;  4Q5N A;  1SKW B;  4JR4 A;  5A4V A;  4BL7 A;  3D6I A;  2V41 A;  1G7E A;  5H5S A;  2L5O A;  3IAS 2;  2HFD A;  2AYT A;  4IJ3 A;  2HRN A;  2FY6 A;  1YF1 A;  2WZ9 A;  2CA8 A;  1X5C A;  3V1W A;  2WCI A;  1GH2 A;  2FNO A;  1QMV A;  3IK7 A;  4MJA A;  3IBH A;  2YCD A;  4Z7X A;  4OMV A;  2H8L A;  4ZB9 A;  1BG5 A;  3TJG A;  2OA7 A;  3ERW A;  4I8B A;  1SD9 A;  2AUV A;  1ACV A;  2X8C A;  1AQV A;  5HR2 A;  3W8J A;  1B48 A;  3CTG A;  5GAN D;  3HKR A;  1B9X C;  4G2E A;  3I9V 2;  4XCS A;  1AXD A;  2O7K A;  1JLW A;  4HS1 A;  2K18 A;  3IV4 A;  2L59 A;  2MZC A;  10GS A;  5G30 A;  2BTO T;  4G9H A;  5DBQ A;  1HNC A;  3W8S A;  5FWG A;  2YWO A;  1AQX A;  1FB6 A;  4J56 E;  3CYN A;  3F63 A;  4OWY A;  3E3E A;  1G6Y A;  2VUP A;  1XW5 A;  1WPI A;  2DSA A;  3FRC A;  1PSQ A;  1A23 A;  1BJX A;  2MYG A;  2ZNM A;  3UEM A;  4HJ2 A;  3TDG A;  4NMU A;  2WB9 A;  2H66 A;  5AIS A;  4HJM A;  1O81 A;  5LD0 A;  2CAQ A;  2VM1 A;  3FHK A;  1A24 A;  2P31 A;  2H1D A;  1XXU A;  1XWC A;  3JCM L;  1VF4 A;  3KMN A;  4ZL7 A;  1DSB A;  1TI1 A;  1KNG A;  3UMA A;  5F07 A;  5G5F A;  3CSJ A;  3GMF A;  2F9S A;  4JR6 A;  1Z6N A;  1ZGN A;  2H6X A;  5G1L A;  4WBR D;  2B5X A;  3DGQ A;  2XPD A;  3R2Q A;  1EZK A;  3QMX A;  3US3 A;  2CVK A;  4ECI A;  4QL9 A;  1IYI A;  2RLI A;  2RII A;  5H5Q A;  4HU9 A;  4Q5R A;  3M3M A;  3UIW A;  3LYK A;  3TKS E;  3GTU B;  1M2B A;  1A2L A;  3G7Y A;  4TW5 A;  1URM A;  3TRP A;  4XTS A;  4I2U A;  3C1S A;  4PUA A;  4L5O A;  3RAZ A;  4CW9 A;  2OKA A;  1K3O A;  3G7J A;  4KDU A;  1XOB A;  4TR3 A;  4L0W A;  4RUV A;  4F03 A;  1M7T A;  3F3Q A;  1OVN A;  5GAP D;  5DCH A;  4OFM A;  1OE8 A;  3VI7 A;  3HY2 A;  5JWQ B;  4PNF A;  2FHE A;  5HFG A;  1O8W A;  4ZB8 A;  4K7I A;  2E0Q A;  2JSY A;  1LJR A;  1B8X A;  3VFI A;  4EO3 A;  2R6K A;  5IIZ A;  1NHY A;  3ZRD A;  3IDV A;  1R5P A;  1ERW A;  3FEU A;  2ALB A;  4I97 A;  4WR5 A;  5D9V A;  3SWL A;  1TK5 B;  4GXZ A;  5IQY A;  4N30 A;  1R4W A;  3FZ9 A;  3TKR A;  1PL1 A;  3ZLP A;  1H75 A;  2GZY A;  1XZO A;  3VUR A;  1MDJ A;  4GSN A;  5CRW A;  5ECK B;  2L4C A;  1EV9 A;  2H1B A;  2OJL A;  4K7N A;  5DAK B;  4O7H A;  4RI7 A;  3APO A;  1F3A A;  3J7Y k;  2B7J A;  2H1G A;  2O85 A;  3DIE A;  3CBU A;  3HYP A;  4DSQ A;  1V57 A;  4LL1 B;  4BWS A;  3GV1 A;  1HQO A;  4X1U A;  4IVF A;  6GSV A;  3ZRE A;  4K8M A;  3QFA C;  4KX4 A;  2NTO A;  2XBI A;  3KP8 A;  1BAY A;  2A2S A;  2GGT A;  3VI5 A;  5AIX A;  2M72 A;  1K0A A;  1TU8 A;  4DSS A;  2DC5 A;  2JZS A;  2C0D A;  2QGV A;  4POL A;  2YWI A;  5D9T A;  5ABR A;  1ZZY A;  3A2W A;  4FYB A;  3N5O A;  2ON5 A;  5DCG A;  5B8A A;  2QC7 A;  2IIY A;  1HNA A;  5CRG A;  3TUE A;  1K0N A;  3L9V A;  2GS3 A;  4IQ1 A;  5D9X A;  5IPH A;  2BJX A;  4MF5 A;  1USB A;  2H74 A;  3EU4 A;  5IMV A;  2H76 A;  1XW6 A;  1M9A A;  1U6T A;  2JZR A;  2YN1 A;  4XS4 B;  4V2L A;  1T8E B;  4ISD A;  3VPQ A;  2B5E A;  1O8X A;  3KP9 A;  2GZZ A;  3FK8 A;  2OAD A;  1FHE A;  2IFQ A;  3D0Z A;  1PD2 1;  2VD0 A;  4WF5 A;  1TRU A;  2PPT A;  4KSM A;  2I81 A;  1K3Y A;  1F9M A;  2V6O A;  3GKX A;  3PH9 A;  1OC9 B;  4K0G A;  4MF7 A;  4EL1 A;  3QR6 A;  2O87 A;  4O92 A;  4ZBB A;  4HUA A;  1TDI A;  2LRC A;  5IMA A;  1NM3 A;  2EIQ A;  3EUR A;  1ERU A;  1TP9 A;  3IC4 A;  3ZMK A;  6GST A;  4H86 A;  3RHC A;  2VCZ A;  2G0F A;  3KTL A;  2LRT A;  3DXB A;  2PGT A;  1JZW A;  3ED3 A;  2JAC A;  3U5R E;  4IP1 A;  3GA4 A;  1A0R P;  1SL0 B;  4KDX A;  3I69 A;  1U3I A;  1PQN A;  1TTZ A;  3GH6 A;  2J23 A;  4MA9 A;  2DJJ A;  3RHB A;  1E2Y A;  3TOT A;  1U3A A;  1WOU A;  3KH7 A;  4IJI A;  3HJP A;  1SJI A;  3VWU A;  3N9J A;  2N5F A;  3UBL A;  4PQH A;  5CO3 A;  3GHA A;  3BCK A;  1O85 A;  2D2Z A;  4MJE A;  2P5R A;  1QK8 A;  2REM A;  3CRU A;  3F8U A;  4ID0 A;  3F4T A;  1M2D A;  3ZFB A;  1FW1 A;  2DIZ A;  1GUK A;  3ZVJ A;  2LJK A;  2LNT A;  4GF0 A;  1BED A;  1XVW A;  2XHF A;  3DRN A;  4LMV A;  3PIN A;  3CTF A;  3QAW A;  1WIK A;  3TKS C;  4NWY A;  4TVE A;  3IHQ A;  5ECI B;  3AY8 A;  3GH9 A; 
#chains in the Genus database with same CATH topology
