3KP9A

Structure of a bacterial homolog of vitamin k epoxide reductase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
259
Chain Sequence
QRHSRLILAILAGLGSLLTAYLTYTKLTEQPAAFCTGSDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bacterial homologue of vitamin K epoxide reductase.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Blood coagulation,oxidoreductase
molecule keywords VKORC1/thioredoxin domain protein
total genus 71
structure length 259
sequence length 264
ec nomenclature ec 1.1.4.2: Transferred entry: 1.17.4.5.
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3kp9A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kp9A02
3FZAA 4MMMA 4V1Ap 3I9V2 1A8LA 3P2AA 2F8FA 2P31A 2R5GA 3A2XA 1TRWA 3VFIA 1WWJA 1CQHA 3BOAA 1JZDA 2LKUA 3TDGA 2J9HA 3ZTLA 5D9VA 2HI7A 6GSSA 4KCEA 1H4OA 4HZ4A 5HR1A 1GSFA 4ECBA 4POBA 3W6GA 4PX1A 1T00A 2IL3A 2RUEA 2PGTA 3VWXA 2VD1A 1AQWA 3P7XA 3GUSA 2H1AA 1LBKA 1SKRB 1K0BA 5HFGA 1SYRA 3C73A 2K6VA 1GUMA 17GSA 2FCHA 4N0VA 2I9HA 3M3MA 4AGSA 3E0UA 4V1Ag 1RQMA 4Q5QA 4AJ7A 4KE3A 4WETA 2WFCA 3HZ4A 2REMA 3PR8A 4ZB6A 2WS2A 4H86A 1VGLA 4KA0A 4TXVA 6GSUA 4HDEA 2P5RA 1MDIA 4PQ1A 5DQYA 1XVWA 2HE3A 1PGTA 1M7TA 1XPVA 3UVTA 3BBYA 2PBJA 3GL5A 3FK8A 4POLA 2XBIA 1ERUA 1LU4A 4KSOA 2EIQA 3J7Yb 2VL2C 3UEMA 5COHA 5J4UA 5JWRB 2WULA 3DVXA 2XHFA 3LGCA 2AHEA 4KUNA 2B5YA 1XW5A 2HZFA 2HLSA 5LCZA 2JZTA 3QAGA 2FNOA 3HKRA 2GVPA 2F51A 1T3BA 3ZL5A 3TJFA 1DBYA 2HFDA 1HNCA 4EVMA 4ZL9A 3HHVA 5ECRB 4V2NA 2XC2A 2H70A 2IFQA 5AIVA 4I97A 2YWMA 5JCUA 4TKYA 4E8HA 3VWWA 4ZBBA 2YJHA 3H8QA 2L59A 1SK0A 5IMDA 2FA8A 3DRNA 3CTFA 2A4VA 3G7YA 1WPIA 2MZCA 4L5LA 3GURA 5L71A 4O5RA 2VAFA 1HD2A 4PUFC 4OMVA 4PQIA 3WT2A 1YZXA 4O92A 5D9WA 3IDVA 1CQGA 2O85A 1XOAA 5CNWA 1NHOA 5FWGA 3CRUA 4N11A 1V2AA 2YANA 2AUVA 3UARA 2QGVA 5JCWA 1M9BA 3DIEA 3TB2A 1OC8A 3Q18A 4O7HA 3ERWA 4TOPA 3EYTA 3MAKA 3ZZXA 3TJBA 3UOMA 2GDRA 1OC3A 5ECHB 2MBTA 5GAND 5HFKA 1O7UA 1R26A 1EGOA 2LNSA 4HU7A 5G1LA 1TTZA 4GQFA 1GSQA 2V1MA 3ZITA 4K0GA 5A4WA 2XPEA 3FR6A 3ED3A 2R4VA 2OBIA 3TJKA 3Q6OA 2VCZA 2PUKC 1SD8A 4G9HA 5ELGA 3GKMA 1TI3A 2CZ2A 20GSA 3GH9A 1F6MC 4MF6A 2ZCTA 4MF7A 1F3BA 1JZWA 5B7CA 2VM1A 4MJCA 2F8AA 1AQVA 1MD3A 4KB3A 3WGEA 2LEGA 4MJEA 2F9SA 4PQHA 4QQ7A 1V9WA 2H01A 2K9FA 3F0IA 4MA9A 2LRCA 2N5FA 3QFBC 1Y6EA 3QAVA 3LYPA 2Z9SA 2X99A 2CZ3A 1GL8A 4MZBA 3GMFA 3IRAA 3IAS2 3H93A 3GTUB 1I9DA 3TUEA 4FIWA 3HZ8A 5G2ZA 1AW9A 2B1KA 2H74A 4ULXA 4DEJA 4K9ZA 2CVDA 1F9MA 1BG5A 4ECJA 2VM2A 1K0CA 4IQAA 3KEBA 3PH9A 2HNLA 2NBSA 5IPHA 2CVBA 5J41A 2OE3A 4EXJA 4F9ZA 3DXBA 5HQPA 1EOGA 2J23A 1GTUA 3TJJA 5DAKB 1TDIA 5KN0A 5G5FA 3KZQA 4KDYA 2B5EA 3KP9A 1MDKA 4MP4A 2C0DA 2DJ2A 1ILOA 5G1KA 2BTOT 2JSYA 1A24A 1AQXA 1Q4JA 4TXOB 1BYEA 2E0QA 3BCIA 4HOJA 1M2DA 3SBCA 2YOIA 3G9BA 4FYCA 4IGJA 1TK8B 6GSVA 2I1UA 5DAKA 1ST9A 2LSTA 4ZL8A 3S9FA 5KN1A 3IC4A 3QCPA 4BWQA 3RDWA 3HJMA 4IP6A 3KMNA 5H5QA 1TRUA 2GQKA 1GSSA 5G5EA 1F3AA 2ON7A 5ECQB 2H0IA 1FVKA 3HYPA 1M99A 3UAPA 2AB6A 1SYXA 3L0HA 4NAXA 1QUWA 3FZ5A 1THOA 2H0HA 6GSWA 5E4WA 5ECSA 2B3SA 2ON5A 5D93A 4KDXA 4POKA 2QC7A 3CXGA 3F4TA 3VURA 3QPMA 4ZL7A 4ZB9A 1PSQA 2R6KA 3SWLA 3TGZA 2VL9A 2DMLA 2TIRA 3LYKA 1PQNA 3TKSE 3KCMA 4MF5A 1AXDA 3DYRA 2I4AA 12GSA 1MEKA 3A2VA 2YCDA 2TRXA 2GZZA 4YH2A 2NPBA 2L5LA 11GSA 3W8JA 4IQ1A 1NM3A 3IPZA 1ZMAA 3DEXA 2DLXA 3I43A 2O87A 4MABA 5IO2A 2M72A 3HY2A 2VL2A 2IIYA 4GLTA 3KXOA 3UVHA 14GSA 5A4VA 2N5AA 2C8UA 3DD3A 2I3YA 1X5EA 4F03A 1PMTA 1N2AA 3LQ7A 2B6MA 1BJXA 2KP1A 1YEXA 1FG4A 3GNJA 4WBJA 4IJ3A 4G10A 4RQXA 1V98A 1QGVA 4ID0A 2K18A 2PVQA 1SL1B 5JWQB 1HNBA 4YAVA 3IHQA 5CP1A 4N30A 1M9AA 3VK9A 3BJ5A 4IP1A 4K7IA 5D9TA 2ZNMA 1H75A 5F05A 1EOHA 4QL7A 4EE0A 2GS3A 5ECOB 3NZNA 4IVFA 2IWTA 2H30A 4RUVA 4BL7A 2MMAA 2HSYA 3VWVA 5DALB 1LJRA 3A5WA 2C3NA 3CMIA 2GT6A 4I5QA 4XS1A 4MDCA 2MYGA 3CRTA 1URMA 1PKZA 4FO5A 4KGIA 4RI7A 2F3MA 4BWSA 3HDCA 3EU3A 3HJPA 1AUCA 4GTUA 4IELA 2JU5A 1G0TA 4PNFA 3TJGA 2VL3A 4LLRA 3VI7A 1XOBA 4GF0A 2ES7A 3I6AA 3UMAA 2PWJA 1T7PB 1OC9A 3ZMKA 5GAPD 4NV5A 1TXXA 3KJYA 2QSIA 3HVSA 1ABAA 4FYUA 2X64A 1SJIA 2IJYA 1OYJA 2EC4A 3TOUA 1TRSA 4BVXA 4P3YB 4ZBDA 3ME7A 4JU5A 3MWHA 4KSMA 3F6DA 1WRYA 5AGYA 2RIIA 1DE1A 3VPQA 1TK0B 1GRXA 4GRFA 2WDUA 4LMVA 4OD7A 5EY6A 4NPBA 4WR5A 3IK7A 3ZYWA 3D0ZA 2GSQA 2FWEA 4Q5RA 4NXIA 4GWRA 5DDLA 1SENA 1RK4A 2PERA 4ECCA 2A2SA 2MBSA 3M1GA 2L6DA 3AY8A 5GSTA 3MSZA 1JZRA 3QMXA 3PGTA 3C1RA 4F2IA 4MLYA 4CDOA 5JCGA 1JFUA 2AYTA 1XXUA 2V2GA 2OKAA 4BA7A 2IMDA 4ISDA 4EDYA 1K0OA 3Q74A 1TW9A 1G7EA 4GSSA 2EIRA 3L9SA 2LJAA 2GSRA 4XIHA 1A0RP 4Z7XA 1E6BA 1Z6NA 3U5RE 5DALA 5IIZA 1I5GA 3ERGA 4NMUA 4QL9A 19GSA 3GL3A 4DSRA 1FAAA 3A3TA 1HQOA 1ZYQB 2R2JA 4Q5NA 3D4TA 1Y25A 2N5BA 3TCOA 1A2MA 5HR2A 1FB0A 2M46A 3U6VA 5J9CA 1OAZA 5F8BA 4L8EA 5IM9A 1ERVA 1ZL9A 4K6XA 1WOUA 5IO0A 5DVBA 1UA5A 3O76A 2OADA 4F0CA 5D9XA 4EUYA 2L5OA 1X5CA 1A0FA 2PN8A 2YZUA 2JADA 3EU4A 2AV4A 4IKHA 1M0UA 3US3A 3FR9A 5DCHA 1J9BA 1TRVA 2VCVA 1XVQA 4YAPA 4JZQA 2C0FA 2E2GA 1IYHA 4OO4A 2GT5A 1A8YA 3LFLA 1EV9A 1VF2A 1Z9HA 4CW9A 3ZVJD 1XCCA 5CRWA 2C1YA 2CX4A 5ENUA 5GZZB 4OFNA 5AN1A 5J5NA 2L4QA 3KH9A 1THXA 1GTIA 3OR5A 2C0EA 4OFMA 5B6NA 4WXTA 1T1VA 3KP8A 1JLVA 2YWIA 2H0GA 3GA4A 1K3OA 4HQZA 4KX4A 5HR3A 1DSBA 4HQSA 1X5DA 1PX6A 3C71A 4X43A 2IMIA 5CYYA 2CAIA 3TRXA 3L78A 4WF5A 1ZYEA 1QQ2A 4NV2A 1O85A 4OCFA 2H75A 2WRTA 6GSTA 3ZLPA 5CRGA 2H1BA 4BVYA 2YWOA 2B7JA 3D5JA 4ML1A 2R3XA 3M9JA 2GTUA 2L4CA 1UC7A 1K0DA 4L0UA 1V40A 3F9UA 2YV9A 2V6OA 3GX8A 4XS4A 4L0WA 1FHEA 3IR4A 3UBLA 3J7Yk 1FB6A 1GSDA 3IK9A 4OO5A 5D8IA 3RPNA 3GX0A 3GH6A 1ON4A 1YEPA 3P8WA 2C4JA 3PINA 1X9WB 5C04A 2YN1A 4HUAA 3RHCA 4ZXGA 2LQOA 4J2FA 4ZIJA 1HYUA 3CYNA 4EDZA 5IOWA 2WJUA 3LXZA 5H5RA 3D6IA 1U88A 2RM6A 2R37A 5A5KA 2CX3A 1B9XC 3DGQA 3NOFA 3F6FA 3F3RA 4K8MA 1MD4A 1ZGNA 4KCAA 1XWKA 3BCKA 3ZMLA 2TRCP 2HT9A 2XPDA 2H8LA 4IN0A 3ISOA 1EWXA 4RQRA 4PNGA 2M80A 5LD0A 3LXTA 1PL1A 3IE3A 1GULA 4MZCA 1SD9A 3VWUA 3HVVA 4MH3A 2G0FA 1GLQA 1OC9B 1T4YA 1GH2A 1PA3A 4TR4A 1JZOA 2YZHA 1ZCPA 1F37A 1TP9A 3FHKA 3QD9A 5IMZA 1FVJA 1SK2A 4PUAA 1TOFA 1S3CA 4I6XA 3ERFA 1GUKA 4EO3A 2FLSA 5EPFA 4AJ6A 2JSZA 2IMFA 2DSAA 1K0NA 1B48A 1S3DA 3LSZA 3VI5A 3EURA 2PMTA 1TU7A 3MNGA 4X1UA 2GZPA 4XRDA 2VLUA 4ECIA 3MDKA 2X8GA 3O3TA 5AIXA 5IPGA 3UIWA 2GLRA 1R4WA 1X9MB 1V57A 1Z6MA 4L5OA 1M2BA 6GSXA 1KEBA 1UN2A 4ZB8A 2QKEA 2PPTA 3R2QA 5ID2B 2DIZA 4LL1B 2NDOA 4PXOA 2IPAA 2O89A 5HR0A 1ACVA 4MH2A 5ECNB 3E9JB 3GN3A 1SJZA 1PD21 4HZ2A 3TKQA 1QFNA 22GSA 4PGTA 4TXOA 2I81A 1XWGA 3FRCA 5CO3A 2RLIA 3GKNA 2O8VB 3GTUA 4EL1A 1NSWA 1PN9A 1MDJA 3IA1A 3WGDA 2C3QA 2IMEA 5B8AA 4N0ZA 5FHIA 1AC1A 3C8EA 1YDKA 2P0GA 2OJLA 1Z7PA 1JLWA 3KD0A 4KAEA 3E3EA 4N10A 5KEJA 2E2MA 3FR3A 4MPFA 1R5AA 3LJRA 4AJ8A 4ACSA 4J56E 3IBHA 3QFAC 5EL8A 4MK3A 4D73A 3GKKA 5J9BA 5CRHA 1S3AA 2D2ZA 1T8EB 4IW9A 3F4RA 3DVWA 2JL4A 1Q98A 2CAQA 2C3TA 3FY7A 3JCML 2FY6A 1GNWA 3DWVA 2DC5A 2YWNA 4MPGA 1JHBA 2H6ZA 5EVOA 3QAWA 5DBQA 2YJ7A 2NVLA 4JR4A 2ZUPA 3LORA 1EV4A 5DCGA 2OE1A 1GLPA 4TR1B 4DSQA 2FWFA 4GSTA 1K3YA 4JBBA 2AJQB 1VF3A 2DBCA 2GZYA 3HD5A 4ML6A 2HZEB 2VIMA 3DMLA 3GIXA 2JACA 1W4VA 4NWYA 5B6MA 1GP1A 1EEMA 5ECPB 2IFQB 3FYGA 3ZVJA 3QR6A 3RBTA 2RM5A 5D73A 5A4UA 3HA9A 4JE1A 1FO5A 3ZFBA 2GSTA 5IOXA 1M2AA 2GSSA 3CBUA 5DQSA 5AISA 1BEDA 4DVCA 1AIUA 3ZRDA 1KBNA 1OE7A 4X0XA 5IQYA 3N9JA 2V6KA 1USBA 1A23A 1PX7A 2VLVA 2HXKA 1SKSB 2V32A 5ECKB 2O7KA 3TKPA 2NTOA 1YQ1A 3HCZA 2RUFA 2JZSA 4IS0A 2VCXA 2VCWA 3EVIA 1OE8A 3KH7A 3A2WA 5CREA 1EP7A 2HSHA 3GRXA 2H66A 2HZEA 