 17GS A;  3F4S A;  2V6E A;  5EL8 A;  1GTU A;  3GKN A;  3FBV A;  1ERT A;  1Z7R A;  1UC7 A;  3NIV A;  4YAP A;  3UIT A;  3LWA A;  3EIN A;  2C0G A;  5DVB A;  4YQU A;  3TJF A;  5G1K A;  2TRX A;  3HVX A;  3D22 A;  4CHS A;  5ECM B;  1G6W A;  5IOX A;  3KTB A;  2NVL A;  1SD8 A;  1SL2 B;  4K2X A;  3UBK A;  2L6D A;  2DJK A;  1GSS A;  2CZ2 A;  1X9M B;  2CAI A;  4GCI A;  4MH2 A;  3P23 A;  3C8E A;  3J7Y b;  5BRT A;  4XS6 A;  3HVV A;  1FOH A;  3WGE A;  1ZCP A;  4O1P A;  2DJ1 A;  2L1L B;  5KN2 A;  1EEJ A;  1HYU A;  4D73 B;  2HSY A;  4V2N A;  4MP4 A;  4TR1 A;  2FA4 A;  1KEB A;  4OCE A;  1UA5 A;  5GST A;  5KN3 A;  5DJM A;  2VL9 A;  3ZML A;  1RW1 A;  4IQA A;  2CVD A;  1BQ7 A;  2X8H A;  2FWF A;  2N5B A;  4MZB A;  2H72 A;  1O7U A;  4K5S A;  3H1N A;  5D8I A;  3CXG A;  4IS0 A;  3ISO A;  4YZD A;  1FOV A;  4L8E A;  2GQM A;  6GSX A;  1V9W A;  5DAL A;  3H4K A;  5ECO B;  2LNS A;  3GUR A;  4KF9 A;  2PU9 C;  1E6B A;  3IXR A;  2GT5 A;  4HDE A;  4Q5Q A;  5ECR B;  4YQM A;  3EC3 A;  3RPP A;  4DSS B;  4O5Q A;  2L5L A;  1WE0 A;  3H93 A;  2H0H A;  5J3R A;  4G76 A;  5FT3 A;  4WKW A;  2P0G A;  1ML6 A;  2CVB A;  4PL5 A;  1PN0 A;  2EC4 A;  2PN8 A;  5ELG A;  1OAZ A;  4BIK A;  2RM5 A;  4KA0 A;  5HR1 A;  3TKQ A;  3FY7 A;  1THX A;  3HJO A;  4EF0 A;  1DE1 A;  4V2M A;  4V1A p;  5HR0 A;  2QGM A;  2HI7 A;  1J9B A;  2YP6 A;  4TXO B;  3UOM A;  1W4V A;  4G75 A;  5J5N A;  5FHI A;  3FZ5 A;  1FB0 A;  3TGZ A;  1YJ6 A;  2KP1 A;  3DYR A;  2LUS A;  1TRW A;  2C1Y A;  4YKG A;  1R7H A;  2AAW A;  4KUN A;  1JFU A;  5DQS A;  1J08 A;  1XBS A;  3DEX A;  2H0G A;  2IFQ B;  2AJQ B;  2E8G A;  4HEA 1;  4G19 A;  4Z7H A;  1O73 A;  3TJJ A;  2MBT A;  4NHZ A;  1PFO A;  4YQV A;  2DKH A;  3NOF A;  1F2E A;  4EDY A;  3KGK A;  3TKP A;  1Z9H A;  2ZW3 A;  4QL7 A;  1TK0 B;  2LRN A;  5E59 A;  2V6K A;  5LCZ A;  5KN1 A;  1TRS A;  3L9U A;  3MWH A;  4XRA A;  2YWN A;  7GSS A;  3TRQ A;  2B1L A;  1B4Q A;  4MLY A;  1QFN A;  4FIW A;  1JLV A;  4K0N A;  1EGR A;  3GNJ A;  3Q18 A;  1PA3 A;  4O5R A;  5JWO B;  4JED A;  4GWR A;  1ON4 A;  3L9S A;  3EPT A;  3LJR A;  4NPB A;  1M0U A;  4YZC A;  5CRD A;  1PRX A;  3EE2 A;  3WGD A;  4PL3 A;  3EVI A;  1TU7 A;  1XVQ A;  4TXV A;  3DA3 A;  4Q5F A;  5CP1 A;  5CRH A;  1X9W B;  2GTU A;  2IWT A;  1FG4 A;  3FR6 A;  1X9S B;  3LQ7 A;  2HE3 A;  2R2J A;  3BBY A;  2GSR A;  2FA8 A;  2WGR A;  1XIY A;  2VL2 C;  4AJ7 A;  4PNG A;  2VCQ A;  6GSS A;  4POM A;  1AIU A;  4P3Y B;  5A4W A;  2CAZ B;  2F51 A;  3GL3 A;  2OE3 A;  4MPG A;  1K0C A;  2G2Q A;  5A4U A;  4MMM A;  4KGI A;  2B3S A;  1OC8 A;  2ZCT A;  3F0I A;  2RLD A;  2R0P A;  2VLU A;  1PKW A;  1WRY A;  2VD1 A;  2P22 B;  4EKZ A;  1M3I A;  2LV3 A;  3M0F A;  1QUW A;  1YEP A;  2OE1 A;  1TOF A;  4XS1 A;  2FWE A;  2LST A;  1SKR B;  1Q4J A;  2VM2 A;  4WXT A;  3ME7 A;  1JZO A;  1T1V A;  4EUY A;  4IBP A;  5G31 A;  2DJ2 A;  3GSS A;  2V1M A;  4BA7 A;  1VF1 A;  1GTB A;  3FR9 A;  3EYT A;  2GSS A;  5COH A;  2K8V A;  4KDY A;  5JCW A;  2HRK A;  1Z3E A;  3HA9 A;  3P8W A;  2F3M A;  3LYP A;  3ZIJ A;  1AQW A;  4BVY B;  1A2J A;  1MTC A;  2RM6 A;  1EOH A;  3HHV A;  1AAZ A;  4LA1 A;  3WT2 A;  4NV2 A;  2CX3 A;  3VLN A;  1QXH A;  1SJZ A;  2P5Q A;  5EY6 A;  3B55 A;  5AN1 A;  2K9F A;  4MK3 A;  2VCW A;  4GSS A;  2DJ0 A;  5EPF A;  2J9H A;  4CDO A;  1BX9 A;  6GSW A;  1Z6M A;  1S3C A;  2MBS A;  1GWC A;  2FD3 A;  2WS2 A;  2IMK A;  1H4O A;  1XWA A;  5LNK 1;  5CNW A;  4ZIJ A;  1KBN A;  4N0Z A;  4WR4 A;  5KN0 A;  2DLX A;  4HOJ A;  2HNL A;  5C04 A;  4O5U A;  3GN3 A;  1T00 A;  4TR0 A;  3VWV A;  2YV9 A;  1ST9 A;  3D21 A;  3QOU A;  1Y25 A;  1GNW A;  2AV4 A;  1VF3 A;  4BL7 B;  3CSH A;  4AJ6 A;  1FO5 A;  4F82 A;  1TKD B;  4L5L A;  2R37 A;  1SJ8 A;  2V2G A;  2YJH A;  3IOS A;  4KCA A;  1DE2 A;  5G2Z A;  5CRE A;  3IAM 1;  4CY6 A;  4ULX A;  4ECB A;  1N8J A;  1AC1 A;  4FO5 A;  3GIX A;  2CV4 A;  3RDW A;  2H75 A;  3A2V A;  1MDK A;  1LBK A;  1RQM A;  4PUR A;  3F4R A;  4JZQ A;  3D4T A;  1EP8 A;  1PX7 A;  1EEM A;  2R4V A;  3PR8 A;  3Q74 A;  2O89 A;  3IR4 A;  1GLQ A;  4ACS A;  2HSH A;  1ERV A;  4EIP A;  1M99 A;  1G0T A;  3FZA A;  1PGT A;  4N0V A;  4ML6 A;  3FYG A;  2LQO A;  4KND A;  1MD4 A;  4MCU A;  2XBQ A;  2K6V A;  1YF0 A;  22GS A;  2DML A;  2YZU A;  2CX4 A;  4HEA 2;  1V40 A;  4OCF A;  1F3B A;  4BVX A;  4GTU A;  1TRV A;  2OAC A;  3F3R A;  2KLX A;  1SJ6 A;  5ELA A;  3QFB C;  2AHE A;  3BCI A;  5HQP A;  4I6X A;  4ZXG A;  3WGX A;  4EIQ A;  1GP1 A;  1PMT A;  3GTU A;  3OR5 A;  2H19 A;  3KIJ A;  3MIX A;  4MZC A;  5J4U A;  5J9B A;  5GSS A;  1ABA A;  1BYE A;  4OFN A;  2B6M A;  4GQF A;  2HXK A;  1EP7 A;  2JAD A;  11GS A;  3LFL A;  4HZ4 A;  3KMO A;  5ECP B;  1VRS D;  1CQG A;  2KOK A;  3SDJ A;  2DMM A;  3Q19 A;  3UAP A;  3P2A A;  4DEJ A;  1X0R A;  3QAV A;  4ILF A;  3M9J A;  4WBJ A;  1C72 A;  1XWB A;  2F8A A;  2L6C A;  2H6Y A;  2ZRR A;  4AS2 A;  1X5E A;  2TIR A;  2V32 A;  4MDC A;  3K8N A;  5J9C A;  2PER A;  5HGI A;  2FUG 2;  4JBB A;  4L0U A;  4OO4 A;  1F37 A;  1ZYP A;  2C8U A;  2IPA A;  2IMD A;  2JBW A;  2N5A A;  3GKK A;  4ZL9 A;  3EMX A;  3QD9 A;  4F0B A;  2ES7 A;  2E2M A;  5IO2 A;  2YFA A;  14GS A;  4MJC A;  1Z7P A;  1IYH A;  3DO9 A;  1FVJ A;  1K3L A;  2C0F A;  2R5G A;  3LG6 A;  4HU7 A;  1OKD A;  3WYW A;  4BWQ A;  1YY7 A;  4MH3 A;  3UJ1 A;  4E8H A;  2HYX A;  1JQO A;  2L57 A;  4Z2R A;  4JE1 A;  4XHM A;  3GX8 A;  1Q98 A;  4EE0 A;  1A8Y A;  3FVV A;  2VAF A;  2YJ7 A;  4AJ8 A;  2GT6 A;  5IMC A;  4NXI A;  2WFC A;  2YZH A;  3RPN A;  3P7X A;  4IP6 A;  2F66 B;  5IM9 A;  5EVO A;  2H70 A;  3DVW A;  1UVZ A;  1GSQ A;  4IGJ A;  3U6V A;  3ZZX A;  2GDR A;  4FYC A;  3BOA A;  3GKM A;  5AGY A;  2RUF A;  2YNX A;  3HXS A;  5IOW A;  2H71 A;  4QQ7 A;  2VLV A;  1HNB A;  2MMO A;  5ID2 A;  4TOP A;  3CMI A;  5ENU A;  2A4H A;  3HJM A;  4WF4 A;  4ML1 A;  1OYJ A;  5F06 A;  1FVK A;  5DJL A;  4IN0 A;  1OKT A;  4POB A;  1GUM A;  1RK4 A;  1YZX A;  4ZBA A;  2HZE A;  1OC3 A;  2H01 A;  3IA1 A;  2H30 A;  2M80 A;  3HDC A;  2EIO A;  3L0H A;  5ECL B;  2L4Q A;  3IHG A;  4TRX A;  3LJ0 A;  4O32 A;  2C3T A;  3APS A;  3Q6O A;  4K2D A;  4V1A g;  2C3Q A;  2VIM A;  1GSY A;  1OC9 A;  1V58 A;  1I5G A;  1WMJ A;  3DD3 A;  1S3A A;  4FH8 A;  2BMX A;  2IME A;  4PX1 A;  4JRR A;  4MPF A;  3D4M A;  5ECN B;  13GS A;  3DWV A;  4KH7 A;  3IE3 A;  2OBK A;  3VWX A;  4MAB A;  1B9Y C;  2X99 A;  4K9Z A;  2FLS A;  1NSW A;  2VL2 A;  3IK9 A;  4F0C A;  3TRX A;  2CT6 A;  2LTK A;  1WP0 A;  3KEB A;  1CQH A;  2JL4 A;  2IMF A;  2DJ3 A;  2H1A A;  3VA9 A;  4YAV A;  5LNK e;  2PWJ A;  3E0U A;  2LS5 A;  1U88 A;  3LJ2 A;  2A4V A;  2HZF A;  4WEY A;  3IAM 2;  2A2D A;  4IKH A;  4X0X A;  2UZ8 A;  1EWX A;  2H0I A;  2C4J A;  2PUK C;  5AIV A;  3ZFL A;  3ZTL A;  5D9W A;  4HQZ A;  4PQI A;  1S3D A;  4MNN A;  1GSU A;  4YZ9 A;  2AB6 A;  5H5R A;  2XC2 A;  2HT9 A;  3ZIT A;  2DBC A;  3DKS A;  2XTR A;  1B4P A;  2F8F A;  3D5J A;  3FKF A;  3R3E A;  5JCU A;  1SU9 A;  5A5K A;  4ZB6 A;  2JB3 A;  1MEK A;  3KJY A;  4Q9V A;  1TW9 A;  4G0K A;  2FGX A;  3DML A;  3HCZ A;  1SK0 A;  1G7O A;  3G7I A;  1EGO A;  4EVM A;  4IEL A;  5GZZ B;  4G10 A;  4IW9 A;  2FUG 1;  2WDU A;  4J57 E;  2LJA A;  1K0M A;  3EMP A;  1GTI A;  5ECQ B;  3CSI A;  16GS A;  1TXX A;  3QPM A;  6GSY A;  1M9B A;  1GUL A;  2E2G A;  2KP2 A;  2OBI A;  1ZYQ B;  4AS3 A;  2GZP A;  5F8B A;  1YKA A;  3G9B A;  2GVP A;  3CRT A;  3L78 A;  5IO0 A;  1J0F A;  5JCG A;  2KHP A;  2R0C A;  4POK A;  3A2X A;  2Z9S A;  2MMA A;  3WT1 A;  2DKI A;  3LEF A;  4RQX A;  1WJK A;  2GSQ A;  2GQL A;  4WET A;  1GTA A;  2OE0 A;  2CQ9 A;  3ZVJ D;  1A8L A;  4TKY A;  3FR3 A;  1N2A A;  5CYY A;  2YOI A;  4IHU A;  1Y6E A;  2WJU A;  3KCM A;  1EV4 A;  3MNG A;  2VLT A;  5ECS A;  3HVS A;  2IN3 A;  4HSC X;  1TI3 A;  5B6N A;  3WD6 A;  4KW6 A;  2H6Z A;  2FWH A;  3QAG A;  1THO A;  2VCV A;  5B6M A;  4D73 A;  2LEG A;  1VF2 A;  4TR4 A;  3VWW A;  2K8S A;  4X4J A;  4OD7 A;  4ZBD A;  4GRF A;  2RUE A;  3FW2 A;  4XIH A;  4I2T A;  1GSD A;  2M46 A;  4E8E A;  1ZOF A;  1QQ2 A;  1JZR A;  1ZMA A;  1SKS B;  3O6T A;  3ERF A;  1SYR A;  4MF6 A;  2X49 A;  1XOA A;  3H79 A;  2NBS A;  3LXZ A;  5IPG A;  4KE3 A;  2KUC A;  4J2F A;  1SL1 B;  1T4Y A;  2FWG A;  1YEX A;  1FAA A;  2NPB A;  4X43 A;  1DBY A;  4DVC A;  1MDI A;  1A2M A;  4PXO A;  3KD0 A;  2QSI A;  3O76 A;  1DUG A;  4I5Q A;  5L71 A;  5KOX A;  1I9D A;  4RI6 A;  3F6D A;  1NW2 A;  1T4Z A;  3IAS 1;  2DIY A;  5INY A;  4KSO A;  3GFK A;  2MMZ A;  5D73 A;  3GYK A;  2ETD A;  2LKU A;  1GSE A;  4EC0 A;  5J41 A;  3DVX A;  1YKC A;  3RBT A;  3F9U A;  1T3B A;  4Z7G A;  3PGT A;  1GUH A;  2JAE A;  2YFB A;  4GQC A;  2I4A A;  2I3Y A;  4TR1 B;  1LU4 A;  1K0O A;  2LQQ A;  1M2A A;  1GSF A;  5IMF A;  4F2I A;  4G0L A;  3QDN A;  4GLT A;  2C3N A;  3VPT A;  4Z2T A;  2I9H A;  4TXO A;  5HFI A;  2B7K A;  1VGL A;  3I9V 1;  2JSZ A;  3APQ A;  1XWG A;  5D96 A;  5ID2 B;  5DDL A;  1V2A A;  2PVO C;  1R5A A;  1KTE A;  4LMW A;  5DAL B;  5HFK A;  1XW9 A;  2R3X A;  2PVQ A;  2HZE B;  1YDK A;  3TKS A;  3C73 A;  2XPE A;  1T7P B;  3TOU A;  2GLR A;  1XFL A;  2X64 A;  4OO5 A;  3UL3 A;  1SYX A;  4HQS A;  4KB3 A;  1F6M C;  4ECJ A;  3GX0 A;  3TB2 A;  4PGT A;  5JWR B;  4FYU A;  1Z5Y E;  2QZG A;  5F0G A;  2GSC A;  2VL3 A;  1SEN A;  2I1U A;  3BJ5 