4YQMA 1NW2A 3RHBA 4K0NA 1E2YA 4PURA 1ZZYA 4FYBA 1DE2A 1V58A 2OA7A 2YP6A 1XWAA 2LQQA 4HJ2A 2GQMA 4K7NA 4BPYA 2FHEA 2WCIA 3EE2A 3BD2A 2FD3A 3LG6A 3EC3A 1BX9A 1OKDA 2PVOC 5C00A 1G7OA 1FW1A 4IJIA 3GSSA 4LMWA 4LL4B 4WKWA 2H6YA 1G6YA 2V41A 1O8WA 4JEDA 4MZWA 1YJ6A 1XZOA 4V2MA 3GYKA 4MJAA 4XHMA 1XIYA 2GQLA 1YKCA 2H1DA 4MCUA 3WGXA 1X0RA 1XWBA 4I2UA 1PKWA 4OFTA 3D4MA 3C7MA 1GNEA 5ELAA 3I69A 2DIYA 4LA1A 1K3LA 16GSA 2KOKA 4K1FA 4RI6A 2IMKA 1XWCA 2LS5A 4KDUA 3L9VA 4XS6A 4JRRA 1GWCA 3TKRA 3F63A 3QDNA 4AF2A 4TW5A 4CHSA 1YF1A 3NIVA 1B8XA 3GHAA 4WF4A 3KM6A 1F2EA 3HVXA 4XTSA 2K8VA 3F8UA 2CQ9A 2OE0A 2BJXA 2DJ0A 4WR4A 1GTBA 1O81A 4GSNA 1AAZA 3QOUA 2XBQA 3APOA 4KH7A 3GV1A 1BQ7A 5F07A 2H76A 3ZIVA 3KTBA 4EKZA 4EF0A 4MJBA 4KW6A 1TJDA 4KNDA 5IMVA 2LTKA 1ML6A 3M0FA 5F06A 1TKDB 4TR3A 1U6TA 3M9KA 3DKSA 8GSSA 4NHZA 3GKXA 4DSSA 2JZRA 2C80A 1OVNA 3L9UA 4G2EA 1SL2B 3UJ1A 4HU9A 1Z5YE 1VF4A 4XRAA 1Z3EA 3TKSA 4V2LA 2DMMA 3ZFLA 2DJJA 3H79A 4K7OA 4HEA2 2HYXA 2KUCA 2H72A 1SK1A 3H1NA 1XBSA 2H6XA 2OBKA 1FOVA 2HRNA 5JWOB 2FWHA 3G7JA 1BAYA 2L6CA 3KIJA 2MMOA 1TI1A 3CSIA 1GSYA 5IMAA 1PL2A 2CV4A 2LRTA 1VRSD 5ECIB 1KNGA 1IYIA 2KP2A 1QMVA 1ERTA 1WMJA 1ERWA 1VF1A 1EEJA 1G6WA 4XCSA 1HNAA 4HJMA 3UBKA 1XFLA 3APSA 5CAXA 1XW6A 2L57A 4WEYA 1NHYA 3TRQA 4JR6A 3KTLA 2OACA 1GSEA 2LJKA 1WJKA 3O6TA 5G31A 3FEUA 2YV7A 1YKAA 3HJOA 2G2QA 1R7HA 2H73A 1SKWB 3FW2A 9GSSA 10GSA 1J08A 2VO4A 2H1GA 1UVZA 5J3RA 1DUGA 2DJ1A 2H19A 2B1LA 1U87A 5CRDA 2P5QA 4ILFA 2B7KA 3K8NA 1KTEA 3VLNA 3ZREA 1EP8A 3WD6A 3ME8A 2VCQA 1B4QA 4NHWA 2WGRA 3F3QA 3EMPA 4XS4B 1N8JA 2WB9A 1J0FA 2PU9C 1A2LA 1Z7RA 6GSYA 4DSSB 1U3AA 2H71A 1QXHA 4GQCA 3N5OA 2DJ3A 1EZKA 1O8XA 3D21A 3EINA 5DJMA 1ZOFA 5KN2A 2WZ9A 2A2RA 4Q5FA 2X8CA 4J57E 3W8SA 3TRPA 3G7IA 1K0AA 3GFKA 2FUG2 2LNTA 4IBPA 3FKFA 2YNXA 1EGRA 1YF0A 2C0GA 3TOTA 18GSA 3KMOA 4WBRD 4E8EA 3H4KA 4FH8A 3M8NA 2VLTA 1GSUA 3EMXA 5ABRA 2E7PA 2AAWA 1A2JA 3KGKA 4TR0A 2LJRA 5KN3A 2LRNA 4TRXA 4OCEA 1PRXA 1WP0A 1TU8A 5ECLB 1W89A 4F82A 3CSJA 4TR1A 2FGXA 4HI7A 5H5SA 2LUSA 2FA4A 4YQVA 3Q19A 3D22A 3IOSA 3CSHA 1MTCA 3FZ4A 1GUHA 2KLXA 3CTGA 2LV3A 1B9YC 2CA8A 1RW1A 3IAM2 3WT1A 2BMXA 3VPTA 2MMZA 3ZIJA 4IHUA 2GGTA 2VOCA 1R5PA 5G30A 4GXZA 5GSSA 3LWAA 3GSTA 4EC0A 5HFIA 1U3IA 3RPPA 13GSA 1SJ6A 4YQUA 4I2TA 2VD0A 7GSSA 5ECMB 3APQA 4TN8A 4F0BA 4GCIA 5E59A 4POMA 3IXRA 5DJLA 2MMNA 1K0MA 2B5XA 1GTAA 4G19A 3F4SA 1WIKA 4HS1A 5LNKe 2VCTA 3IV4A 1QK8A 3L4NA 2KHPA 1YY7A 1XW9A 5D96A 4D73B 3C1SA 2VUPA 2DJKA 2X8HA 3P90A 5IMCA 1O73A 1WE0A 4ZBAA 3FZ9A 1OKTA 2EIOA 4O32A 2IN3A 4OWYA 1C72A 4ZILA 1T4ZA 3UL3A 4K2DA 3TKSC 1X9SB 1TK5B 2K8SA 4I8BA 1B4PA 5B8BA 2ALBA 5INYA 3HXSA 3WYWA 2YPMA 1SU9A 5IMFA 4TVEA 2CT6A 1SL0B 2FWGA 3V1WA 3RAZA 5FT3A 3EWLA 2HRFA 2CVKA 5ID2A 1O6JA 5F0GA 3LEFA
chains in the Genus database with same CATH superfamily
1M3IA 3FZAA 4MMMA 4V1Ap 3I9V2 1A8LA 3P2AA 2F8FA 2P31A 2R5GA 3A2XA 1TRWA 3VFIA 1WWJA 1CQHA 5HGIA 3BOAA 1JZDA 2LKUA 3TDGA 2J9HA 3ZTLA 5D9VA 2HI7A 6GSSA 4KCEA 1H4OA 4HZ4A 5HR1A 1GSFA 4ECBA 4POBA 3W6GA 4PX1A 1T00A 4PL5A 2IL3A 2RUEA 2PGTA 3VWXA 2VD1A 1AQWA 4Z2RA 3P7XA 3GUSA 2H1AA 1LBKA 1SKRB 1K0BA 5HFGA 1SYRA 3C73A 2K6VA 1GUMA 17GSA 2FCHA 4N0VA 2I9HA 3M3MA 4AGSA 3E0UA 4V1Ag 2XMXA 1RQMA 4Q5QA 4AJ7A 4KE3A 4WETA 3A5IA 2WFCA 3HZ4A 2REMA 3PR8A 4ZB6A 2WS2A 4H86A 1VGLA 4KA0A 4TXVA 6GSUA 4HDEA 2P5RA 1MDIA 4PQ1A 5DQYA 1XVWA 2HE3A 1PGTA 1M7TA 1XPVA 3UVTA 3BBYA 2PBJA 3GL5A 3FK8A 4POLA 2XBIA 1ERUA 1LU4A 4KSOA 2EIQA 3J7Yb 2VL2C 3UEMA 5COHA 5J4UA 5JWRB 2WULA 3DVXA 2XHFA 3LGCA 2AHEA 4KUNA 2B5YA 1XW5A 2HZFA 2HLSA 5LCZA 2JZTA 3QAGA 2A2PA 2FNOA 3HKRA 2GVPA 4O5QA 2F51A 1T3BA 1ZYPA 3ZL5A 3TJFA 1DBYA 4K5RA 2HFDA 1HNCA 4EVMA 4ZL9A 3HHVA 5ECRB 4V2NA 2XC2A 2H70A 4BVYB 2IFQA 4K5SA 5AIVA 4I97A 2YWMA 5JCUA 4BVXB 4TKYA 4E8HA 3VWWA 4ZBBA 2YJHA 3H8QA 2L59A 1SK0A 5IMDA 2QA1A 2FA8A 3DRNA 3CTFA 2A4VA 3G7YA 1WPIA 2MZCA 4L5LA 3GURA 5L71A 4O5RA 2HRKA 2VAFA 1HD2A 4PUFC 4OMVA 4PQIA 3WT2A 1YZXA 4O92A 5D9WA 3IDVA 2V1CC 1CQGA 2O85A 2K19A 1XOAA 4CY6A 5CNWA 1NHOA 5FWGA 3CRUA 4N11A 1V2AA 2YANA 2AUVA 3UARA 2QGVA 2DKHA 5JCWA 4YKGA 2YFAA 1M9BA 3DIEA 3TB2A 1OC8A 3Q18A 4O7HA 3ERWA 4TOPA 3EYTA 3MAKA 3ZZXA 3TJBA 3UOMA 2GDRA 1OC3A 5ECHB 2MBTA 5GAND 5HFKA 1O7UA 1R26A 1EGOA 2LNSA 4HU7A 5G1LA 1TTZA 4GQFA 3UITA 1GSQA 2V1MA 2FEFA 3ZITA 4K0GA 5A4WA 2XPEA 3FR6A 3ED3A 2R4VA 2OBIA 3TJKA 3Q6OA 2VCZA 2PUKC 1SD8A 4G9HA 4KF9A 5ELGA 3GKMA 2L1LB 1TI3A 4BIKA 2ZW3A 2CZ2A 20GSA 3GH9A 1F6MC 4MF6A 2ZCTA 4MF7A 1F3BA 1JZWA 5B7CA 2VM1A 4MJCA 2F8AA 1AQVA 1MD3A 4KB3A 3WGEA 2LEGA 4MJEA 2F9SA 4PQHA 4QQ7A 1V9WA 2H01A 2K9FA 3F0IA 4MA9A 2LRCA 2N5FA 3QFBC 1Y6EA 3QAVA 3LYPA 2Z9SA 2X99A 2CZ3A 1GL8A 4MZBA 3GMFA 4AS3A 3IRAA 3IAS2 3H93A 3GTUB 1I9DA 3TUEA 4FIWA 3HZ8A 5G2ZA 1AW9A 2B1KA 2H74A 2A2DA 4ULXA 4DEJA 4K9ZA 1U5KA 2JB1A 2CVDA 3AJFA 1BG5A 1F9MA 4ECJA 4YZ9A 2VM2A 1K0CA 4IQAA 3KEBA 3PH9A 2HNLA 3R3EA 2NBSA 5IPHA 2CVBA 5J41A 3LJ1A 2OE3A 4EXJA 4F9ZA 3DXBA 5HQPA 2A2CA 1EOGA 2J23A 1GTUA 3TJJA 5DAKB 1TDIA 5KN0A 5G5FA 3KZQA 4KDYA 2B5EA 3KP9A 1MDKA 4MP4A 2C0DA 2DJ2A 1ILOA 5G1KA 2BTOT 2JSYA 1A24A 1AQXA 1Q4JA 4TXOB 1BYEA 2E0QA 3BCIA 4HOJA 1M2DA 3SBCA 2YOIA 3G9BA 4FYCA 4IGJA 1TK8B 6GSVA 2QZGA 2I1UA 5DAKA 1ST9A 2LSTA 4ZL8A 3S9FA 5KN1A 3IC4A 3QCPA 4BWQA 3RDWA 3HJMA 4IP6A 3KMNA 5H5QA 1TRUA 2GQKA 1GSSA 5G5EA 1F3AA 2ON7A 5ECQB 2H0IA 1FVKA 3HYPA 1M99A 3UAPA 2AB6A 1SYXA 3L0HA 4NAXA 1QUWA 3FZ5A 1THOA 2H0HA 5KOWA 6GSWA 5BMUA 5E4WA 5ECSA 2B3SA 2ON5A 5D93A 4KDXA 4POKA 2QC7A 3CXGA 3F4TA 3VURA 3QPMA 4ZL7A 4ZB9A 1PSQA 2R6KA 3SWLA 3TGZA 2VL9A 2DMLA 2TIRA 3LYKA 1PQNA 4JCVE 3TKSE 3KCMA 4MF5A 1AXDA 3DYRA 2I4AA 12GSA 5LNK1 1MEKA 3A2VA 2YCDA 2TRXA 2GZZA 4YH2A 2NPBA 2L5LA 11GSA 3IAS1 3W8JA 4IQ1A 1NM3A 4AS2A 3IPZA 1ZMAA 3DEXA 2DLXA 3I43A 2O87A 4MABA 2IP6A 5IO2A 2M72A 3HY2A 4EIPA 2VL2A 2IIYA 4GLTA 3KXOA 3UVHA 14GSA 5A4VA 2N5AA 2C8UA 3DD3A 2I3YA 1X5EA 4F03A 1PMTA 1N2AA 3LQ7A 2B6MA 2KKMA 1BJXA 2R0CA 2KP1A 2RLDA 1FG4A 1YEXA 3GNJA 4WBJA 4IJ3A 4G10A 4RQXA 1V98A 1QGVA 4ID0A 2K18A 2PVQA 1SL1B 5JWQB 1HNBA 4YAVA 3IHQA 5CP1A 3JSBA 4N30A 1M9AA 3VK9A 3BJ5A 4IP1A 4K7IA 5D9TA 2ZNMA 1H75A 5F05A 1EOHA 4QL7A 4EE0A 2GS3A 4OAUC 5ECOB 3NZNA 4IVFA 1TDPA 2IWTA 2H30A 4RUVA 4BL7A 2MMAA 2HSYA 3VWVA 4X4JA 5DALB 1LJRA 3A5WA 2C3NA 3CMIA 4U6RA 2GT6A 4I5QA 4XS1A 4MDCA 4Z2UA 2MYGA 3CRTA 1URMA 1PKZA 4FO5A 4KGIA 4RI7A 2F3MA 4BWSA 3MIXA 3HDCA 3EU3A 3HJPA 1AUCA 4GTUA 4IELA 2JU5A 1G0TA 4PNFA 3TJGA 2VL3A 4LLRA 3VI7A 1XOBA 4GF0A 2ES7A 3I6AA 3UMAA 2PWJA 1T7PB 1OC9A 3ZMKA 5GAPD 4NV5A 1TXXA 3KJYA 2QSIA 3HVSA 1ABAA 4FYUA 2X64A 1SJIA 2IJYA 1OYJA 2EC4A 3TOUA 1TRSA 4BVXA 4P3YB 4ZBDA 2DKIA 3ME7A 4JU5A 3MWHA 4KSMA 3F6DA 1WRYA 5AGYA 2RIIA 1DE1A 3VPQA 1TK0B 1GRXA 4GRFA 2WDUA 4LMVA 4OD7A 5EY6A 4NPBA 4WR5A 3IK7A 3ZYWA 3D0ZA 2GSQA 2JB3A 2FWEA 4Q5RA 4NXIA 4GWRA 5DDLA 1SENA 4HSCX 1RK4A 2PERA 4ECCA 2A2SA 2MBSA 3M1GA 2L6DA 3AY8A 5GSTA 3MSZA 1JZRA 3QMXA 3PGTA 3C1RA 4F2IA 4MLYA 4CDOA 1PFOA 5JCGA 1JFUA 2AYTA 1XXUA 2V2GA 2OKAA 4BA7A 2IMDA 4ISDA 4EDYA 1K0OA 4PL4A 3Q74A 1TW9A 2ZRRA 4K2XA 1G7EA 4GSSA 2HGKA 2EIRA 3L9SA 2LJAA 2GSRA 3FNBA 4XIHA 1A0RP 4Z7XA 1E6BA 1Z6NA 4G0IA 3U5RE 5DALA 5IIZA 3I9V1 1I5GA 3ERGA 4NMUA 2RIOA 4QL9A 19GSA 3GL3A 4DSRA 1FAAA 3A3TA 1HQOA 1ZYQB 2R2JA 4Q5NA 3FVVA 3D4TA 1Y25A 2N5BA 4MNNA 3TCOA 1A2MA 5HR2A 1FB0A 2M46A 3U6VA 5J9CA 1OAZA 5F8BA 4L8EA 5IM9A 1ERVA 1ZL9A 4K6XA 1WOUA 5IO0A 5DVBA 1UA5A 3O76A 2OADA 4F0CA 5D9XA 4EUYA 2L5OA 1X5CA 1A0FA 2PN8A 2ETDA 2YZUA 2JADA 3EU4A 2AV4A 