A;  4LLR A;  3UAR A;  1PX6 A;  3M9K A;  1AUC A;  2B5Y A;  2QA2 A;  4PTS A;  1PN9 A;  4EDZ A;  3VK9 A;  3ME8 A;  4NV5 A;  20GS A;  2MJF B;  1XPV A;  3GRX A;  3GL5 A;  4N11 A;  1JHB A;  3TJK A;  3MDK A;  1XCC A;  4OAV B;  1MD3 A;  3MSZ A;  2IL3 A;  12GS A;  3UVH A;  5HR3 A;  3CQF A;  1O6J A;  3C71 A;  3LGC A;  3C7M A;  2LJR A;  3E9J B;  5ECH B;  3C1R A;  3M1G A;  2GQK A;  2C80 A;  5C00 A;  1YO7 A;  3KXO A;  1W89 A;  3BD2 A;  19GS A;  4KAE A;  3MAK A;  2JU5 A;  3LXT A;  4GST A;  2IMI A;  5DQY A;  1JZD A;  2BL7 A;  1GLP A;  3O3T A;  2ON7 A;  6GSU A;  1SK1 A;  3ERG A;  5F05 A;  4N10 A;  2VO4 A;  4RQR A;  3W6G A;  2O8V B;  4ZIL A;  9GSS A;  1EOG A;  2NDO A;  3NZN A;  3A3T A;  4JCV E;  2PBJ A;  2H73 A;  2YAN A;  1XWK A;  3P90 A;  3HD5 A;  3L4N A;  1TK8 B;  2X4A A;  3SBC A;  3ZYW A;  3LJ1 A;  4HZ2 A;  1U87 A;  2PMT A;  1ILO A;  1ZL9 A;  1GRX A;  4ZL8 A;  3EU3 A;  3FMW A;  4PQ1 A;  4AF2 A;  1R26 A;  2VCX A;  4OFT A;  5CAX A;  1HD2 A;  1UN2 A;  3TJB A;  2B1K A;  1GNE A;  4JU5 A;  4F9Z A;  4EXJ A;  3KM6 A;  18GS A;  1YQ1 A;  3A5W A;  5IMD A;  5KEJ A;  1A0F A;  2GST A;  4KCE A;  3LSZ A;  1QGV A;  1X5D A;  2EIR A;  2VOC A;  5E4W A;  1OE7 A;  1S3R A;  3GST A;  5DAK A;  2C0E A;  3GUS A;  3FZ4 A;  4YH2 A;  2X8G A;  2CZ3 A;  2JZT A;  4K1F A;  1AW9 A;  3IPZ A;  3KZQ A;  3UVT A;  1TJD A;  2FCH A;  1V98 A;  4PUF C;  4XRD A;  1GL8 A;  3I6A A;  3ZIV A;  1PL2 A;  1NHO A;  2WUL A;  3QCP A;  4BVY A;  2HLS A;  4MZW A;  2A2R A;  3H8Q A;  4LL4 B;  2IJY A;  2VCT A;  1WWJ A;  2WRT A;  2E7P A;  1K0D A;  3HZ8 A;  3IRA A;  3ZL5 A;  1K0B A;  3M8N A;  4HI7 A;  4MJB A;  2MMN A;  3F6F A;  3HZ4 A;  4HFV A;  3A5I A;  4K7O A;  3TCO A;  1SK2 A;  1PKZ A;  4DSR A;  4AGS A;  8GSS A;  4DWL A;  5B7C A;  2YWM A;  4NHW A;  1ZYE A;  3KH9 A;  2HRF A;  4ECC A;  2YV7 A;  4BPY A;  4K6X A;  3LOR A;  3FNB A;  2YPM A;  2ZUP A;  4XS4 A;  3AJF A;  3I43 A;  3IC8 A;  5B8B A;  5D93 A;  2FEF A;  2TRC P;  5G5E A;  2QKE A;  4NAX A;  4TN8 A;  3S9F A;  5IMZ A;  3EWL A;  4Q5N A;  1SKW B;  4JR4 A;  5A4V A;  4BL7 A;  3D6I A;  2V41 A;  1XG8 A;  1G7E A;  5H5S A;  2L5O A;  3IAS 2;  2HFD A;  2AYT A;  4IJ3 A;  2HRN A;  2FY6 A;  1YF1 A;  2WZ9 A;  2CA8 A;  4PL4 A;  1X5C A;  4GXT A;  3V1W A;  2WCI A;  4USS A;  1GH2 A;  2A2C A;  2FNO A;  1QMV A;  3IK7 A;  4O1O A;  4MJA A;  3IBH A;  2YCD A;  4Z7X A;  2K19 A;  2JB1 A;  4OMV A;  2H8L A;  4ZB9 A;  1BG5 A;  3TJG A;  2OA7 A;  3ERW A;  4I8B A;  1SD9 A;  2AUV A;  1ACV A;  2X8C A;  1AQV A;  5HR2 A;  3W8J A;  1B48 A;  3CTG A;  5GAN D;  3HKR A;  1B9X C;  4G2E A;  3I9V 2;  4XCS A;  1AXD A;  2O7K A;  1JLW A;  2XMX A;  3L0I A;  4HS1 A;  2K18 A;  3IV4 A;  2L59 A;  2MZC A;  10GS A;  5G30 A;  2BTO T;  3DA4 A;  4G9H A;  5DBQ A;  1HNC A;  3W8S A;  5FWG A;  2YWO A;  4A5P A;  1AQX A;  1FB6 A;  4J56 E;  3CYN A;  3PPU A;  3F63 A;  4OWY A;  3Q8D A;  3E3E A;  1TDP A;  1G6Y A;  1W3S A;  2VUP A;  4K5R A;  1XW5 A;  1WPI A;  2DSA A;  3FRC A;  1PSQ A;  1A23 A;  1BJX A;  2MYG A;  2ZNM A;  3UEM A;  4HJ2 A;  3TDG A;  4NMU A;  2WB9 A;  2H66 A;  5AIS A;  4HJM A;  1O81 A;  2KKM A;  4OAU C;  5LD0 A;  2CAQ A;  2VM1 A;  3FHK A;  1A24 A;  2P31 A;  2H1D A;  1XXU A;  1XWC A;  3JCM L;  1VF4 A;  3KMN A;  4ZL7 A;  1DSB A;  1TI1 A;  1KNG A;  3UMA A;  5F07 A;  5G5F A;  3CSJ A;  3GMF A;  2F9S A;  4JR6 A;  1Z6N A;  1ZGN A;  2H6X A;  5G1L A;  4WBR D;  2B5X A;  3DGQ A;  2XPD A;  3R2Q A;  1EZK A;  4BVX B;  3QMX A;  3US3 A;  2CVK A;  4ECI A;  4QL9 A;  1IYI A;  2RLI A;  2RII A;  5H5Q A;  4HU9 A;  4Q5R A;  3M3M A;  3UIW A;  3LYK A;  3TKS E;  3GTU B;  1M2B A;  2HGK A;  3HVN A;  1A2L A;  2RIO A;  3G7Y A;  1URM A;  4TW5 A;  3TRP A;  1M3J A;  4XTS A;  4I2U A;  3C1S A;  2F6M B;  4PUA A;  4L5O A;  3RAZ A;  4CW9 A;  2OKA A;  1K3O A;  3G7J A;  4KDU A;  1XOB A;  3F4M A;  4TR3 A;  4L0W A;  4RUV A;  4F03 A;  1M7T A;  3F3Q A;  1OVN A;  5GAP D;  5DCH A;  4OFM A;  1OE8 A;  3VI7 A;  3HY2 A;  5JWQ B;  4PNF A;  2FHE A;  5HFG A;  1O8W A;  4ZB8 A;  4K7I A;  2E0Q A;  2QA1 A;  2JSY A;  1LJR A;  1B8X A;  4ICY A;  3VFI A;  4EO3 A;  2R6K A;  5IIZ A;  1NHY A;  3ZRD A;  3IDV A;  1R5P A;  3MYD A;  1ERW A;  3FEU A;  2ALB A;  4I97 A;  4WR5 A;  5D9V A;  3SWL A;  1TK5 B;  4GXZ A;  5IQY A;  4N30 A;  1R4W A;  3FZ9 A;  3TKR A;  1PL1 A;  3ZLP A;  1H75 A;  2GZY A;  1XZO A;  3VUR A;  1MDJ A;  2HSM A;  4GSN A;  5CRW A;  5ECK B;  1ZYN A;  2L4C A;  1EV9 A;  2H1B A;  2OJL A;  4K7N A;  5DAK B;  4O7H A;  4RI7 A;  3APO A;  4U6R A;  1F3A A;  3J7Y k;  2B7J A;  2H1G A;  2O85 A;  3DIE A;  1U5K A;  3CBU A;  2HRA A;  3HYP A;  4DSQ A;  1V57 A;  4LL1 B;  4BWS A;  3GV1 A;  1HQO A;  4X1U A;  4IVF A;  6GSV A;  3ZRE A;  4K8M A;  3QFA C;  4KX4 A;  2NTO A;  2XBI A;  3KP8 A;  1BAY A;  2A2S A;  2GGT A;  3VI5 A;  5AIX A;  2M72 A;  1K0A A;  1TU8 A;  4DSS A;  2DC5 A;  4YKF A;  2JZS A;  2C0D A;  2QGV A;  4POL A;  2YWI A;  5D9T A;  5ABR A;  1ZZY A;  3A2W A;  4FYB A;  3N5O A;  2ON5 A;  5DCG A;  5B8A A;  2QC7 A;  2IIY A;  1HNA A;  5CRG A;  3TUE A;  2V1C C;  1K0N A;  3L9V A;  2GS3 A;  2R0G A;  4IQ1 A;  5D9X A;  5IPH A;  2BJX A;  4MF5 A;  1USB A;  2H74 A;  3EU4 A;  5IMV A;  2H76 A;  1XW6 A;  1M9A A;  1U6T A;  2JZR A;  2YN1 A;  4XS4 B;  4V2L A;  1T8E B;  4ISD A;  3VPQ A;  2B5E A;  1O8X A;  3KP9 A;  2GZZ A;  3FK8 A;  2OAD A;  2FU2 A;  1FHE A;  2IFQ A;  3D0Z A;  3JSB A;  1PD2 1;  2VD0 A;  4WF5 A;  1TRU A;  2PPT A;  4KSM A;  2I81 A;  1K3Y A;  1F9M A;  2V6O A;  3GKX A;  3PH9 A;  1OC9 B;  4K0G A;  4MF7 A;  4EL1 A;  3QR6 A;  2O87 A;  4O92 A;  2IP6 A;  4ZBB A;  4HUA A;  1TDI A;  2LRC A;  5IMA A;  1NM3 A;  2EIQ A;  3EUR A;  1ERU A;  1TP9 A;  3IC4 A;  3ZMK A;  6GST A;  4H86 A;  3RHC A;  2VCZ A;  2G0F A;  3KTL A;  2LRT A;  3DXB A;  2XTQ A;  1JZW A;  2PGT A;  3ED3 A;  4CY8 A;  2JAC A;  3U5R E;  4IP1 A;  3GA4 A;  1A0R P;  1SL0 B;  4KDX A;  3I69 A;  1U3I A;  1PQN A;  1TTZ A;  3GH6 A;  2J23 A;  4MA9 A;  2DJJ A;  3RHB A;  4FQU A;  2RAD A;  1E2Y A;  3TOT A;  1U3A A;  1WOU A;  3KH7 A;  4IJI A;  3HJP A;  1SJI A;  3VWU A;  3N9J A;  2N5F A;  3UBL A;  4PQH A;  5CO3 A;  3GHA A;  3BCK A;  1O85 A;  2D2Z A;  4MJE A;  2P5R A;  1QK8 A;  2REM A;  5KOW A;  3CRU A;  5BMU A;  3F8U A;  4ID0 A;  3F4T A;  1M2D A;  3ZFB A;  2BL8 A;  1FW1 A;  2DIZ A;  1GUK A;  3ZVJ A;  2LJK A;  2LNT A;  4GF0 A;  1BED A;  2JB2 A;  2QSB A;  2A2P A;  1XVW A;  2XHF A;  3DRN A;  4LMV A;  3PIN A;  3CTF A;  3LW9 A;  1WIK A;  3QAW A;  4G0I A;  3TKS C;  4Z2U A;  4NWY A;  4I1T A;  4TVE A;  3IHQ A;  5ECI B;  3AY8 A;  3GH9 A; 
#chains in the Genus database with same CATH homology
 17GS A;  3F4S A;  2V6E A;  5EL8 A;  1GTU A;  3GKN A;  3FBV A;  1ERT A;  1Z7R A;  1UC7 A;  3NIV A;  4YAP A;  3UIT A;  3LWA A;  3EIN A;  2C0G A;  5DVB A;  4YQU A;  3TJF A;  5G1K A;  2TRX A;  3HVX A;  3D22 A;  4CHS A;  5ECM B;  1G6W A;  5IOX A;  3KTB A;  2NVL A;  1SD8 A;  1SL2 B;  4K2X A;  3UBK A;  2L6D A;  2DJK A;  1GSS A;  2CZ2 A;  1X9M B;  2CAI A;  4GCI A;  4MH2 A;  3P23 A;  3C8E A;  3J7Y b;  5BRT A;  4XS6 A;  3HVV A;  1FOH A;  3WGE A;  1ZCP A;  4O1P A;  2DJ1 A;  2L1L B;  5KN2 A;  1EEJ A;  1HYU A;  4D73 B;  2HSY A;  4V2N A;  4MP4 A;  4TR1 A;  2FA4 A;  1KEB A;  4OCE A;  1UA5 A;  5GST A;  5KN3 A;  5DJM A;  2VL9 A;  3ZML A;  1RW1 A;  4IQA A;  2CVD A;  1BQ7 A;  2X8H A;  2FWF A;  2N5B A;  4MZB A;  2H72 A;  1O7U A;  4K5S A;  3H1N A;  5D8I A;  3CXG A;  4IS0 A;  3ISO A;  4YZD A;  1FOV A;  4L8E A;  2GQM A;  6GSX A;  1V9W A;  5DAL A;  3H4K A;  5ECO B;  2LNS A;  3GUR A;  4KF9 A;  2PU9 C;  1E6B A;  3IXR A;  2GT5 A;  4HDE A;  4Q5Q A;  5ECR B;  4YQM A;  3EC3 A;  3RPP A;  4DSS B;  4O5Q A;  2L5L A;  1WE0 A;  3H93 A;  2H0H A;  5J3R A;  4G76 A;  5FT3 A;  4WKW A;  2P0G A;  1ML6 A;  2CVB A;  4PL5 A;  1PN0 A;  2EC4 A;  2PN8 A;  5ELG A;  1OAZ A;  2RM5 A;  4KA0 A;  5HR1 A;  3TKQ A;  3FY7 A;  1THX A;  3HJO A;  4EF0 A;  1DE1 A;  4V2M A;  4V1A p;  5HR0 A;  2HI7 A;  1J9B A;  2YP6 A;  4TXO B;  3UOM A;  1W4V A;  4G75 A;  5J5N A;  5FHI A;  3FZ5 A;  1FB0 A;  3TGZ A;  1YJ6 A;  2KP1 A;  3DYR A;  2LUS A;  1TRW A;  2C1Y A;  4YKG A;  1R7H A;  2AAW A;  4KUN A;  1JFU A;  5DQS A;  1J08 A;  1XBS A;  3DEX A;  2H0G A;  2IFQ B;  2AJQ B;  2E8G A;  4HEA 1;  4G19 A;  4Z7H A;  1O73 A;  3TJJ A;  2MBT A;  4NHZ A;  4YQV A;  2DKH A;  3NOF A;  1F2E A;  4EDY A;  3KGK A;  3TKP A;  1Z9H A;  4QL7 A;  1TK0 B;  2LRN A;  5E59 A;  2V6K A;  5LCZ A;  5KN1 A;  1TRS A;  3L9U A;  3MWH A;  4XRA A;  2YWN A;  7GSS A;  3TRQ A;  2B1L A;  1B4Q A;  4MLY A;  1QFN A;  4FIW A;  1JLV A;  4K0N A;  1EGR A;  3GNJ A;  3Q18 A;  1PA3 A;  4O5R A;  5JWO B;  4JED A;  4GWR A;  1ON4 A;  3L9S A;  3EPT A;  3LJR A;  4NPB A;  1M0U A;  4YZC A;  5CRD A;  1PRX A;  3EE2 A;  3WGD A;  4PL3 A;  3EVI A;  1TU7 A;  1XVQ A;  4TXV A;  3DA3 A;  4Q5F A;  5CP1 A;  5CRH A;  1X9W B;  2GTU A;  2IWT A;  1FG4 A;  3FR6 A;  1X9S B;  3LQ7 