4IKHA 1M0UA 3US3A 3FR9A 5DCHA 1J9BA 1TRVA 2VCVA 1XVQA 4YAPA 4JZQA 2C0FA 2E2GA 1IYHA 4OO4A 2GT5A 1A8YA 3LFLA 1EV9A 1VF2A 4ICYA 1Z9HA 4YZDA 5BRTA 4CW9A 3ZVJD 1XCCA 5CRWA 2C1YA 2CX4A 5ENUA 4BL7B 5GZZB 4OFNA 4Z2TA 5AN1A 5J5NA 2L4QA 3KH9A 1THXA 1GTIA 3OR5A 2C0EA 4OFMA 5B6NA 4WXTA 1T1VA 3KP8A 1JLVA 2YWIA 2H0GA 3GA4A 1K3OA 4HQZA 4KX4A 5HR3A 1DSBA 4HQSA 1X5DA 1PX6A 3C71A 4X43A 2IMIA 5CYYA 1XG8A 2CAIA 3TRXA 3L78A 4WF5A 1ZYEA 1QQ2A 4NV2A 1O85A 4OCFA 2H75A 1SJ8A 3DA3A 2WRTA 6GSTA 3ZLPA 5CRGA 2H1BA 4BVYA 2YWOA 2B7JA 3D5JA 4ML1A 2R3XA 3M9JA 2UZ8A 2GTUA 2L4CA 1UC7A 1K0DA 4L0UA 1V40A 3F9UA 2YV9A 2V6OA 3GX8A 4XS4A 4L0WA 1FHEA 3IHGA 3IR4A 3UBLA 1S3RA 3J7Yk 1FB6A 1GSDA 3IK9A 4OO5A 5D8IA 3Q8DA 3RPNA 3GX0A 3FBVA 3GH6A 1ON4A 1YEPA 3P8WA 2C4JA 3PINA 1X9WB 5C04A 2YN1A 1YO7A 4HUAA 3RHCA 4ZXGA 2LQOA 4J2FA 4ZIJA 2R0PA 1HYUA 3CYNA 4EDZA 5IOWA 2WJUA 3LXZA 5H5RA 3D6IA 1U88A 2RM6A 2R37A 5A5KA 2CX3A 1B9XC 4G0LA 3DGQA 3NOFA 3F6FA 2QA2A 3F3RA 4K8MA 1MD4A 1ZGNA 2HRAA 4KCAA 1XWKA 3BCKA 3ZMLA 2TRCP 2HT9A 2XPDA 3HVNA 2H8LA 4IN0A 3ISOA 1EWXA 4RQRA 4PNGA 2M80A 5LD0A 3LXTA 1PL1A 3IE3A 1GULA 4MZCA 1SD9A 3VWUA 3HVVA 4MH3A 2FUG1 2G0FA 1GLQA 1OC9B 1T4YA 1GH2A 1PA3A 4TR4A 1JZOA 4O5UA 2YZHA 3P23A 1ZCPA 2E8GA 1F37A 1TP9A 3FHKA 3QD9A 5IMZA 1FVJA 1SK2A 4PUAA 1TOFA 4Z7GA 1S3CA 4I6XA 3ERFA 1GUKA 4EO3A 2FLSA 5EPFA 4AJ6A 2JSZA 2IMFA 2DSAA 1K0NA 3VA9A 1B48A 1S3DA 3LSZA 3VI5A 3EURA 2PMTA 1TU7A 3MNGA 4X1UA 2GZPA 4XRDA 2VLUA 4ECIA 3MDKA 2X8GA 3O3TA 5AIXA 5IPGA 3UIWA 2GLRA 1R4WA 1X9MB 1V57A 4Q9VA 1Z6MA 3LW9A 4L5OA 2X4AA 1M2BA 6GSXA 1KEBA 1UN2A 4ZB8A 2QKEA 2PPTA 1JQOA 2XTRA 3R2QA 5ID2B 2DIZA 4LL1B 2NDOA 4PXOA 2IPAA 2O89A 5HR0A 1ACVA 4MH2A 5ECNB 3E9JB 3GN3A 1SJZA 1PD21 4HZ2A 3TKQA 1QFNA 22GSA 4PGTA 4TXOA 4A5PA 2I81A 1XWGA 4USSA 3FRCA 5CO3A 4O1PA 2RLIA 3FMWA 3GKNA 2O8VB 3GTUA 4EL1A 1NSWA 1PN9A 1MDJA 3IA1A 3WGDA 2C3QA 2IMEA 5B8AA 4N0ZA 2GSCA 5FHIA 1AC1A 3C8EA 1YDKA 2P0GA 2OJLA 4GXTA 1Z7PA 1JLWA 3KD0A 4KAEA 3E3EA 2V6EA 4N10A 5KEJA 2E2MA 3FR3A 4MPFA 1R5AA 3LJRA 4AJ8A 4ACSA 4J56E 3IBHA 3QFAC 5EL8A 4MK3A 4D73A 3GKKA 2F6MB 5J9BA 5CRHA 1S3AA 2D2ZA 1T8EB 4IW9A 3F4RA 2XTQA 3DVWA 2JL4A 1Q98A 2CAQA 2C3TA 3FY7A 3JCML 2FY6A 1GNWA 3DWVA 4I1TA 2DC5A 4MPGA 2YWNA 1JHBA 2H6ZA 5EVOA 3QAWA 5DBQA 2YJ7A 2NVLA 4JR4A 2ZUPA 3LORA 1EV4A 5DCGA 2OE1A 1GLPA 4TR1B 4DSQA 1M3JA 2FWFA 4GSTA 1K3YA 4JBBA 2AJQB 1VF3A 2DBCA 2GZYA 3HD5A 4ML6A 2HZEB 2VIMA 3DMLA 3GIXA 2JACA 4YZCA 1W4VA 4NWYA 5B6MA 1GP1A 1EEMA 5ECPB 2IFQB 3DA4A 3FYGA 3ZVJA 3QR6A 3RBTA 2RM5A 1FOHA 5D73A 5A4UA 2HSMA 3HA9A 4JE1A 1FO5A 3ZFBA 2GSTA 5IOXA 1M2AA 2GSSA 3CBUA 5DQSA 5AISA 1BEDA 4DVCA 1AIUA 3ZRDA 1KBNA 1OE7A 4X0XA 5IQYA 3N9JA 2V6KA 1USBA 1A23A 1PX7A 2VLVA 2HXKA 1SKSB 2V32A 4Z7HA 5ECKB 2QGMA 2O7KA 3TKPA 2NTOA 1YQ1A 3HCZA 2RUFA 2JZSA 4IS0A 4PL3A 3DO9A 2VCXA 2P22B 2VCWA 3EVIA 1OE8A 2BL7A 3KH7A 3A2WA 5CREA 1EP7A 2HSHA 3GRXA 2H66A 2HZEA 4YQMA 1NW2A 3RHBA 4K0NA 1E2YA 4PURA 1ZZYA 4FYBA 1DE2A 1V58A 2OA7A 2YP6A 1XWAA 2LQQA 4HJ2A 2GQMA 4K7NA 4BPYA 2FHEA 2WCIA 3EE2A 3BD2A 2FD3A 3LG6A 3EC3A 2MJFB 1BX9A 1OKDA 4FQUA 2PVOC 2F66B 5C00A 1G7OA 1FW1A 4IJIA 3GSSA 4LMWA 4LL4B 4WKWA 2H6YA 1G6YA 2V41A 1O8WA 4JEDA 4MZWA 1YJ6A 1XZOA 4V2MA 3GYKA 4MJAA 4XHMA 1XIYA 2GQLA 1YKCA 2A4HA 3B55A 2H1DA 4MCUA 3WGXA 1X0RA 1XWBA 4I2UA 3MYDA 1PKWA 4OFTA 3D4MA 3C7MA 4DWLA 1GNEA 1PN0A 5ELAA 3I69A 2DIYA 3IAM1 4LA1A 1K3LA 16GSA 2KOKA 1ZYNA 4K1FA 4RI6A 2IMKA 1XWCA 2LS5A 4KDUA 3L9VA 4XS6A 4JRRA 1GWCA 3TKRA 3F63A 3QDNA 4G76A 4AF2A 4TW5A 4CHSA 1YF1A 3NIVA 1B8XA 3GHAA 4WF4A 3KM6A 4YKFA 1F2EA 3HVXA 4XTSA 3PPUA 4O1OA 2K8VA 3F8UA 2CQ9A 2OE0A 2BJXA 2DJ0A 4WR4A 1GTBA 1O81A 4GSNA 1AAZA 3QOUA 2XBQA 3APOA 4KH7A 3GV1A 1BQ7A 5F07A 4G75A 2H76A 3ZIVA 3KTBA 4EKZA 4EF0A 3SDJA 4MJBA 4KW6A 1TJDA 4KNDA 5IMVA 2LTKA 1ML6A 3M0FA 5F06A 1TKDB 4TR3A 1U6TA 3M9KA 4HFVA 3DKSA 8GSSA 4NHZA 3GKXA 4DSSA 2JZRA 2C80A 1OVNA 2R0GA 3L9UA 4G2EA 1SL2B 3UJ1A 4HU9A 1Z5YE 1VF4A 4XRAA 1Z3EA 3TKSA 2QSBA 4V2LA 4G0KA 2RADA 2DMMA 3ZFLA 2DJJA 3H79A 4K7OA 4HEA2 2HYXA 2KUCA 2H72A 1SK1A 3H1NA 1XBSA 2H6XA 2OBKA 1FOVA 2HRNA 5JWOB 2FWHA 3G7JA 1BAYA 2L6CA 3LJ2A 3KIJA 2MMOA 1TI1A 3CSIA 1GSYA 5IMAA 1PL2A 2CV4A 2LRTA 4HEA1 1VRSD 5ECIB 1KNGA 1IYIA 2KP2A 1QMVA 1ERTA 1WMJA 1ERWA 1VF1A 1EEJA 4PTSA 1G6WA 4XCSA 2JAEA 1HNAA 4HJMA 3UBKA 1XFLA 3APSA 5CAXA 1XW6A 2L57A 4WEYA 1NHYA 3TRQA 4JR6A 3KTLA 2OACA 1GSEA 2LJKA 1WJKA 3O6TA 5G31A 3FEUA 2YV7A 1YKAA 3HJOA 2G2QA 1R7HA 2H73A 1SKWB 3FW2A 9GSSA 10GSA 4EIQA 1J08A 2VO4A 2H1GA 1UVZA 5J3RA 1DUGA 2DJ1A 2H19A 2B1LA 1U87A 5CRDA 2P5QA 4ILFA 2B7KA 3K8NA 1KTEA 3VLNA 3ZREA 1EP8A 3WD6A 3ME8A 2VCQA 1B4QA 4NHWA 2WGRA 3F3QA 3EMPA 4XS4B 1N8JA 2WB9A 1J0FA 2PU9C 1A2LA 2CAZB 1Z7RA 6GSYA 4OAVB 4DSSB 1U3AA 2H71A 1QXHA 4GQCA 3N5OA 2DJ3A 1EZKA 1O8XA 3D21A 3EINA 5DJMA 1ZOFA 5KN2A 2WZ9A 2A2RA 4Q5FA 2X8CA 4J57E 3W8SA 3TRPA 3G7IA 1K0AA 3GFKA 2FUG2 2LNTA 2FU2A 4IBPA 3FKFA 2YNXA 1EGRA 1YF0A 2BL8A 2YFBA 2C0GA 3TOTA 18GSA 3KMOA 4WBRD 4E8EA 3H4KA 4FH8A 3LJ0A 3M8NA 2VLTA 1GSUA 3EMXA 5ABRA 2E7PA 3EPTA 2AAWA 1A2JA 3KGKA 4TR0A 2LJRA 1W3SA 5KN3A 2LRNA 2JB2A 4TRXA 4OCEA 1PRXA 1WP0A 1TU8A 5ECLB 1W89A 4F82A 3CSJA 4TR1A 2FGXA 4HI7A 5H5SA 2LUSA 2FA4A 4YQVA 3Q19A 3D22A 3IOSA 3CSHA 1MTCA 3FZ4A 1GUHA 2KLXA 3CTGA 2LV3A 1B9YC 2CA8A 1RW1A 3IAM2 3WT1A 2BMXA 3VPTA 2MMZA 3L0IA 4IHUA 3ZIJA 2GGTA 2VOCA 1R5PA 5G30A 4GXZA 5GSSA 3LWAA 3GSTA 4EC0A 5HFIA 1U3IA 3RPPA 13GSA 1SJ6A 4YQUA 4I2TA 2VD0A 4CY8A 7GSSA 5ECMB 3APQA 4TN8A 4F0BA 4GCIA 5E59A 3IC8A 4POMA 3IXRA 5DJLA 2MMNA 1K0MA 2B5XA 1GTAA 4G19A 3F4SA 1WIKA 3CQFA 4HS1A 5LNKe 3F4MA 2VCTA 3IV4A 1QK8A 3L4NA 2KHPA 1YY7A 1XW9A 5D96A 4D73B 3C1SA 2VUPA 2X49A 2DJKA 2JBWA 2X8HA 3P90A 5IMCA 1O73A 1WE0A 4ZBAA 3FZ9A 1OKTA 2EIOA 4O32A 2IN3A 4OWYA 1C72A 4ZILA 1T4ZA 5KOXA 3UL3A 4K2DA 3TKSC 1X9SB 1TK5B 2K8SA 4I8BA 1B4PA 5B8BA 2ALBA 5INYA 3HXSA 2YPMA 3WYWA 1SU9A 5IMFA 4TVEA 2CT6A 1SL0B 2FWGA 3V1WA 3RAZA 3EWLA 5FT3A 2HRFA 2CVKA 5ID2A 1O6JA 5F0GA 3LEFA
chains in the Genus database with same CATH topology
3FZAA 4MMMA 4V1Ap 3I9V2 1A8LA 3P2AA 2F8FA 2P31A 2R5GA 3A2XA 1TRWA 3VFIA 1WWJA 1CQHA 5HGIA 3BOAA 1JZDA 2LKUA 3TDGA 2J9HA 3ZTLA 5D9VA 2HI7A 6GSSA 4KCEA 1H4OA 4HZ4A 5HR1A 1GSFA 4ECBA 4POBA 3W6GA 4PX1A 1T00A 4PL5A 2IL3A 2RUEA 2PGTA 3VWXA 2VD1A 1AQWA 4Z2RA 3P7XA 3GUSA 2H1AA 1LBKA 1SKRB 1K0BA 5HFGA 1SYRA 3C73A 2K6VA 1GUMA 17GSA 2FCHA 4N0VA 2I9HA 3M3MA 4AGSA 3E0UA 4V1Ag 2XMXA 1RQMA 4Q5QA 4AJ7A 4KE3A 4WETA 3A5IA 2WFCA 3HZ4A 2REMA 3PR8A 4ZB6A 2WS2A 4H86A 1VGLA 4KA0A 4TXVA 6GSUA 4HDEA 2P5RA 1MDIA 4PQ1A 5DQYA 1XVWA 2HE3A 1PGTA 1M7TA 1XPVA 3UVTA 3BBYA 2PBJA 3GL5A 3FK8A 4POLA 2XBIA 1ERUA 1LU4A 4KSOA 2EIQA 3J7Yb 2VL2C 3UEMA 5COHA 5J4UA 5JWRB 2WULA 3DVXA 2XHFA 3LGCA 2AHEA 4KUNA 2B5YA 1XW5A 2HZFA 2HLSA 5LCZA 2JZTA 3QAGA 2A2PA 2FNOA 3HKRA 2GVPA 4O5QA 2F51A 1T3BA 1ZYPA 3ZL5A 3TJFA 1DBYA 4K5RA 2HFDA 1HNCA 4EVMA 4ZL9A 3HHVA 5ECRB 4V2NA 2XC2A 2H70A 4BVYB 2IFQA 4K5SA 5AIVA 4I97A 2YWMA 5JCUA 4BVXB 4TKYA 4E8HA 3VWWA 4ZBBA 2YJHA 3H8QA 2L59A 1SK0A 5IMDA 2QA1A 2FA8A 3DRNA 3CTFA 2A4VA 3G7YA 1WPIA 2MZCA 4L5LA 3GURA 5L71A 4O5RA 2HRKA 2VAFA 1HD2A 4PUFC 4OMVA 4PQIA 3WT2A 1YZXA 4O92A 5D9WA 3IDVA 2V1CC 1CQGA 2O85A 2K19A 1XOAA 4CY6A 5CNWA 1NHOA 5FWGA 3CRUA 4N11A 1V2AA 2YANA 2AUVA 3UARA 2QGVA 2DKHA 5JCWA 4YKGA 2YFAA 1M9BA 3DIEA 3TB2A 1OC8A 3Q18A 4O7HA 3ERWA 4TOPA 3EYTA 3MAKA 3ZZXA 3TJBA 3UOMA 2GDRA 1OC3A 5ECHB 2MBTA 5GAND 5HFKA 1O7UA 1R26A 1EGOA 2LNSA 4HU7A 5G1LA 1TTZA 4GQFA 3UITA 1GSQA 2V1MA 