A;  2HE3 A;  2R2J A;  3BBY A;  2GSR A;  2FA8 A;  2WGR A;  1XIY A;  2VL2 C;  4AJ7 A;  4PNG A;  2VCQ A;  6GSS A;  4POM A;  1AIU A;  4P3Y B;  5A4W A;  2CAZ B;  2F51 A;  3GL3 A;  2OE3 A;  4MPG A;  1K0C A;  2G2Q A;  5A4U A;  4MMM A;  4KGI A;  2B3S A;  1OC8 A;  2ZCT A;  3F0I A;  2R0P A;  2VLU A;  1PKW A;  1WRY A;  2VD1 A;  2P22 B;  4EKZ A;  2LV3 A;  3M0F A;  1QUW A;  1YEP A;  2OE1 A;  1TOF A;  4XS1 A;  2FWE A;  2LST A;  1SKR B;  1Q4J A;  2VM2 A;  4WXT A;  3ME7 A;  1JZO A;  1T1V A;  4EUY A;  4IBP A;  5G31 A;  2DJ2 A;  3GSS A;  2V1M A;  4BA7 A;  1VF1 A;  1GTB A;  3FR9 A;  3EYT A;  2GSS A;  5COH A;  2K8V A;  4KDY A;  5JCW A;  2HRK A;  1Z3E A;  3HA9 A;  3P8W A;  2F3M A;  3LYP A;  3ZIJ A;  1AQW A;  4BVY B;  1A2J A;  1MTC A;  2RM6 A;  1EOH A;  3HHV A;  1AAZ A;  4LA1 A;  3WT2 A;  4NV2 A;  2CX3 A;  3VLN A;  1QXH A;  1SJZ A;  2P5Q A;  5EY6 A;  5AN1 A;  2K9F A;  4MK3 A;  2VCW A;  4GSS A;  2DJ0 A;  5EPF A;  2J9H A;  4CDO A;  1BX9 A;  6GSW A;  1Z6M A;  1S3C A;  2MBS A;  1GWC A;  2FD3 A;  2WS2 A;  2IMK A;  1H4O A;  1XWA A;  5LNK 1;  5CNW A;  4ZIJ A;  1KBN A;  4N0Z A;  4WR4 A;  5KN0 A;  2DLX A;  4HOJ A;  2HNL A;  5C04 A;  4O5U A;  3GN3 A;  1T00 A;  4TR0 A;  3VWV A;  2YV9 A;  1ST9 A;  3D21 A;  3QOU A;  1Y25 A;  1GNW A;  2AV4 A;  1VF3 A;  4BL7 B;  3CSH A;  4AJ6 A;  1FO5 A;  4F82 A;  1TKD B;  4L5L A;  2R37 A;  1SJ8 A;  2V2G A;  2YJH A;  3IOS A;  4KCA A;  1DE2 A;  5G2Z A;  5CRE A;  3IAM 1;  4CY6 A;  4ULX A;  4ECB A;  1N8J A;  1AC1 A;  4FO5 A;  3GIX A;  2CV4 A;  3RDW A;  2H75 A;  3A2V A;  1MDK A;  1LBK A;  1RQM A;  4PUR A;  3F4R A;  4JZQ A;  3D4T A;  1EP8 A;  1PX7 A;  1EEM A;  2R4V A;  3PR8 A;  3Q74 A;  2O89 A;  3IR4 A;  1GLQ A;  4ACS A;  2HSH A;  1ERV A;  4EIP A;  1M99 A;  1G0T A;  3FZA A;  1PGT A;  4N0V A;  4ML6 A;  3FYG A;  2LQO A;  4KND A;  1MD4 A;  4MCU A;  2XBQ A;  2K6V A;  1YF0 A;  22GS A;  2DML A;  2YZU A;  2CX4 A;  4HEA 2;  1V40 A;  4OCF A;  1F3B A;  4BVX A;  4GTU A;  1TRV A;  2OAC A;  3F3R A;  2KLX A;  1SJ6 A;  5ELA A;  3QFB C;  2AHE A;  3BCI A;  5HQP A;  4I6X A;  4ZXG A;  3WGX A;  4EIQ A;  1GP1 A;  1PMT A;  3GTU A;  3OR5 A;  2H19 A;  3KIJ A;  3MIX A;  4MZC A;  5J4U A;  5J9B A;  5GSS A;  1ABA A;  1BYE A;  4OFN A;  2B6M A;  4GQF A;  2HXK A;  1EP7 A;  2JAD A;  11GS A;  3LFL A;  4HZ4 A;  3KMO A;  5ECP B;  1VRS D;  1CQG A;  2KOK A;  3SDJ A;  2DMM A;  3Q19 A;  3UAP A;  3P2A A;  4DEJ A;  1X0R A;  3QAV A;  4ILF A;  3M9J A;  4WBJ A;  1C72 A;  1XWB A;  2F8A A;  2L6C A;  2H6Y A;  2ZRR A;  4AS2 A;  1X5E A;  2TIR A;  2V32 A;  4MDC A;  3K8N A;  5J9C A;  2PER A;  5HGI A;  2FUG 2;  4JBB A;  4L0U A;  4OO4 A;  1F37 A;  1ZYP A;  2C8U A;  2IPA A;  2IMD A;  2N5A A;  3GKK A;  4ZL9 A;  3EMX A;  3QD9 A;  4F0B A;  2ES7 A;  2E2M A;  5IO2 A;  2YFA A;  14GS A;  4MJC A;  1Z7P A;  1IYH A;  3DO9 A;  1FVJ A;  1K3L A;  2C0F A;  2R5G A;  3LG6 A;  4HU7 A;  1OKD A;  3WYW A;  4BWQ A;  1YY7 A;  4MH3 A;  3UJ1 A;  4E8H A;  2HYX A;  2L57 A;  4Z2R A;  4JE1 A;  4XHM A;  3GX8 A;  1Q98 A;  4EE0 A;  1A8Y A;  2VAF A;  2YJ7 A;  4AJ8 A;  2GT6 A;  5IMC A;  4NXI A;  2WFC A;  2YZH A;  3RPN A;  3P7X A;  4IP6 A;  2F66 B;  5IM9 A;  5EVO A;  2H70 A;  3DVW A;  1UVZ A;  1GSQ A;  4IGJ A;  3U6V A;  3ZZX A;  2GDR A;  4FYC A;  3BOA A;  3GKM A;  5AGY A;  2RUF A;  2YNX A;  3HXS A;  5IOW A;  2H71 A;  4QQ7 A;  2VLV A;  1HNB A;  2MMO A;  5ID2 A;  4TOP A;  3CMI A;  5ENU A;  2A4H A;  3HJM A;  4WF4 A;  4ML1 A;  1OYJ A;  5F06 A;  1FVK A;  5DJL A;  4IN0 A;  1OKT A;  4POB A;  1GUM A;  1RK4 A;  1YZX A;  4ZBA A;  2HZE A;  1OC3 A;  2H01 A;  3IA1 A;  2H30 A;  2M80 A;  3HDC A;  2EIO A;  3L0H A;  5ECL B;  2L4Q A;  3IHG A;  4TRX A;  3LJ0 A;  4O32 A;  2C3T A;  3APS A;  3Q6O A;  4K2D A;  4V1A g;  2C3Q A;  2VIM A;  1GSY A;  1OC9 A;  1V58 A;  1I5G A;  1WMJ A;  3DD3 A;  1S3A A;  4FH8 A;  2BMX A;  2IME A;  4PX1 A;  4JRR A;  4MPF A;  3D4M A;  5ECN B;  13GS A;  3DWV A;  4KH7 A;  3IE3 A;  2OBK A;  3VWX A;  4MAB A;  1B9Y C;  2X99 A;  4K9Z A;  2FLS A;  1NSW A;  2VL2 A;  3IK9 A;  4F0C A;  3TRX A;  2CT6 A;  2LTK A;  1WP0 A;  3KEB A;  1CQH A;  2JL4 A;  2IMF A;  2DJ3 A;  2H1A A;  3VA9 A;  4YAV A;  5LNK e;  2PWJ A;  3E0U A;  2LS5 A;  1U88 A;  3LJ2 A;  2A4V A;  2HZF A;  4WEY A;  3IAM 2;  2A2D A;  4IKH A;  4X0X A;  2UZ8 A;  1EWX A;  2H0I A;  2C4J A;  2PUK C;  5AIV A;  3ZFL A;  3ZTL A;  5D9W A;  4HQZ A;  4PQI A;  1S3D A;  4MNN A;  1GSU A;  4YZ9 A;  2AB6 A;  5H5R A;  2XC2 A;  2HT9 A;  3ZIT A;  2DBC A;  3DKS A;  2XTR A;  1B4P A;  2F8F A;  3D5J A;  3FKF A;  3R3E A;  5JCU A;  1SU9 A;  5A5K A;  4ZB6 A;  2JB3 A;  1MEK A;  3KJY A;  4Q9V A;  1TW9 A;  4G0K A;  2FGX A;  3DML A;  3HCZ A;  1SK0 A;  1G7O A;  3G7I A;  1EGO A;  4EVM A;  4IEL A;  5GZZ B;  4G10 A;  4IW9 A;  2FUG 1;  2WDU A;  4J57 E;  2LJA A;  1K0M A;  3EMP A;  1GTI A;  5ECQ B;  3CSI A;  16GS A;  1TXX A;  3QPM A;  6GSY A;  1M9B A;  1GUL A;  2E2G A;  2KP2 A;  2OBI A;  1ZYQ B;  4AS3 A;  2GZP A;  5F8B A;  1YKA A;  3G9B A;  2GVP A;  3CRT A;  3L78 A;  5IO0 A;  1J0F A;  5JCG A;  2KHP A;  2R0C A;  4POK A;  3A2X A;  2Z9S A;  2MMA A;  3WT1 A;  2DKI A;  3LEF A;  4RQX A;  1WJK A;  2GSQ A;  2GQL A;  4WET A;  1GTA A;  2OE0 A;  2CQ9 A;  3ZVJ D;  1A8L A;  4TKY A;  3FR3 A;  1N2A A;  5CYY A;  2YOI A;  4IHU A;  1Y6E A;  2WJU A;  3KCM A;  1EV4 A;  3MNG A;  2VLT A;  5ECS A;  3HVS A;  2IN3 A;  1TI3 A;  5B6N A;  3WD6 A;  4KW6 A;  2H6Z A;  2FWH A;  3QAG A;  1THO A;  2VCV A;  5B6M A;  4D73 A;  2LEG A;  1VF2 A;  4TR4 A;  3VWW A;  2K8S A;  4X4J A;  4OD7 A;  4ZBD A;  4GRF A;  2RUE A;  3FW2 A;  4XIH A;  4I2T A;  1GSD A;  2M46 A;  4E8E A;  1ZOF A;  1QQ2 A;  1JZR A;  1ZMA A;  1SKS B;  3O6T A;  3ERF A;  1SYR A;  4MF6 A;  2X49 A;  1XOA A;  3H79 A;  2NBS A;  3LXZ A;  5IPG A;  4KE3 A;  2KUC A;  4J2F A;  1SL1 B;  1T4Y A;  2FWG A;  1YEX A;  1FAA A;  2NPB A;  4X43 A;  1DBY A;  4DVC A;  1MDI A;  1A2M A;  4PXO A;  3KD0 A;  2QSI A;  3O76 A;  1DUG A;  4I5Q A;  5L71 A;  5KOX A;  1I9D A;  4RI6 A;  3F6D A;  1NW2 A;  1T4Z A;  3IAS 1;  2DIY A;  5INY A;  4KSO A;  3GFK A;  2MMZ A;  5D73 A;  3GYK A;  2LKU A;  1GSE A;  4EC0 A;  5J41 A;  3DVX A;  1YKC A;  3RBT A;  3F9U A;  1T3B A;  4Z7G A;  3PGT A;  1GUH A;  2JAE A;  2YFB A;  4GQC A;  2I4A A;  2I3Y A;  4TR1 B;  1LU4 A;  1K0O A;  2LQQ A;  1M2A A;  1GSF A;  5IMF A;  4F2I A;  4G0L A;  3QDN A;  4GLT A;  2C3N A;  3VPT A;  4Z2T A;  2I9H A;  4TXO A;  5HFI A;  2B7K A;  1VGL A;  3I9V 1;  2JSZ A;  3APQ A;  1XWG A;  5D96 A;  5ID2 B;  5DDL A;  1V2A A;  2PVO C;  1R5A A;  1KTE A;  4LMW A;  5DAL B;  5HFK A;  1XW9 A;  2R3X A;  2PVQ A;  2HZE B;  1YDK A;  3TKS A;  3C73 A;  2XPE A;  1T7P B;  3TOU A;  2GLR A;  1XFL A;  2X64 A;  4OO5 A;  3UL3 A;  1SYX A;  4HQS A;  4KB3 A;  1F6M C;  4ECJ A;  3GX0 A;  3TB2 A;  4PGT A;  5JWR B;  4FYU A;  1Z5Y E;  5F0G A;  2VL3 A;  1SEN A;  2I1U A;  3BJ5 A;  4LLR A;  3UAR A;  1PX6 A;  3M9K A;  1AUC A;  2B5Y A;  2QA2 A;  4PTS A;  1PN9 A;  4EDZ A;  3VK9 A;  3ME8 A;  4NV5 A;  20GS A;  2MJF B;  1XPV A;  3GRX A;  3GL5 A;  4N11 A;  1JHB A;  3TJK A;  3MDK A;  1XCC A;  4OAV B;  1MD3 A;  3MSZ A;  2IL3 A;  12GS A;  3UVH A;  5HR3 A;  1O6J A;  3C71 A;  3LGC A;  3C7M A;  2LJR A;  3E9J B;  5ECH B;  3C1R A;  3M1G A;  2GQK A;  2C80 A;  5C00 A;  1YO7 A;  3KXO A;  1W89 A;  3BD2 A;  19GS A;  4KAE A;  3MAK A;  2JU5 A;  3LXT A;  4GST A;  2IMI A;  5DQY A;  1JZD A;  1GLP A;  3O3T A;  2ON7 A;  6GSU A;  1SK1 A;  3ERG A;  5F05 A;  4N10 A;  2VO4 A;  4RQR A;  3W6G A;  2O8V B;  4ZIL A;  9GSS A;  1EOG A;  2NDO A;  3NZN A;  3A3T A;  4JCV E;  2PBJ A;  2H73 A;  2YAN A;  1XWK A;  3P90 A;  3HD5 A;  3L4N A;  1TK8 B;  2X4A A;  3SBC A;  3ZYW A;  3LJ1 A;  4HZ2 A;  1U87 A;  2PMT A;  1ILO A;  1ZL9 A;  1GRX A;  4ZL8 A;  3EU3 A;  3FMW A;  4PQ1 A;  4AF2 A;  1R26 A;  2VCX A;  4OFT A;  5CAX A;  1HD2 A;  1UN2 A;  3TJB A;  2B1K A;  1GNE A;  4JU5 A;  4F9Z A;  4EXJ A;  3KM6 A;  18GS A;  1YQ1 A;  3A5W A;  5IMD A;  5KEJ A;  1A0F A;  2GST A;  4KCE A;  3LSZ A;  1QGV A;  1X5D A;  2EIR A;  2VOC A;  5E4W A;  1OE7 A;  3GST A;  5DAK A;  2C0E A;  3GUS A;  3FZ4 A;  4YH2 A;  2X8G A;  2CZ3 A;  2JZT A;  4K1F A;  1AW9 A;  3IPZ A;  3KZQ A;  3UVT A;  1TJD A;  2FCH A;  1V98 A;  4PUF C;  4XRD A;  1GL8 A;  3I6A A;  3ZIV A;  1PL2 A;  1NHO A;  2WUL A;  3QCP A;  4BVY A;  2HLS A;  4MZW A;  2A2R A;  3H8Q A;  4LL4 B;  2IJY A;  2VCT A;  1WWJ A;  2WRT A;  2E7P A;  1K0D A;  3HZ8 A;  3IRA A;  3ZL5 A;  1K0B A;  3M8N A;  4HI7 A;  4MJB A;  2MMN A;  3F6F A;  3HZ4 A;  4HFV A;  3A5I A;  4K7O A;  3TCO A;  1SK2 A;  1PKZ A;  4DSR A;  4AGS A;  8GSS A;  4DWL A;  5B7C A;  2YWM A;  4NHW A;  1ZYE A;  3KH9 A;  2HRF A;  4ECC A;  2YV7 A;  4BPY A;  4K6X A;  3LOR A;  2YPM A;  2ZUP A;  4XS4 A;  3AJF A;  3I43 A;  3IC8 A;  5B8B A;  5D93 A;  2TRC P;  5G5E A;  2QKE A;  4NAX A;  4TN8 A;  3S9F A;  5IMZ A;  3EWL A;  4Q5N A;  1SKW B;  4JR4 A;  5A4V A;  