3ZITA 4K0GA 5A4WA 2XPEA 3FR6A 3ED3A 2R4VA 2OBIA 3TJKA 3Q6OA 2VCZA 2PUKC 1SD8A 4G9HA 4KF9A 5ELGA 3GKMA 2L1LB 1TI3A 2CZ2A 20GSA 3GH9A 1F6MC 4MF6A 2ZCTA 4MF7A 1F3BA 1JZWA 5B7CA 2VM1A 4MJCA 2F8AA 1AQVA 1MD3A 4KB3A 3WGEA 2LEGA 4MJEA 2F9SA 4PQHA 4QQ7A 1V9WA 2H01A 2K9FA 3F0IA 4MA9A 2LRCA 2N5FA 3QFBC 1Y6EA 3QAVA 3LYPA 2Z9SA 2X99A 2CZ3A 1GL8A 4MZBA 3GMFA 4AS3A 3IRAA 3IAS2 3H93A 3GTUB 1I9DA 3TUEA 4FIWA 3HZ8A 5G2ZA 1AW9A 2B1KA 2H74A 2A2DA 4ULXA 4DEJA 4K9ZA 1U5KA 2JB1A 2CVDA 3AJFA 1BG5A 1F9MA 4ECJA 4YZ9A 2VM2A 1K0CA 4IQAA 3KEBA 3PH9A 2HNLA 3R3EA 2NBSA 5IPHA 2CVBA 5J41A 3LJ1A 2OE3A 4EXJA 4F9ZA 3DXBA 5HQPA 2A2CA 1EOGA 2J23A 1GTUA 3TJJA 5DAKB 1TDIA 5KN0A 5G5FA 3KZQA 4KDYA 2B5EA 3KP9A 1MDKA 4MP4A 2C0DA 2DJ2A 1ILOA 5G1KA 2BTOT 2JSYA 1A24A 1AQXA 1Q4JA 4TXOB 1BYEA 2E0QA 3BCIA 4HOJA 1M2DA 3SBCA 2YOIA 3G9BA 4FYCA 4IGJA 1TK8B 6GSVA 2I1UA 5DAKA 1ST9A 2LSTA 4ZL8A 3S9FA 5KN1A 3IC4A 3QCPA 4BWQA 3RDWA 3HJMA 4IP6A 3KMNA 5H5QA 1TRUA 2GQKA 1GSSA 5G5EA 1F3AA 2ON7A 5ECQB 2H0IA 1FVKA 3HYPA 1M99A 3UAPA 2AB6A 1SYXA 3L0HA 4NAXA 1QUWA 3FZ5A 1THOA 2H0HA 5KOWA 6GSWA 5BMUA 5E4WA 5ECSA 2B3SA 2ON5A 5D93A 4KDXA 4POKA 2QC7A 3CXGA 3F4TA 3VURA 3QPMA 4ZL7A 4ZB9A 1PSQA 2R6KA 3SWLA 3TGZA 2VL9A 2DMLA 2TIRA 3LYKA 1PQNA 4JCVE 3TKSE 3KCMA 4MF5A 1AXDA 3DYRA 2I4AA 12GSA 5LNK1 1MEKA 3A2VA 2YCDA 2TRXA 2GZZA 4YH2A 2NPBA 2L5LA 11GSA 3IAS1 3W8JA 4IQ1A 1NM3A 4AS2A 3IPZA 1ZMAA 3DEXA 2DLXA 3I43A 2O87A 4MABA 2IP6A 5IO2A 2M72A 3HY2A 4EIPA 2VL2A 2IIYA 4GLTA 3KXOA 3UVHA 14GSA 5A4VA 2N5AA 2C8UA 3DD3A 2I3YA 1X5EA 4F03A 1PMTA 1N2AA 3LQ7A 2B6MA 2KKMA 1BJXA 2R0CA 2KP1A 1YEXA 1FG4A 3GNJA 4WBJA 4IJ3A 4G10A 4RQXA 1V98A 1QGVA 4ID0A 2K18A 2PVQA 1SL1B 5JWQB 1HNBA 4YAVA 3IHQA 5CP1A 3JSBA 4N30A 1M9AA 3VK9A 3BJ5A 4IP1A 4K7IA 5D9TA 2ZNMA 1H75A 5F05A 1EOHA 4QL7A 4EE0A 2GS3A 4OAUC 5ECOB 3NZNA 4IVFA 2IWTA 2H30A 4RUVA 4BL7A 2MMAA 2HSYA 3VWVA 4X4JA 5DALB 1LJRA 3A5WA 2C3NA 3CMIA 4U6RA 2GT6A 4I5QA 4XS1A 4MDCA 4Z2UA 2MYGA 3CRTA 1URMA 1PKZA 4FO5A 4KGIA 4RI7A 2F3MA 4BWSA 3MIXA 3HDCA 3EU3A 3HJPA 1AUCA 4GTUA 4IELA 2JU5A 1G0TA 4PNFA 3TJGA 2VL3A 4LLRA 3VI7A 1XOBA 4GF0A 2ES7A 3I6AA 3UMAA 2PWJA 1T7PB 1OC9A 3ZMKA 5GAPD 4NV5A 1TXXA 3KJYA 2QSIA 3HVSA 1ABAA 4FYUA 2X64A 1SJIA 2IJYA 1OYJA 2EC4A 3TOUA 1TRSA 4BVXA 4P3YB 4ZBDA 2DKIA 3ME7A 4JU5A 3MWHA 4KSMA 3F6DA 1WRYA 5AGYA 2RIIA 1DE1A 3VPQA 1TK0B 1GRXA 4GRFA 2WDUA 4LMVA 4OD7A 5EY6A 4NPBA 4WR5A 3IK7A 3ZYWA 3D0ZA 2GSQA 2JB3A 2FWEA 4Q5RA 4NXIA 4GWRA 5DDLA 1SENA 1RK4A 2PERA 4ECCA 2A2SA 2MBSA 3M1GA 2L6DA 3AY8A 5GSTA 3MSZA 1JZRA 3QMXA 3PGTA 3C1RA 4F2IA 4MLYA 4CDOA 5JCGA 1JFUA 2AYTA 1XXUA 2V2GA 2OKAA 4BA7A 2IMDA 4ISDA 4EDYA 1K0OA 4PL4A 3Q74A 1TW9A 2ZRRA 4K2XA 1G7EA 4GSSA 2EIRA 3L9SA 2LJAA 2GSRA 4XIHA 1A0RP 4Z7XA 1E6BA 1Z6NA 4G0IA 3U5RE 5DALA 5IIZA 3I9V1 1I5GA 3ERGA 4NMUA 2RIOA 4QL9A 19GSA 3GL3A 4DSRA 1FAAA 3A3TA 1HQOA 1ZYQB 2R2JA 4Q5NA 3D4TA 1Y25A 2N5BA 4MNNA 3TCOA 1A2MA 5HR2A 1FB0A 2M46A 3U6VA 5J9CA 1OAZA 5F8BA 4L8EA 5IM9A 1ERVA 1ZL9A 4K6XA 1WOUA 5IO0A 5DVBA 1UA5A 3O76A 2OADA 4F0CA 5D9XA 4EUYA 2L5OA 1X5CA 1A0FA 2PN8A 2YZUA 2JADA 3EU4A 2AV4A 4IKHA 1M0UA 3US3A 3FR9A 5DCHA 1J9BA 1TRVA 2VCVA 1XVQA 4YAPA 4JZQA 2C0FA 2E2GA 1IYHA 4OO4A 2GT5A 1A8YA 3LFLA 1EV9A 1VF2A 4ICYA 1Z9HA 4YZDA 5BRTA 4CW9A 3ZVJD 1XCCA 5CRWA 2C1YA 2CX4A 5ENUA 4BL7B 5GZZB 4OFNA 4Z2TA 5AN1A 5J5NA 2L4QA 3KH9A 1THXA 1GTIA 3OR5A 2C0EA 4OFMA 5B6NA 4WXTA 1T1VA 3KP8A 1JLVA 2YWIA 2H0GA 3GA4A 1K3OA 4HQZA 4KX4A 5HR3A 1DSBA 4HQSA 1X5DA 1PX6A 3C71A 4X43A 2IMIA 5CYYA 2CAIA 3TRXA 3L78A 4WF5A 1ZYEA 1QQ2A 4NV2A 1O85A 4OCFA 2H75A 1SJ8A 3DA3A 2WRTA 6GSTA 3ZLPA 5CRGA 2H1BA 4BVYA 2YWOA 2B7JA 3D5JA 4ML1A 2R3XA 3M9JA 2UZ8A 2GTUA 2L4CA 1UC7A 1K0DA 4L0UA 1V40A 3F9UA 2YV9A 2V6OA 3GX8A 4XS4A 4L0WA 1FHEA 3IHGA 3IR4A 3UBLA 3J7Yk 1FB6A 1GSDA 3IK9A 4OO5A 5D8IA 3Q8DA 3RPNA 3GX0A 3FBVA 3GH6A 1ON4A 1YEPA 3P8WA 2C4JA 3PINA 1X9WB 5C04A 2YN1A 1YO7A 4HUAA 3RHCA 4ZXGA 2LQOA 4J2FA 4ZIJA 2R0PA 1HYUA 3CYNA 4EDZA 5IOWA 2WJUA 3LXZA 5H5RA 3D6IA 1U88A 2RM6A 2R37A 5A5KA 2CX3A 1B9XC 4G0LA 3DGQA 3NOFA 3F6FA 2QA2A 3F3RA 4K8MA 1MD4A 1ZGNA 2HRAA 4KCAA 1XWKA 3BCKA 3ZMLA 2TRCP 2HT9A 2XPDA 2H8LA 4IN0A 3ISOA 1EWXA 4RQRA 4PNGA 2M80A 5LD0A 3LXTA 1PL1A 3IE3A 1GULA 4MZCA 1SD9A 3VWUA 3HVVA 4MH3A 2FUG1 2G0FA 1GLQA 1OC9B 1T4YA 1GH2A 1PA3A 4TR4A 1JZOA 4O5UA 2YZHA 3P23A 1ZCPA 2E8GA 1F37A 1TP9A 3FHKA 3QD9A 5IMZA 1FVJA 1SK2A 4PUAA 1TOFA 4Z7GA 1S3CA 4I6XA 3ERFA 1GUKA 4EO3A 2FLSA 5EPFA 4AJ6A 2JSZA 2IMFA 2DSAA 1K0NA 3VA9A 1B48A 1S3DA 3LSZA 3VI5A 3EURA 2PMTA 1TU7A 3MNGA 4X1UA 2GZPA 4XRDA 2VLUA 4ECIA 3MDKA 2X8GA 3O3TA 5AIXA 5IPGA 3UIWA 2GLRA 1R4WA 1X9MB 1V57A 4Q9VA 1Z6MA 3LW9A 4L5OA 2X4AA 1M2BA 6GSXA 1KEBA 1UN2A 4ZB8A 2QKEA 2PPTA 2XTRA 3R2QA 5ID2B 2DIZA 4LL1B 2NDOA 4PXOA 2IPAA 2O89A 5HR0A 1ACVA 4MH2A 5ECNB 3E9JB 3GN3A 1SJZA 1PD21 4HZ2A 3TKQA 1QFNA 22GSA 4PGTA 4TXOA 4A5PA 2I81A 1XWGA 4USSA 3FRCA 5CO3A 4O1PA 2RLIA 3FMWA 3GKNA 2O8VB 3GTUA 4EL1A 1NSWA 1PN9A 1MDJA 3IA1A 3WGDA 2C3QA 2IMEA 5B8AA 4N0ZA 5FHIA 1AC1A 3C8EA 1YDKA 2P0GA 2OJLA 4GXTA 1Z7PA 1JLWA 3KD0A 4KAEA 3E3EA 2V6EA 4N10A 5KEJA 2E2MA 3FR3A 4MPFA 1R5AA 3LJRA 4AJ8A 4ACSA 4J56E 3IBHA 3QFAC 5EL8A 4MK3A 4D73A 3GKKA 2F6MB 5J9BA 5CRHA 1S3AA 2D2ZA 1T8EB 4IW9A 3F4RA 2XTQA 3DVWA 2JL4A 1Q98A 2CAQA 2C3TA 3FY7A 3JCML 2FY6A 1GNWA 3DWVA 4I1TA 2DC5A 2YWNA 4MPGA 1JHBA 2H6ZA 5EVOA 3QAWA 5DBQA 2YJ7A 2NVLA 4JR4A 2ZUPA 3LORA 1EV4A 5DCGA 2OE1A 1GLPA 4TR1B 4DSQA 2FWFA 4GSTA 1K3YA 4JBBA 2AJQB 1VF3A 2DBCA 2GZYA 3HD5A 4ML6A 2HZEB 2VIMA 3DMLA 3GIXA 2JACA 4YZCA 1W4VA 4NWYA 5B6MA 1GP1A 1EEMA 5ECPB 2IFQB 3DA4A 3FYGA 3ZVJA 3QR6A 3RBTA 2RM5A 1FOHA 5D73A 5A4UA 2HSMA 3HA9A 4JE1A 1FO5A 3ZFBA 2GSTA 5IOXA 1M2AA 2GSSA 3CBUA 5DQSA 5AISA 1BEDA 4DVCA 1AIUA 3ZRDA 1KBNA 1OE7A 4X0XA 5IQYA 3N9JA 2V6KA 1USBA 1A23A 1PX7A 2VLVA 2HXKA 1SKSB 2V32A 4Z7HA 5ECKB 2O7KA 3TKPA 2NTOA 1YQ1A 3HCZA 2RUFA 2JZSA 4IS0A 4PL3A 3DO9A 2VCXA 2P22B 2VCWA 3EVIA 1OE8A 3KH7A 3A2WA 5CREA 1EP7A 2HSHA 3GRXA 2H66A 2HZEA 4YQMA 1NW2A 3RHBA 4K0NA 1E2YA 4PURA 1ZZYA 4FYBA 1DE2A 1V58A 2OA7A 2YP6A 1XWAA 2LQQA 4HJ2A 2GQMA 4K7NA 4BPYA 2FHEA 2WCIA 3EE2A 3BD2A 2FD3A 3LG6A 3EC3A 2MJFB 1BX9A 1OKDA 4FQUA 2PVOC 2F66B 5C00A 1G7OA 1FW1A 4IJIA 3GSSA 4LMWA 4LL4B 4WKWA 2H6YA 1G6YA 2V41A 1O8WA 4JEDA 4MZWA 1YJ6A 1XZOA 4V2MA 3GYKA 4MJAA 4XHMA 1XIYA 2GQLA 1YKCA 2A4HA 2H1DA 4MCUA 3WGXA 1X0RA 1XWBA 4I2UA 3MYDA 1PKWA 4OFTA 3D4MA 3C7MA 4DWLA 1GNEA 1PN0A 5ELAA 3I69A 2DIYA 3IAM1 4LA1A 1K3LA 16GSA 2KOKA 1ZYNA 4K1FA 4RI6A 2IMKA 1XWCA 2LS5A 4KDUA 3L9VA 4XS6A 4JRRA 1GWCA 3TKRA 3F63A 3QDNA 4G76A 4AF2A 4TW5A 4CHSA 1YF1A 3NIVA 1B8XA 3GHAA 4WF4A 3KM6A 4YKFA 1F2EA 3HVXA 4XTSA 3PPUA 4O1OA 2K8VA 3F8UA 2CQ9A 2OE0A 2BJXA 2DJ0A 4WR4A 1GTBA 1O81A 4GSNA 1AAZA 3QOUA 2XBQA 3APOA 4KH7A 3GV1A 1BQ7A 5F07A 4G75A 2H76A 3ZIVA 3KTBA 4EKZA 4EF0A 3SDJA 4MJBA 4KW6A 1TJDA 4KNDA 5IMVA 2LTKA 1ML6A 3M0FA 5F06A 1TKDB 4TR3A 1U6TA 3M9KA 4HFVA 3DKSA 8GSSA 4NHZA 3GKXA 4DSSA 2JZRA 2C80A 1OVNA 2R0GA 3L9UA 4G2EA 1SL2B 3UJ1A 4HU9A 1Z5YE 1VF4A 4XRAA 1Z3EA 3TKSA 4V2LA 4G0KA 2DMMA 3ZFLA 2DJJA 3H79A 4K7OA 4HEA2 2HYXA 2KUCA 2H72A 1SK1A 3H1NA 1XBSA 2H6XA 2OBKA 1FOVA 2HRNA 5JWOB 2FWHA 3G7JA 1BAYA 2L6CA 3LJ2A 3KIJA 2MMOA 1TI1A 3CSIA 1GSYA 5IMAA 1PL2A 2CV4A 2LRTA 4HEA1 1VRSD 5ECIB 1KNGA 1IYIA 2KP2A 1QMVA 1ERTA 1WMJA 1ERWA 1VF1A 1EEJA 4PTSA 1G6WA 4XCSA 2JAEA 1HNAA 4HJMA 3UBKA 1XFLA 3APSA 5CAXA 1XW6A 2L57A 4WEYA 1NHYA 3TRQA 4JR6A 3KTLA 2OACA 1GSEA 2LJKA 1WJKA 3O6TA 5G31A 3FEUA 2YV7A 1YKAA 3HJOA 2G2QA 1R7HA 2H73A 1SKWB 3FW2A 9GSSA 10GSA 4EIQA 1J08A 2VO4A 2H1GA 1UVZA 5J3RA 1DUGA 2DJ1A 2H19A 2B1LA 1U87A 5CRDA 2P5QA 4ILFA 2B7KA 3K8NA 1KTEA 3VLNA 3ZREA 1EP8A 3WD6A 3ME8A 2VCQA 1B4QA 4NHWA 2WGRA 3F3QA 3EMPA 4XS4B 1N8JA 2WB9A 1J0FA 2PU9C 1A2LA 2CAZB 1Z7RA 6GSYA 4OAVB 4DSSB 1U3AA 2H71A 1QXHA 4GQCA 3N5OA 2DJ3A 1EZKA 1O8XA 3D21A 3EINA 5DJMA 1ZOFA 5KN2A 2WZ9A 2A2RA 4Q5FA 2X8CA 4J57E 3W8SA 3TRPA 3G7IA 1K0AA 3GFKA 2FUG2 2LNTA 4IBPA 3FKFA 2YNXA 1EGRA 1YF0A 2YFBA 2C0GA 3TOTA 18GSA 3KMOA 4WBRD 4E8EA 3H4KA 4FH8A 3LJ0A 3M8NA 2VLTA 1GSUA 3EMXA 5ABRA 2E7PA 3EPTA 2AAWA 1A2JA 3KGKA 4TR0A 2LJRA 1W3SA 5KN3A 2LRNA 2JB2A 4TRXA 4OCEA 1PRXA 1WP0A 1TU8A 5ECLB 1W89A 4F82A 3CSJA 4TR1A 2FGXA 4HI7A 5H5SA 2LUSA 2FA4A 4YQVA 3Q19A 3D22A 3IOSA 3CSHA 1MTCA 3FZ4A 1GUHA 2KLXA 3CTGA 2LV3A 1B9YC 2CA8A 1RW1A 3IAM2 3WT1A 2BMXA 3VPTA 2MMZA 3L0IA 4IHUA 3ZIJA 2GGTA 2VOCA 1R5PA 5G30A 4GXZA 5GSSA 3LWAA 3GSTA 4EC0A 5HFIA 1U3IA 3RPPA 13GSA 1SJ6A 4YQUA 4I2TA 2VD0A 4CY8A 7GSSA 5ECMB 3APQA 4TN8A 4F0BA 4GCIA 5E59A 3IC8A 4POMA 3IXRA 5DJLA 2MMNA 1K0MA 2B5XA 1GTAA 4G19A 3F4SA 1WIKA 4HS1A 5LNKe 3F4MA 2VCTA 3IV4A 1QK8A 3L4NA 2KHPA 1YY7A 1XW9A 5D96A 4D73B 3C1SA 2VUPA 2X49A 2DJKA 2X8HA 3P90A 5IMCA 1O73A 1WE0A 4ZBAA 3FZ9A 1OKTA 2EIOA 4O32A 2IN3A 4OWYA 1C72A 4ZILA 1T4ZA 5KOXA 3UL3A 4K2DA 3TKSC 1X9SB 1TK5B 2K8SA 4I8BA 1B4PA 5B8BA 2ALBA 5INYA 3HXSA 2YPMA 3WYWA 1SU9A 5IMFA 4TVEA 2CT6A 1SL0B 2FWGA 3V1WA 3RAZA 5FT3A 3EWLA 2HRFA 2CVKA 5ID2A 1O6JA 5F0GA 3LEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZA A;  4MMM A;  4V1A p;  3I9V 2;  1A8L A;  3P2A A;  2F8F A;  2P31 A;  2R5G A;  3A2X A;  1TRW A;  3VFI A;  1WWJ A;  1CQH A;  3BOA A;  1JZD A;  2LKU A;  3TDG A;  2J9H A;  3ZTL A;  5D9V A;  2HI7 A;  6GSS A;  4KCE A;  1H4O A;  4HZ4 A;  5HR1 A;  1GSF A;  4ECB A;  4POB A;  3W6G A;  4PX1 A;  1T00 A;  2IL3 A;  2RUE A;  2PGT A;  3VWX A;  2VD1 A;  1AQW A;  3P7X A;  3GUS A;  2H1A A;  1LBK A;  1SKR B;  1K0B A;  5HFG A;  1SYR A;  3C73 A;  2K6V A;  1GUM A;  17GS A;  2FCH A;  4N0V A;  2I9H A;  3M3M A;  4AGS A;  3E0U A;  4V1A g;  1RQM A;  4Q5Q A;  4AJ7 A;  4KE3 A;  4WET A;  2WFC A;  3HZ4 A;  2REM A;  3PR8 A;  4ZB6 A;  2WS2 A;  4H86 A;  1VGL A;  4KA0 A;  4TXV A;  6GSU A;  4HDE A;  2P5R A;  1MDI A;  4PQ1 A;  5DQY A;  1XVW A;  2HE3 A;  1PGT A;  1M7T A;  1XPV A;  3UVT A;  3BBY A;  2PBJ A;  3GL5 A;  3FK8 A;  4POL A;  2XBI A;  1ERU A;  1LU4 A;  4KSO A;  2EIQ A;  3J7Y b;  2VL2 C;  3UEM A;  5COH A;  5J4U A;  5JWR B;  2WUL A;  3DVX A;  2XHF A;  3LGC A;  2AHE A;  4KUN A;  2B5Y A;  1XW5 A;  2HZF A;  2HLS A;  5LCZ A;  2JZT A;  3QAG A;  2FNO A;  3HKR A;  2GVP A;  2F51 A;  1T3B A;  3ZL5 A;  3TJF A;  1DBY A;  2HFD A;  1HNC A;  4EVM A;  4ZL9 A;  3HHV A;  5ECR B;  4V2N A;  2XC2 A;  2H70 A;  2IFQ A;  5AIV A;  4I97 A;  2YWM A;  5JCU A;  4TKY A;  4E8H A;  3VWW A;  4ZBB A;  2YJH A;  3H8Q A;  2L59 A;  1SK0 A;  5IMD A;  2FA8 A;  3DRN A;  3CTF A;  2A4V A;  3G7Y A;  1WPI A;  2MZC A;  4L5L A;  3GUR A;  5L71 A;  4O5R A;  2VAF A;  1HD2 A;  4PUF C;  4OMV A;  4PQI A;  3WT2 A;  1YZX A;  4O92 A;  5D9W A;  3IDV A;  1CQG A;  2O85 A;  1XOA A;  5CNW A;  1NHO A;  5FWG A;  3CRU A;  4N11 A;  1V2A A;  2YAN A;  2AUV A;  3UAR A;  2QGV A;  5JCW A;  1M9B A;  3DIE A;  3TB2 A;  1OC8 A;  3Q18 A;  4O7H A;  3ERW A;  4TOP A;  3EYT A;  3MAK A;  3ZZX A;  3TJB A;  3UOM A;  2GDR A;  1OC3 A;  5ECH B;  2MBT A;  5GAN D;  5HFK A;  1O7U A;  1R26 A;  1EGO A;  2LNS A;  4HU7 A;  5G1L A;  1TTZ A;  4GQF A;  1GSQ A;  2V1M A;  3ZIT A;  4K0G A;  5A4W A;  2XPE A;  3FR6 A;  3ED3 A;  2R4V A;  2OBI A;  3TJK A;  3Q6O A;  2VCZ A;  2PUK C;  1SD8 A;  4G9H A;  5ELG A;  3GKM A;  1TI3 A;  2CZ2 A;  20GS A;  3GH9 A;  1F6M C;  4MF6 A;  2ZCT A;  4MF7 A;  1F3B A;  1JZW A;  5B7C A;  2VM1 A;  4MJC A;  2F8A A;  1AQV A;  1MD3 A;  4KB3 A;  3WGE A;  2LEG A;  4MJE A;  2F9S A;  4PQH A;  4QQ7 A;  1V9W A;  2H01 A;  2K9F A;  3F0I A;  4MA9 A;  2LRC A;  2N5F A;  3QFB C;  1Y6E A;  3QAV A;  3LYP A;  2Z9S A;  2X99 A;  2CZ3 A;  1GL8 A;  4MZB A;  3GMF A;  3IRA A;  3IAS 2;  3H93 A;  3GTU B;  1I9D A;  3TUE A;  4FIW A;  3HZ8 A;  5G2Z A;  1AW9 A;  2B1K A;  2H74 A;  4ULX A;  4DEJ A;  4K9Z A;  2CVD A;  1F9M A;  1BG5 A;  4ECJ A;  2VM2 A;  1K0C A;  4IQA A;  3KEB A;  3PH9 A;  2HNL A;  2NBS A;  5IPH A;  2CVB A;  5J41 A;  2OE3 A;  4EXJ A;  4F9Z A;  3DXB A;  5HQP A;  1EOG A;  2J23 A;  1GTU A;  3TJJ A;  5DAK B;  1TDI A;  5KN0 A;  5G5F A;  3KZQ A;  4KDY A;  2B5E A;  3KP9 A;  1MDK A;  4MP4 A;  2C0D A;  2DJ2 A;  1ILO A;  5G1K A;  2BTO T;  2JSY A;  1A24 A;  1AQX A;  1Q4J A;  4TXO B;  1BYE A;  2E0Q A;  3BCI A;  4HOJ A;  1M2D A;  3SBC A;  2YOI A;  3G9B A;  4FYC A;  4IGJ A;  1TK8 B;  6GSV A;  2I1U A;  5DAK A;  1ST9 A;  2LST A;  4ZL8 A;  3S9F A;  5KN1 A;  3IC4 A;  3QCP A;  4BWQ A;  3RDW A;  3HJM A;  4IP6 A;  3KMN A;  5H5Q A;  1TRU A;  2GQK A;  1GSS A;  5G5E A;  1F3A A;  2ON7 A;  5ECQ B;  2H0I A;  1FVK A;  3HYP A;  1M99 A;  3UAP A;  2AB6 A;  1SYX A;  3L0H A;  4NAX A;  1QUW A;  3FZ5 A;  1THO A;  2H0H A;  6GSW A;  5E4W A;  5ECS A;  2B3S A;  2ON5 A;  5D93 A;  4KDX A;  4POK A;  2QC7 A;  3CXG A;  3F4T A;  3VUR A;  3QPM A;  4ZL7 A;  4ZB9 A;  1PSQ A;  2R6K A;  3SWL A;  3TGZ A;  2VL9 A;  2DML A;  2TIR A;  3LYK A;  1PQN A;  3TKS E;  3KCM A;  4MF5 A;  1AXD A;  3DYR A;  2I4A A;  12GS A;  1MEK A;  3A2V A;  2YCD A;  2TRX A;  2GZZ A;  4YH2 A;  2NPB A;  2L5L A;  11GS A;  3W8J A;  4IQ1 A;  1NM3 A;  3IPZ A;  1ZMA A;  3DEX A;  2DLX A;  3I43 A;  2O87 A;  4MAB A;  5IO2 A;  2M72 A;  3HY2 A;  2VL2 A;  2IIY A;  4GLT A;  3KXO A;  3UVH A;  14GS A;  5A4V A;  2N5A A;  2C8U A;  3DD3 A;  2I3Y A;  1X5E A;  4F03 A;  1PMT A;  1N2A A;  3LQ7 A;  2B6M A;  1BJX A;  2KP1 A;  1YEX A;  1FG4 A;  3GNJ A;  4WBJ A;  4IJ3 A;  4G10 A;  4RQX A;  1V98 A;  1QGV A;  4ID0 A;  2K18 A;  2PVQ A;  1SL1 B;  5JWQ B;  1HNB A;  4YAV A;  3IHQ A;  5CP1 A;  4N30 A;  1M9A A;  3VK9 A;  3BJ5 A;  4IP1 A;  4K7I A;  5D9T A;  2ZNM A;  1H75 A;  5F05 A;  1EOH A;  4QL7 A;  4EE0 A;  2GS3 A;  5ECO B;  3NZN A;  4IVF A;  2IWT A;  2H30 A;  4RUV A;  4BL7 A;  2MMA A;  2HSY A;  3VWV A;  5DAL B;  1LJR A;  3A5W A;  2C3N A;  3CMI A;  2GT6 A;  4I5Q A;  4XS1 A;  4MDC A;  2MYG A;  3CRT A;  1URM A;  1PKZ A;  4FO5 A;  4KGI A;  4RI7 A;  2F3M A;  4BWS A;  3HDC A;  3EU3 A;  3HJP A;  1AUC A;  4GTU A;  4IEL A;  2JU5 A;  1G0T A;  4PNF A;  3TJG A;  2VL3 A;  4LLR A;  3VI7 A;  1XOB A;  4GF0 A;  2ES7 A;  3I6A A;  3UMA A;  2PWJ A;  1T7P B;  1OC9 A;  3ZMK A;  5GAP D;  4NV5 A;  1TXX A;  3KJY A;  2QSI A;  3HVS A;  1ABA A;  4FYU A;  2X64 A;  1SJI A;  2IJY A;  1OYJ A;  2EC4 A;  3TOU A;  1TRS A;  4BVX A;  4P3Y B;  4ZBD A;  3ME7 A;  4JU5 A;  3MWH A;  4KSM A;  3F6D A;  1WRY A;  5AGY A;  2RII A;  1DE1 A;  3VPQ A;  1TK0 B;  1GRX A;  4GRF A;  2WDU A;  4LMV A;  4OD7 A;  5EY6 A;  4NPB A;  4WR5 A;  3IK7 A;  3ZYW A;  3D0Z A;  2GSQ A;  2FWE A;  4Q5R A;  4NXI A;  4GWR A;  5DDL A;  1SEN A;  1RK4 A;  2PER A;  4ECC A;  2A2S A;  2MBS A;  3M1G A;  2L6D A;  3AY8 A;  5GST A;  3MSZ A;  1JZR A;  3QMX A;  3PGT A;  3C1R A;  4F2I A;  4MLY A;  4CDO A;  5JCG A;  1JFU A;  2AYT A;  1XXU A;  2V2G A;  2OKA A;  4BA7 A;  2IMD A;  4ISD A;  4EDY A;  1K0O A;  3Q74 A;  1TW9 A;  1G7E A;  4GSS A;  2EIR A;  3L9S A;  2LJA A;  2GSR A;  4XIH A;  1A0R P;  4Z7X A;  1E6B A;  1Z6N A;  3U5R E;  5DAL A;  5IIZ A;  1I5G A;  3ERG A;  4NMU A;  4QL9 A;  19GS A;  3GL3 A;  4DSR A;  1FAA A;  3A3T A;  1HQO