4BL7 A;  3D6I A;  2V41 A;  1G7E A;  5H5S A;  2L5O A;  3IAS 2;  2HFD A;  2AYT A;  4IJ3 A;  2HRN A;  2FY6 A;  1YF1 A;  2WZ9 A;  2CA8 A;  4PL4 A;  1X5C A;  4GXT A;  3V1W A;  2WCI A;  4USS A;  1GH2 A;  2A2C A;  2FNO A;  1QMV A;  3IK7 A;  4O1O A;  4MJA A;  3IBH A;  2YCD A;  4Z7X A;  2K19 A;  2JB1 A;  4OMV A;  2H8L A;  4ZB9 A;  1BG5 A;  3TJG A;  2OA7 A;  3ERW A;  4I8B A;  1SD9 A;  2AUV A;  1ACV A;  2X8C A;  1AQV A;  5HR2 A;  3W8J A;  1B48 A;  3CTG A;  5GAN D;  3HKR A;  1B9X C;  4G2E A;  3I9V 2;  4XCS A;  1AXD A;  2O7K A;  1JLW A;  2XMX A;  3L0I A;  4HS1 A;  2K18 A;  3IV4 A;  2L59 A;  2MZC A;  10GS A;  5G30 A;  2BTO T;  3DA4 A;  4G9H A;  5DBQ A;  1HNC A;  3W8S A;  5FWG A;  2YWO A;  4A5P A;  1AQX A;  1FB6 A;  4J56 E;  3CYN A;  3PPU A;  3F63 A;  4OWY A;  3Q8D A;  3E3E A;  1G6Y A;  1W3S A;  2VUP A;  4K5R A;  1XW5 A;  1WPI A;  2DSA A;  3FRC A;  1PSQ A;  1A23 A;  1BJX A;  2MYG A;  2ZNM A;  3UEM A;  4HJ2 A;  3TDG A;  4NMU A;  2WB9 A;  2H66 A;  5AIS A;  4HJM A;  1O81 A;  2KKM A;  4OAU C;  5LD0 A;  2CAQ A;  2VM1 A;  3FHK A;  1A24 A;  2P31 A;  2H1D A;  1XXU A;  1XWC A;  3JCM L;  1VF4 A;  3KMN A;  4ZL7 A;  1DSB A;  1TI1 A;  1KNG A;  3UMA A;  5F07 A;  5G5F A;  3CSJ A;  3GMF A;  2F9S A;  4JR6 A;  1Z6N A;  1ZGN A;  2H6X A;  5G1L A;  4WBR D;  2B5X A;  3DGQ A;  2XPD A;  3R2Q A;  1EZK A;  4BVX B;  3QMX A;  3US3 A;  2CVK A;  4ECI A;  4QL9 A;  1IYI A;  2RLI A;  2RII A;  5H5Q A;  4HU9 A;  4Q5R A;  3M3M A;  3UIW A;  3LYK A;  3TKS E;  3GTU B;  1M2B A;  1A2L A;  2RIO A;  3G7Y A;  1URM A;  4TW5 A;  3TRP A;  4XTS A;  4I2U A;  3C1S A;  2F6M B;  4PUA A;  4L5O A;  3RAZ A;  4CW9 A;  2OKA A;  1K3O A;  3G7J A;  4KDU A;  1XOB A;  3F4M A;  4TR3 A;  4L0W A;  4RUV A;  4F03 A;  1M7T A;  3F3Q A;  1OVN A;  5GAP D;  5DCH A;  4OFM A;  1OE8 A;  3VI7 A;  3HY2 A;  5JWQ B;  4PNF A;  2FHE A;  5HFG A;  1O8W A;  4ZB8 A;  4K7I A;  2E0Q A;  2QA1 A;  2JSY A;  1LJR A;  1B8X A;  4ICY A;  3VFI A;  4EO3 A;  2R6K A;  5IIZ A;  1NHY A;  3ZRD A;  3IDV A;  1R5P A;  3MYD A;  1ERW A;  3FEU A;  2ALB A;  4I97 A;  4WR5 A;  5D9V A;  3SWL A;  1TK5 B;  4GXZ A;  5IQY A;  4N30 A;  1R4W A;  3FZ9 A;  3TKR A;  1PL1 A;  3ZLP A;  1H75 A;  2GZY A;  1XZO A;  3VUR A;  1MDJ A;  2HSM A;  4GSN A;  5CRW A;  5ECK B;  1ZYN A;  2L4C A;  1EV9 A;  2H1B A;  2OJL A;  4K7N A;  5DAK B;  4O7H A;  4RI7 A;  3APO A;  4U6R A;  1F3A A;  3J7Y k;  2B7J A;  2H1G A;  2O85 A;  3DIE A;  1U5K A;  3CBU A;  2HRA A;  3HYP A;  4DSQ A;  1V57 A;  4LL1 B;  4BWS A;  3GV1 A;  1HQO A;  4X1U A;  4IVF A;  6GSV A;  3ZRE A;  4K8M A;  3QFA C;  4KX4 A;  2NTO A;  2XBI A;  3KP8 A;  1BAY A;  2A2S A;  2GGT A;  3VI5 A;  5AIX A;  2M72 A;  1K0A A;  1TU8 A;  4DSS A;  2DC5 A;  4YKF A;  2JZS A;  2C0D A;  2QGV A;  4POL A;  2YWI A;  5D9T A;  5ABR A;  1ZZY A;  3A2W A;  4FYB A;  3N5O A;  2ON5 A;  5DCG A;  5B8A A;  2QC7 A;  2IIY A;  1HNA A;  5CRG A;  3TUE A;  2V1C C;  1K0N A;  3L9V A;  2GS3 A;  2R0G A;  4IQ1 A;  5D9X A;  5IPH A;  2BJX A;  4MF5 A;  1USB A;  2H74 A;  3EU4 A;  5IMV A;  2H76 A;  1XW6 A;  1M9A A;  1U6T A;  2JZR A;  2YN1 A;  4XS4 B;  4V2L A;  1T8E B;  4ISD A;  3VPQ A;  2B5E A;  1O8X A;  3KP9 A;  2GZZ A;  3FK8 A;  2OAD A;  1FHE A;  2IFQ A;  3D0Z A;  3JSB A;  1PD2 1;  2VD0 A;  4WF5 A;  1TRU A;  2PPT A;  4KSM A;  2I81 A;  1K3Y A;  1F9M A;  2V6O A;  3GKX A;  3PH9 A;  1OC9 B;  4K0G A;  4MF7 A;  4EL1 A;  3QR6 A;  2O87 A;  4O92 A;  2IP6 A;  4ZBB A;  4HUA A;  1TDI A;  2LRC A;  5IMA A;  1NM3 A;  2EIQ A;  3EUR A;  1ERU A;  1TP9 A;  3IC4 A;  3ZMK A;  6GST A;  4H86 A;  3RHC A;  2VCZ A;  2G0F A;  3KTL A;  2LRT A;  3DXB A;  2XTQ A;  1JZW A;  2PGT A;  3ED3 A;  4CY8 A;  2JAC A;  3U5R E;  4IP1 A;  3GA4 A;  1A0R P;  1SL0 B;  4KDX A;  3I69 A;  1U3I A;  1PQN A;  1TTZ A;  3GH6 A;  2J23 A;  4MA9 A;  2DJJ A;  3RHB A;  4FQU A;  1E2Y A;  3TOT A;  1U3A A;  1WOU A;  3KH7 A;  4IJI A;  3HJP A;  1SJI A;  3VWU A;  3N9J A;  2N5F A;  3UBL A;  4PQH A;  5CO3 A;  3GHA A;  3BCK A;  1O85 A;  2D2Z A;  4MJE A;  2P5R A;  1QK8 A;  2REM A;  5KOW A;  3CRU A;  5BMU A;  3F8U A;  4ID0 A;  3F4T A;  1M2D A;  3ZFB A;  1FW1 A;  2DIZ A;  1GUK A;  3ZVJ A;  2LJK A;  2LNT A;  4GF0 A;  1BED A;  2JB2 A;  2A2P A;  1XVW A;  2XHF A;  3DRN A;  4LMV A;  3PIN A;  3CTF A;  3LW9 A;  1WIK A;  3QAW A;  4G0I A;  3TKS C;  4Z2U A;  4NWY A;  4I1T A;  4TVE A;  3IHQ A;  5ECI B;  3AY8 A;  3GH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...