A;  1ZYQ B;  2R2J A;  4Q5N A;  3D4T A;  1Y25 A;  2N5B A;  3TCO A;  1A2M A;  5HR2 A;  1FB0 A;  2M46 A;  3U6V A;  5J9C A;  1OAZ A;  5F8B A;  4L8E A;  5IM9 A;  1ERV A;  1ZL9 A;  4K6X A;  1WOU A;  5IO0 A;  5DVB A;  1UA5 A;  3O76 A;  2OAD A;  4F0C A;  5D9X A;  4EUY A;  2L5O A;  1X5C A;  1A0F A;  2PN8 A;  2YZU A;  2JAD A;  3EU4 A;  2AV4 A;  4IKH A;  1M0U A;  3US3 A;  3FR9 A;  5DCH A;  1J9B A;  1TRV A;  2VCV A;  1XVQ A;  4YAP A;  4JZQ A;  2C0F A;  2E2G A;  1IYH A;  4OO4 A;  2GT5 A;  1A8Y A;  3LFL A;  1EV9 A;  1VF2 A;  1Z9H A;  4CW9 A;  3ZVJ D;  1XCC A;  5CRW A;  2C1Y A;  2CX4 A;  5ENU A;  5GZZ B;  4OFN A;  5AN1 A;  5J5N A;  2L4Q A;  3KH9 A;  1THX A;  1GTI A;  3OR5 A;  2C0E A;  4OFM A;  5B6N A;  4WXT A;  1T1V A;  3KP8 A;  1JLV A;  2YWI A;  2H0G A;  3GA4 A;  1K3O A;  4HQZ A;  4KX4 A;  5HR3 A;  1DSB A;  4HQS A;  1X5D A;  1PX6 A;  3C71 A;  4X43 A;  2IMI A;  5CYY A;  2CAI A;  3TRX A;  3L78 A;  4WF5 A;  1ZYE A;  1QQ2 A;  4NV2 A;  1O85 A;  4OCF A;  2H75 A;  2WRT A;  6GST A;  3ZLP A;  5CRG A;  2H1B A;  4BVY A;  2YWO A;  2B7J A;  3D5J A;  4ML1 A;  2R3X A;  3M9J A;  2GTU A;  2L4C A;  1UC7 A;  1K0D A;  4L0U A;  1V40 A;  3F9U A;  2YV9 A;  2V6O A;  3GX8 A;  4XS4 A;  4L0W A;  1FHE A;  3IR4 A;  3UBL A;  3J7Y k;  1FB6 A;  1GSD A;  3IK9 A;  4OO5 A;  5D8I A;  3RPN A;  3GX0 A;  3GH6 A;  1ON4 A;  1YEP A;  3P8W A;  2C4J A;  3PIN A;  1X9W B;  5C04 A;  2YN1 A;  4HUA A;  3RHC A;  4ZXG A;  2LQO A;  4J2F A;  4ZIJ A;  1HYU A;  3CYN A;  4EDZ A;  5IOW A;  2WJU A;  3LXZ A;  5H5R A;  3D6I A;  1U88 A;  2RM6 A;  2R37 A;  5A5K A;  2CX3 A;  1B9X C;  3DGQ A;  3NOF A;  3F6F A;  3F3R A;  4K8M A;  1MD4 A;  1ZGN A;  4KCA A;  1XWK A;  3BCK A;  3ZML A;  2TRC P;  2HT9 A;  2XPD A;  2H8L A;  4IN0 A;  3ISO A;  1EWX A;  4RQR A;  4PNG A;  2M80 A;  5LD0 A;  3LXT A;  1PL1 A;  3IE3 A;  1GUL A;  4MZC A;  1SD9 A;  3VWU A;  3HVV A;  4MH3 A;  2G0F A;  1GLQ A;  1OC9 B;  1T4Y A;  1GH2 A;  1PA3 A;  4TR4 A;  1JZO A;  2YZH A;  1ZCP A;  1F37 A;  1TP9 A;  3FHK A;  3QD9 A;  5IMZ A;  1FVJ A;  1SK2 A;  4PUA A;  1TOF A;  1S3C A;  4I6X A;  3ERF A;  1GUK A;  4EO3 A;  2FLS A;  5EPF A;  4AJ6 A;  2JSZ A;  2IMF A;  2DSA A;  1K0N A;  1B48 A;  1S3D A;  3LSZ A;  3VI5 A;  3EUR A;  2PMT A;  1TU7 A;  3MNG A;  4X1U A;  2GZP A;  4XRD A;  2VLU A;  4ECI A;  3MDK A;  2X8G A;  3O3T A;  5AIX A;  5IPG A;  3UIW A;  2GLR A;  1R4W A;  1X9M B;  1V57 A;  1Z6M A;  4L5O A;  1M2B A;  6GSX A;  1KEB A;  1UN2 A;  4ZB8 A;  2QKE A;  2PPT A;  3R2Q A;  5ID2 B;  2DIZ A;  4LL1 B;  2NDO A;  4PXO A;  2IPA A;  2O89 A;  5HR0 A;  1ACV A;  4MH2 A;  5ECN B;  3E9J B;  3GN3 A;  1SJZ A;  1PD2 1;  4HZ2 A;  3TKQ A;  1QFN A;  22GS A;  4PGT A;  4TXO A;  2I81 A;  1XWG A;  3FRC A;  5CO3 A;  2RLI A;  3GKN A;  2O8V B;  3GTU A;  4EL1 A;  1NSW A;  1PN9 A;  1MDJ A;  3IA1 A;  3WGD A;  2C3Q A;  2IME A;  5B8A A;  4N0Z A;  5FHI A;  1AC1 A;  3C8E A;  1YDK A;  2P0G A;  2OJL A;  1Z7P A;  1JLW A;  3KD0 A;  4KAE A;  3E3E A;  4N10 A;  5KEJ A;  2E2M A;  3FR3 A;  4MPF A;  1R5A A;  3LJR A;  4AJ8 A;  4ACS A;  4J56 E;  3IBH A;  3QFA C;  5EL8 A;  4MK3 A;  4D73 A;  3GKK A;  5J9B A;  5CRH A;  1S3A A;  2D2Z A;  1T8E B;  4IW9 A;  3F4R A;  3DVW A;  2JL4 A;  1Q98 A;  2CAQ A;  2C3T A;  3FY7 A;  3JCM L;  2FY6 A;  1GNW A;  3DWV A;  2DC5 A;  2YWN A;  4MPG A;  1JHB A;  2H6Z A;  5EVO A;  3QAW A;  5DBQ A;  2YJ7 A;  2NVL A;  4JR4 A;  2ZUP A;  3LOR A;  1EV4 A;  5DCG A;  2OE1 A;  1GLP A;  4TR1 B;  4DSQ A;  2FWF A;  4GST A;  1K3Y A;  4JBB A;  2AJQ B;  1VF3 A;  2DBC A;  2GZY A;  3HD5 A;  4ML6 A;  2HZE B;  2VIM A;  3DML A;  3GIX A;  2JAC A;  1W4V A;  4NWY A;  5B6M A;  1GP1 A;  1EEM A;  5ECP B;  2IFQ B;  3FYG A;  3ZVJ A;  3QR6 A;  3RBT A;  2RM5 A;  5D73 A;  5A4U A;  3HA9 A;  4JE1 A;  1FO5 A;  3ZFB A;  2GST A;  5IOX A;  1M2A A;  2GSS A;  3CBU A;  5DQS A;  5AIS A;  1BED A;  4DVC A;  1AIU A;  3ZRD A;  1KBN A;  1OE7 A;  4X0X A;  5IQY A;  3N9J A;  2V6K A;  1USB A;  1A23 A;  1PX7 A;  2VLV A;  2HXK A;  1SKS B;  2V32 A;  5ECK B;  2O7K A;  3TKP A;  2NTO A;  1YQ1 A;  3HCZ A;  2RUF A;  2JZS A;  4IS0 A;  2VCX A;  2VCW A;  3EVI A;  1OE8 A;  3KH7 A;  3A2W A;  5CRE A;  1EP7 A;  2HSH A;  3GRX A;  2H66 A;  2HZE A;  4YQM A;  1NW2 A;  3RHB A;  4K0N A;  1E2Y A;  4PUR A;  1ZZY A;  4FYB A;  1DE2 A;  1V58 A;  2OA7 A;  2YP6 A;  1XWA A;  2LQQ A;  4HJ2 A;  2GQM A;  4K7N A;  4BPY A;  2FHE A;  2WCI A;  3EE2 A;  3BD2 A;  2FD3 A;  3LG6 A;  3EC3 A;  1BX9 A;  1OKD A;  2PVO C;  5C00 A;  1G7O A;  1FW1 A;  4IJI A;  3GSS A;  4LMW A;  4LL4 B;  4WKW A;  2H6Y A;  1G6Y A;  2V41 A;  1O8W A;  4JED A;  4MZW A;  1YJ6 A;  1XZO A;  4V2M A;  3GYK A;  4MJA A;  4XHM A;  1XIY A;  2GQL A;  1YKC A;  2H1D A;  4MCU A;  3WGX A;  1X0R A;  1XWB A;  4I2U A;  1PKW A;  4OFT A;  3D4M A;  3C7M A;  1GNE A;  5ELA A;  3I69 A;  2DIY A;  4LA1 A;  1K3L A;  16GS A;  2KOK A;  4K1F A;  4RI6 A;  2IMK A;  1XWC A;  2LS5 A;  4KDU A;  3L9V A;  4XS6 A;  4JRR A;  1GWC A;  3TKR A;  3F63 A;  3QDN A;  4AF2 A;  4TW5 A;  4CHS A;  1YF1 A;  3NIV A;  1B8X A;  3GHA A;  4WF4 A;  3KM6 A;  1F2E A;  3HVX A;  4XTS A;  2K8V A;  3F8U A;  2CQ9 A;  2OE0 A;  2BJX A;  2DJ0 A;  4WR4 A;  1GTB A;  1O81 A;  4GSN A;  1AAZ A;  3QOU A;  2XBQ A;  3APO A;  4KH7 A;  3GV1 A;  1BQ7 A;  5F07 A;  2H76 A;  3ZIV A;  3KTB A;  4EKZ A;  4EF0 A;  4MJB A;  4KW6 A;  1TJD A;  4KND A;  5IMV A;  2LTK A;  1ML6 A;  3M0F A;  5F06 A;  1TKD B;  4TR3 A;  1U6T A;  3M9K A;  3DKS A;  8GSS A;  4NHZ A;  3GKX A;  4DSS A;  2JZR A;  2C80 A;  1OVN A;  3L9U A;  4G2E A;  1SL2 B;  3UJ1 A;  4HU9 A;  1Z5Y E;  1VF4 A;  4XRA A;  1Z3E A;  3TKS A;  4V2L A;  2DMM A;  3ZFL A;  2DJJ A;  3H79 A;  4K7O A;  4HEA 2;  2HYX A;  2KUC A;  2H72 A;  1SK1 A;  3H1N A;  1XBS A;  2H6X A;  2OBK A;  1FOV A;  2HRN A;  5JWO B;  2FWH A;  3G7J A;  1BAY A;  2L6C A;  3KIJ A;  2MMO A;  1TI1 A;  3CSI A;  1GSY A;  5IMA A;  1PL2 A;  2CV4 A;  2LRT A;  1VRS D;  5ECI B;  1KNG A;  1IYI A;  2KP2 A;  1QMV A;  1ERT A;  1WMJ A;  1ERW A;  1VF1 A;  1EEJ A;  1G6W A;  4XCS A;  1HNA A;  4HJM A;  3UBK A;  1XFL A;  3APS A;  5CAX A;  1XW6 A;  2L57 A;  4WEY A;  1NHY A;  3TRQ A;  4JR6 A;  3KTL A;  2OAC A;  1GSE A;  2LJK A;  1WJK A;  3O6T A;  5G31 A;  3FEU A;  2YV7 A;  1YKA A;  3HJO A;  2G2Q A;  1R7H A;  2H73 A;  1SKW B;  3FW2 A;  9GSS A;  10GS A;  1J08 A;  2VO4 A;  2H1G A;  1UVZ A;  5J3R A;  1DUG A;  2DJ1 A;  2H19 A;  2B1L A;  1U87 A;  5CRD A;  2P5Q A;  4ILF A;  2B7K A;  3K8N A;  1KTE A;  3VLN A;  3ZRE A;  1EP8 A;  3WD6 A;  3ME8 A;  2VCQ A;  1B4Q A;  4NHW A;  2WGR A;  3F3Q A;  3EMP A;  4XS4 B;  1N8J A;  2WB9 A;  1J0F A;  2PU9 C;  1A2L A;  1Z7R A;  6GSY A;  4DSS B;  1U3A A;  2H71 A;  1QXH A;  4GQC A;  3N5O A;  2DJ3 A;  1EZK A;  1O8X A;  3D21 A;  3EIN A;  5DJM A;  1ZOF A;  5KN2 A;  2WZ9 A;  2A2R A;  4Q5F A;  2X8C A;  4J57 E;  3W8S A;  3TRP A;  3G7I A;  1K0A A;  3GFK A;  2FUG 2;  2LNT A;  4IBP A;  3FKF A;  2YNX A;  1EGR A;  1YF0 A;  2C0G A;  3TOT A;  18GS A;  3KMO A;  4WBR D;  4E8E A;  3H4K A;  4FH8 A;  3M8N A;  2VLT A;  1GSU A;  3EMX A;  5ABR A;  2E7P A;  2AAW A;  1A2J A;  3KGK A;  4TR0 A;  2LJR A;  5KN3 A;  2LRN A;  4TRX A;  4OCE A;  1PRX A;  1WP0 A;  1TU8 A;  5ECL B;  1W89 A;  4F82 A;  3CSJ A;  4TR1 A;  2FGX A;  4HI7 A;  5H5S A;  2LUS A;  2FA4 A;  4YQV A;  3Q19 A;  3D22 A;  3IOS A;  3CSH A;  1MTC A;  3FZ4 A;  1GUH A;  2KLX A;  3CTG A;  2LV3 A;  1B9Y C;  2CA8 A;  1RW1 A;  3IAM 2;  3WT1 A;  2BMX A;  3VPT A;  2MMZ A;  3ZIJ A;  4IHU A;  2GGT A;  2VOC A;  1R5P A;  5G30 A;  4GXZ A;  5GSS A;  3LWA A;  3GST A;  4EC0 A;  5HFI A;  1U3I A;  3RPP A;  13GS A;  1SJ6 A;  4YQU A;  4I2T A;  2VD0 A;  7GSS A;  5ECM B;  3APQ A;  4TN8 A;  4F0B A;  4GCI A;  5E59 A;  4POM A;  3IXR A;  5DJL A;  2MMN A;  1K0M A;  2B5X A;  1GTA A;  4G19 A;  3F4S A;  1WIK A;  4HS1 A;  5LNK e;  2VCT A;  3IV4 A;  1QK8 A;  3L4N A;  2KHP A;  1YY7 A;  1XW9 A;  5D96 A;  4D73 B;  3C1S A;  2VUP A;  2DJK A;  2X8H A;  3P90 A;  5IMC A;  1O73 A;  1WE0 A;  4ZBA A;  3FZ9 A;  1OKT A;  2EIO A;  4O32 A;  2IN3 A;  4OWY A;  1C72 A;  4ZIL A;  1T4Z A;  3UL3 A;  4K2D A;  3TKS C;  1X9S B;  1TK5 B;  2K8S A;  4I8B A;  1B4P A;  5B8B A;  2ALB A;  5INY A;  3HXS A;  3WYW A;  2YPM A;  1SU9 A;  5IMF A;  4TVE A;  2CT6 A;  1SL0 B;  2FWG A;  3V1W A;  3RAZ A;  5FT3 A;  3EWL A;  2HRF A;  2CVK A;  5ID2 A;  1O6J A;  5F0G A;  3LEF A; 
#chains in the Genus database with same CATH topology
 1M3I A;  3FZA A;  4MMM A;  4V1A p;  3I9V 2;  1A8L A;  3P2A A;  2F8F A;  2P31 A;  2R5G A;  3A2X A;  1TRW A;  3VFI A;  1WWJ A;  1CQH A;  5HGI A;  3BOA A;  1JZD A;  2LKU A;  3TDG A;  2J9H A;  3ZTL A;  5D9V A;  2HI7 A;  6GSS A;  4KCE A;  1H4O A;  4HZ4 A;  5HR1 A;  1GSF A;  4ECB A;  4POB A;  3W6G A;  4PX1 A;  1T00 A;  4PL5 A;  2IL3 A;  2RUE A;  2PGT A;  3VWX A;  2VD1 A;  1AQW A;  4Z2R A;  3P7X A;  3GUS A;  2H1A A;  1LBK A;  1SKR B;  1K0B A;  5HFG A;  1SYR A;  3C73 A;  2K6V A;  1GUM A;  17GS A;  2FCH A;  4N0V A;  2I9H A;  3M3M A;  4AGS A;  3E0U A;  4V1A g;  2XMX A;  1RQM A;  4Q5Q A;  4AJ7 A;  4KE3 A;  4WET A;  3A5I A;  2WFC A;  3HZ4 A;  2REM A;  3PR8 A;  4ZB6 A;  2WS2 A;  4H86 A;  1VGL A;  4KA0 A;  4TXV A;  6GSU A;  4HDE A;  2P5R A;  1MDI A;  4PQ1 A;  5DQY A;  1XVW A;  2HE3 A;  1PGT A;  1M7T A;  1XPV A;  3UVT A;  3BBY A;  2PBJ A;  3GL5 A;  3FK8 A;  4POL A;  2XBI A;  1ERU A;  1LU4 A;  4KSO A;  2EIQ A;  3J7Y b;  2VL2 C;  3UEM A;  5COH A;  5J4U A;  5JWR B;  2WUL A;  3DVX A;  2XHF A;  3LGC A;  2AHE A;  4KUN A;  2B5Y A;  1XW5 A;  2HZF A;  2HLS A;  5LCZ A;  2JZT A;  3QAG A;  2A2P A;  2FNO A;  3HKR A;  2GVP A;  4O5Q A;  2F51 A;  1T3B A;  1ZYP A;  3ZL5 A;  3TJF A;  1DBY A;  4K5R A;  2HFD A;  1HNC A;  4EVM A;  4ZL9 A;  3HHV A;  5ECR B;  4V2N A;  2XC2 A;  2H70 A;  4BVY B;  2IFQ A;  4K5S A;  5AIV A;  4I97 A;  2YWM A;  5JCU A;  4BVX B;  4TKY A;  4E8H A;  3VWW A;  4ZBB A;  2YJH A;  3H8Q A;  2L59 A;  1SK0 A;  5IMD A;  2QA1 A;  2FA8 A;  3DRN A;  3CTF A;  2A4V A;  3G7Y A;  1WPI A;  2MZC A;  4L5L A;  3GUR A;  5L71 A;  4O5R A;  2HRK A;  2VAF A;  1HD2 A;  4PUF C;  4OMV A;  4PQI A;  3WT2 A;  1YZX A;  4O92 A;  5D9W A;  3IDV A;  2V1C C;  1CQG A;  2O85 A;  2K19 A;  1XOA A;  4CY6 A;  5CNW A;  1NHO A;  5FWG A;  3CRU A;  4N11 A;  1V2A A;  2YAN A;  2AUV A;  3UAR A;  2QGV A;  2DKH A;  5JCW A;  4YKG A;  2YFA A;  1M9B A;  3DIE A;  3TB2 A;  1OC8 A;  3Q18 A;  4O7H A;  3ERW A;  4TOP A;  3EYT A;  3MAK A;  3ZZX A;  3TJB A;  3UOM A;  2GDR A;  1OC3 A;  5ECH B;  2MBT A;  5GAN D;  5HFK A;  1O7U A;  1R26 A;  1EGO A;  2LNS A;  4HU7 A;  5G1L A;  1TTZ A;  4GQF A;  3UIT A;  1GSQ A;  2V1M A;  2FEF A;  3ZIT A;  4K0G A;  5A4W A;  2XPE A;  3FR6 A;  3ED3 A;  2R4V A;  2OBI A;  3TJK A;  3Q6O A;  2VCZ A;  2PUK C;  1SD8 A;  4G9H A;  4KF9 A;  5ELG A;  3GKM A;  2L1L B;  1TI3 A;  4BIK A;  2ZW3 A;  2CZ2 A;  20GS A;  3GH9 A;  1F6M C;  4MF6 A;  2ZCT A;  4MF7 A;  1F3B A;  1JZW A;  5B7C A;  2VM1 A;  4MJC A;  2F8A A;  1AQV A;  1MD3 A;  4KB3 A;  3WGE A;  2LEG A;  4MJE A;  2F9S A;  4PQH A;  4QQ7 A;  1V9W A;  2H01 A;  2K9F A;  3F0I A;  4MA9 A;  2LRC A;  2N5F A;  3QFB C;  1Y6E A;  3QAV A;  3LYP A;  2Z9S A;  2X99 A;  2CZ3 A;  1GL8 A;  4MZB A;  3GMF A;  4AS3 A;  3IRA A;  3IAS 2;  3H93 A;  3GTU B;  1I9D A;  3TUE A;  4FIW A;  3HZ8 A;  5G2Z A;  1AW9 A;  2B1K A;  2H74 A;  2A2D A;  4ULX A;  4DEJ A;  4K9Z A;  1U5K A;  2JB1 A;  2CVD A;  3AJF A;  1BG5 A;  1F9M A;  4ECJ A;  4YZ9 A;  2VM2 A;  1K0C A;  4IQA A;  3KEB A;  3PH9 A;  2HNL A;  3R3E A;  2NBS A;  5IPH A;  2CVB A;  5J41 A;  3LJ1 A;  2OE3 A;  4EXJ A;  4F9Z A;  3DXB A;  5HQP A;  2A2C A;  1EOG A;  2J23 A;  1GTU A;  3TJJ A;  5DAK B;  1TDI A;  5KN0 A;  5G5F A;  3KZQ A;  4KDY A;  2B5E A;  3KP9 A;  1MDK A;  4MP4 A;  2C0D A;  2DJ2 A;  1ILO A;  5G1K A;  2BTO T;  2JSY A;  1A24 A;  1AQX A;  1Q4J A;  4TXO B;  1BYE A;  2E0Q A;  3BCI A;  4HOJ A;  1M2D A;  3SBC A;  2YOI A;  3G9B A;  4FYC A;  4IGJ A;  1TK8 B;  6GSV A;  2QZG A;  2I1U A;  5DAK A;  1ST9 A;  2LST A;  4ZL8 A;  3S9F A;  5KN1 A;  3IC4 A;  3QCP A;  4BWQ A;  3RDW A;  3HJM A;  4IP6 A;  3KMN A;  5H5Q A;  1TRU A;  2GQK A;  1GSS A;  5G5E A;  1F3A A;  2ON7 A;  5ECQ B;  2H0I A;  1FVK A;  3HYP A;  1M99 A;  3UAP A;  2AB6 A;  1SYX A;  3L0H A;  4NAX A;  1QUW A;  3FZ5 A;  1THO A;  2H0H A;  5KOW A;  6GSW A;  5BMU A;  5E4W A;  5ECS A;  2B3S A;  2ON5 A;  5D93 A;  4KDX A;  4POK A;  2QC7 A;  3CXG A;  3F4T A;  3VUR A;  3QPM A;  4ZL7 A;  4ZB9 A;  1PSQ A;  2R6K A;  3SWL A;  3TGZ A;  2VL9 A;  2DML A;  2TIR A;  3LYK A;  1PQN A;  4JCV E;  3TKS E;  3KCM A;  4MF5 A;  1AXD A;  3DYR A;  2I4A A;  12GS A;  5LNK 1;  1MEK A;  3A2V A;  2YCD A;  2TRX A;  2GZZ A;  4YH2 A;  2NPB A;  2L5L A;  11GS A;  3IAS 1;  3W8J A;  4IQ1 A;  1NM3 A;  4AS2 A;  3IPZ A;  1ZMA A;  3DEX A;  2DLX A;  3I43 A;  2O87 A;  4MAB A;  2IP6 A;  5IO2 A;  2M72 A;  3HY2 A;  4EIP A;  2VL2 A;  2IIY A;  4GLT A;  3KXO A;  3UVH A;  14GS A;  5A4V A;  2N5A A;  2C8U A;  3DD3 A;  2I3Y A;  1X5E A;  4F03 A;  1PMT A;  1N2A A;  3LQ7 A;  2B6M A;  2KKM A;  1BJX A;  2R0C A;  2KP1 A;  2RLD A;  1FG4 A;  1YEX A;  3GNJ A;  4WBJ A;  4IJ3 A;  4G10 A;  4RQX A;  1V98 A;  1QGV A;  4ID0 A;  2K18 A;  2PVQ A;  1SL1 B;  5JWQ B;  1HNB A;  4YAV A;  3IHQ A;  5CP1 A;  3JSB A;  4N30 A;  1M9A A;  3VK9 A;  3BJ5 A;  4IP1 A;  4K7I A;  5D9T A;  2ZNM A;  1H75 A;  5F05 A;  1EOH A;  4QL7 A;  4EE0 A;  2GS3 A;  4OAU C;  5ECO B;  3NZN A;  4IVF A;  1TDP A;  2IWT A;  2H30 A;  4RUV A;  4BL7 A;  2MMA A;  2HSY A;  3VWV A;  4X4J A;  5DAL B;  1LJR A;  3A5W A;  2C3N A;  3CMI A;  4U6R A;  2GT6 A;  4I5Q A;  4XS1 A;  4MDC A;  4Z2U A;  2MYG A;  3CRT A;  1URM A;  1PKZ A;  4FO5 A;  4KGI A;  4RI7 A;  2F3M A;  4BWS A;  3MIX A;  3HDC A;  3EU3 A;  3HJP A;  1AUC A;  4GTU A;  4IEL A;  2JU5 A;  1G0T A;  4PNF A;  3TJG A;  2VL3 A;  4LLR A;  3VI7 A;  1XOB A;  4GF0 A;  2ES7 A;  3I6A A;  3UMA A;  2PWJ A;  1T7P B;  1OC9 A;  3ZMK A;  5GAP D;  4NV5 A;  1TXX A;  3KJY A;  2QSI A;  3HVS A;  1ABA A;  4FYU A;  2X64 A;  1SJI A;  2IJY A;  1OYJ A;  2EC4 A;  3TOU A;  1TRS A;  4BVX A;  4P3Y B;  4ZBD A;  2DKI A;  3ME7 A;  4JU5 A;  3MWH A;  4KSM A;  3F6D A;  1WRY A;  5AGY A;  2RII A;  1DE1 A;  3VPQ A;  1TK0 B;  1GRX A;  4GRF A;  2WDU A;  4LMV A;  4OD7 A;  5EY6 A;  4NPB A;  4WR5 A;  3IK7 A;  3ZYW A;  3D0Z A;  2GSQ A;  2JB3 A;  2FWE A;  4Q5R A;  4NXI A;  4GWR A;  5DDL A;  1SEN A;  4HSC X;  1RK4 A;  2PER A;  4ECC A;  2A2S A;  2MBS A;  3M1G A;  2L6D A;  3AY8 A;  5GST A;  3MSZ A;  1JZR A;  3QMX A;  3PGT A;  3C1R A;  4F2I A;  4MLY A;  4CDO A;  1PFO A;  5JCG A;  1JFU A;  2AYT A;  1XXU A;  2V2G A;  2OKA A;  4BA7 A;  2IMD A;  4ISD A;  4EDY A;  1K0O A;  4PL4 A;  3Q74 A;  1TW9 A;  2ZRR A;  4K2X A;  1G7E A;  4GSS A;  2HGK A;  2EIR A;  3L9S A;  2LJA A;  2GSR A;  3FNB A;  4XIH A;  1A0R P;  4Z7X A;  1E6B A;  1Z6N A;  4G0I A;  3U5R E;  5DAL A;  5IIZ A;  3I9V 1;  1I5G A;  3ERG A;  4NMU A;  2RIO A;  4QL9 A;  19GS A;  3GL3 A;  4DSR A;  1FAA A;  3A3T A;  1HQO A;  1ZYQ B;  2R2J A;  4Q5N A;  3FVV A;  3D4T A;  1Y25 A;  2N5B A;  4MNN A;  3TCO A;  1A2M A;  5HR2 A;  1FB0 A;  2M46 A;  3U6V A;  5J9C A;  1OAZ A;  5F8B A;  4L8E A;  5IM9 A;  1ERV A;  1ZL9 A;  4K6X A;  1WOU A;  5IO0 A;  5DVB A;  1UA5 A;  3O76 A;  2OAD A;  4F0C A;  5D9X A;  4EUY A;  2L5O A;  1X5C A;  1A0F A;  2PN8 A;  2ETD A;  2YZU A;  2JAD A;  3EU4 A;  2AV4 A;  4IKH A;  1M0U A;  3US3 A;  3FR9 A;  5DCH A;  1J9B A;  1TRV A;  2VCV A;  1XVQ A;  4YAP A;  4JZQ A;  2C0F A;  2E2G A;  1IYH A;  4OO4 A;  2GT5 A;  1A8Y A;  3LFL A;  1EV9 A;  1VF2 A;  4ICY A;  1Z9H A;  4YZD A;  5BRT A;  4CW9 A;  3ZVJ D;  1XCC A;  5CRW A;  2C1Y A;  2CX4 A;  5ENU A;  4BL7 B;  5GZZ B;  4OFN A;  4Z2T A;  5AN1 A;  5J5N A;  2L4Q A;  3KH9 A;  1THX A;  1GTI A;  3OR5 A;  2C0E A;  4OFM A;  5B6N A;  4WXT A;  1T1V A;  3KP8 A;  1JLV A;  2YWI A;  2H0G A;  3GA4 A;  1K3O A;  4HQZ A;  4KX4 A;  5HR3 A;  1DSB A;  4HQS A;  1X5D A;  1PX6 A;  3C71 A;  4X43 A;  2IMI A;  5CYY A;  1XG8 A;  2CAI A;  3TRX A;  3L78 A;  4WF5 A;  1ZYE A;  1QQ2 A;  4NV2 A;  1O85 A;  4OCF A;  2H75 A;  1SJ8 A;  3DA3 A;  2WRT A;  6GST A;  3ZLP A;  5CRG A;  2H1B A;  4BVY A;  2YWO A;  2B7J A;  3D5J A;  4ML1 A;  2R3X A;  3M9J A;  2UZ8 A;  2GTU A;  2L4C A;  1UC7 A;  1K0D A;  4L0U A;  1V40 A;  3F9U A;  2YV9 A;  2V6O A;  3GX8 A;  4XS4 A;  4L0W A;  1FHE A;  3IHG A;  3IR4 A;  3UBL A;  1S3R A;  3J7Y k;  1FB6 A;  1GSD A;  3IK9 A;  4OO5 A;  5D8I A;  3Q8D A;  3RPN A;  3GX0 A;  3FBV A;  3GH6 A;  1ON4 A;  1YEP A;  3P8W A;  2C4J A;  3PIN A;  1X9W B;  5C04 A;  2YN1 A;  1YO7 A;  4HUA A;  3RHC A;  4ZXG A;  2LQO A;  4J2F A;  4ZIJ A;  2R0P A;  1HYU A;  3CYN A;  4EDZ A;  5IOW A;  2WJU A;  3LXZ A;  5H5R A;  3D6I A;  1U88 A;  2RM6 A;  2R37 A;  5A5K A;  2CX3 A;  1B9X C;  4G0L A;  3DGQ A;  3NOF A;  3F6F A;  2QA2 A;  3F3R A;  4K8M A;  1MD4 A;  1ZGN A;  2HRA A;  4KCA A;  1XWK A;  3BCK A;  3ZML A;  2TRC P;  2HT9 A;  2XPD A;  3HVN A;  2H8L A;  4IN0 A;  3ISO A;  1EWX A;  4RQR A;  4PNG A;  2M80 A;  5LD0 A;  3LXT A;  1PL1 A;  3IE3 A;  1GUL A;  4MZC A;  1SD9 A;  3VWU A;  3HVV A;  4MH3 A;  2FUG 1;  2G0F A;  1GLQ A;  1OC9 B;  1T4Y A;  1GH2 A;  1PA3 A;  4TR4 A;  1JZO A;  4O5U A;  2YZH A;  3P23 A;  1ZCP A;  2E8G A;  1F37 A;  1TP9 A;  3FHK A;  3QD9 A;  5IMZ A;  1FVJ A;  1SK2 A;  4PUA A;  1TOF A;  4Z7G A;  1S3C A;  4I6X A;  3ERF A;  1GUK A;  4EO3 A;  2FLS A;  5EPF A;  4AJ6 A;  2JSZ A;  2IMF A;  2DSA A;  1K0N A;  3VA9 A;  1B48 A;  1S3D A;  3LSZ A;  3VI5 A;  3EUR A;  2PMT A;  1TU7 A;  3MNG A;  4X1U A;  2GZP A;  4XRD A;  2VLU A;  4ECI A;  3MDK A;  2X8G A;  3O3T A;  5AIX A;  5IPG A;  3UIW A;  2GLR A;  1R4W A;  1X9M B;  1V57 A;  4Q9V A;  1Z6M A;  3LW9 A;  4L5O A;  2X4A A;  1M2B A;  6GSX A;  1KEB A;  1UN2 A;  4ZB8 A;  2QKE A;  2PPT A;  1JQO A;  2XTR A;  3R2Q A;  5ID2 B;  2DIZ A;  4LL1 B;  2NDO A;  4PXO A;  2IPA A;  2O89 A;  5HR0 A;  1ACV A;  4MH2 A;  5ECN B;  3E9J B;  3GN3 A;  1SJZ A;  1PD2 1;  4HZ2 A;  3TKQ A;  1QFN A;  22GS A;  4PGT A;  4TXO A;  4A5P A;  2I81 A;  1XWG A;  4USS A;  3FRC A;  5CO3 A;  4O1P A;  2RLI A;  3FMW A;  3GKN A;  2O8V B;  3GTU A;  4EL1 A;  1NSW A;  1PN9 A;  1MDJ A;  3IA1 A;  3WGD A;  2C3Q A;  2IME A;  5B8A A;  4N0Z A;  2GSC A;  5FHI A;  1AC1 A;  3C8E A;  1YDK A;  2P0G A;  2OJL A;  4GXT A;  1Z7P A;  1JLW A;  3KD0 A;  4KAE A;  3E3E A;  2V6E A;  4N10 A;  5KEJ A;  2E2M A;  3FR3 A;  4MPF A;  1R5A A;  3LJR A;  4AJ8 A;  4ACS A;  4J56 E;  3IBH A;  3QFA C;  5EL8 A;  4MK3 A;  4D73 A;  3GKK A;  2F6M B;  5J9B A;  5CRH A;  1S3A A;  2D2Z A;  1T8E B;  4IW9 A;  3F4R A;  2XTQ A;  3DVW A;  2JL4 A;  1Q98 A;  2CAQ A;  2C3T A;  3FY7 A;  3JCM L;  2FY6 A;  1GNW A;  3DWV A;  4I1T A;  2DC5 A;  4MPG A;  2YWN A;  1JHB A;  2H6Z A;  5EVO A;  3QAW A;  5DBQ A;  2YJ7 A;  2NVL A;  4JR4 A;  2ZUP A;  3LOR A;  1EV4 A;  5DCG A;  2OE1 A;  1GLP A;  4TR1 B;  4DSQ A;  1M3J A;  2FWF A;  4GST A;  1K3Y A;  4JBB A;  2AJQ B;  1VF3 A;  2DBC A;  2GZY A;  3HD5 A;  4ML6 A;  2HZE B;  2VIM A;  3DML A;  3GIX A;  2JAC A;  4YZC A;  1W4V A;  4NWY A;  5B6M A;  1GP1 A;  1EEM A;  5ECP B;  2IFQ B;  3DA4 A;  3FYG A;  3ZVJ A;  3QR6 A;  3RBT A;  2RM5 A;  1FOH A;  5D73 A;  5A4U A;  2HSM A;  3HA9 A;  4JE1 A;  1FO5 A;  3ZFB A;  2GST A;  5IOX A;  1M2A A;  2GSS A;  3CBU A;  5DQS A;  5AIS A;  1BED A;  4DVC A;  1AIU A;  3ZRD A;  1KBN A;  1OE7 A;  4X0X A;  5IQY A;  3N9J A;  2V6K A;  1USB A;  1A23 A;  1PX7 A;  2VLV A;  2HXK A;  1SKS B;  2V32 A;  4Z7H A;  5ECK B;  2QGM A;  2O7K A;  3TKP A;  2NTO A;  1YQ1 A;  3HCZ A;  2RUF A;  2JZS A;  4IS0 A;  4PL3 A;  3DO9 A;  2VCX A;  2P22 B;  2VCW A;  3EVI A;  1OE8 A;  2BL7 A;  3KH7 A;  3A2W A;  5CRE A;  1EP7 A;  2HSH A;  3GRX A;  2H66 A;  2HZE A;  4YQM A;  1NW2 A;  3RHB A;  4K0N A;  1E2Y A;  4PUR A;  1ZZY A;  4FYB A;  1DE2 A;  1V58 A;  2OA7 A;  2YP6 A;  1XWA A;  2LQQ A;  4HJ2 A;  2GQM A;  4K7N A;  4BPY A;  2FHE A;  2WCI A;  3EE2 A;  3BD2 A;  2FD3 A;  3LG6 A;  3EC3 A;  2MJF B;  1BX9 A;  1OKD A;  4FQU A;  2PVO C;  2F66 B;  5C00 A;  1G7O A;  1FW1 A;  4IJI A;  3GSS A;  4LMW A;  4LL4 B;  4WKW A;  2H6Y A;  1G6Y A;  2V41 A;  1O8W A;  4JED A;  4MZW A;  1YJ6 A;  1XZO A;  4V2M A;  3GYK A;  4MJA A;  4XHM A;  1XIY A;  2GQL A;  1YKC A;  2A4H A;  3B55 A;  2H1D A;  4MCU A;  3WGX A;  1X0R A;  1XWB A;  4I2U A;  3MYD A;  1PKW A;  4OFT A;  3D4M A;  3C7M A;  4DWL A;  1GNE A;  1PN0 A;  5ELA A;  3I69 A;  2DIY A;  3IAM 1;  4LA1 A;  1K3L A;  16GS A;  2KOK A;  1ZYN A;  4K1F A;  4RI6 A;  2IMK A;  1XWC A;  2LS5 A;  4KDU A;  3L9V A;  4XS6 A;  4JRR A;  1GWC A;  3TKR A;  3F63 A;  3QDN A;  4G76 A;  4AF2 A;  4TW5 A;  4CHS A;  1YF1 A;  3NIV A;  1B8X A;  3GHA A;  4WF4 A;  3KM6 A;  4YKF A;  1F2E A;  3HVX A;  4XTS A;  3PPU A;  4O1O A;  2K8V A;  3F8U A;  2CQ9 A;  2OE0 A;  2BJX A;  2DJ0 A;  4WR4 A;  1GTB A;  1O81 A;  4GSN A;  1AAZ A;  3QOU A;  2XBQ A;  3APO A;  4KH7 A;  3GV1 A;  1BQ7 A;  5F07 A;  4G75 A;  2H76 A;  3ZIV A;  3KTB A;  4EKZ A;  4EF0 A;  3SDJ A;  4MJB A;  4KW6 A;  1TJD A;  4KND A;  5IMV A;  2LTK A;  1ML6 A;  3M0F A;  5F06 A;  1TKD B;  4TR3 A;  1U6T A;  3M9K A;  4HFV A;  3DKS A;  8GSS A;  4NHZ A;  3GKX A;  4DSS A;  2JZR A;  2C80 A;  1OVN A;  2R0G A;  3L9U A;  4G2E A;  1SL2 B;  3UJ1 A;  4HU9 A;  1Z5Y E;  1VF4 A;  4XRA A;  1Z3E A;  3TKS A;  2QSB A;  4V2L A;  4G0K A;  2RAD A;  2DMM A;  3ZFL A;  2DJJ A;  3H79 A;  4K7O A;  4HEA 2;  2HYX A;  2KUC A;  2H72 A;  1SK1 A;  3H1N A;  1XBS A;  2H6X A;  2OBK A;  1FOV A;  2HRN A;  5JWO B;  2FWH A;  3G7J A;  1BAY A;  2L6C A;  3LJ2 A;  3KIJ A;  2MMO A;  1TI1 A;  3CSI A;  1GSY A;  5IMA A;  1PL2 A;  2CV4 A;  2LRT A;  4HEA 1;  1VRS D;  5ECI B;  1KNG A;  1IYI A;  2KP2 A;  1QMV A;  1ERT A;  1WMJ A;  1ERW A;  1VF1 A;  1EEJ A;  4PTS A;  1G6W A;  4XCS A;  2JAE A;  1HNA A;  4HJM A;  3UBK A;  1XFL A;  3APS A;  5CAX A;  1XW6 A;  2L57 A;  4WEY A;  1NHY A;  3TRQ A;  4JR6 A;  3KTL A;  2OAC A;  1GSE A;  2LJK A;  1WJK A;  3O6T A;  5G31 A;  3FEU A;  2YV7 A;  1YKA A;  3HJO A;  2G2Q A;  1R7H A;  2H73 A;  1SKW B;  3FW2 A;  9GSS A;  10GS A;  4EIQ A;  1J08 A;  2VO4 A;  2H1G A;  1UVZ A;  5J3R A;  1DUG A;  2DJ1 A;  2H19 A;  2B1L A;  1U87 A;  5CRD A;  2P5Q A;  4ILF A;  2B7K A;  3K8N A;  1KTE A;  3VLN A;  3ZRE A;  1EP8 A;  3WD6 A;  3ME8 A;  2VCQ A;  1B4Q A;  4NHW A;  2WGR A;  3F3Q A;  3EMP A;  4XS4 B;  1N8J A;  2WB9 A;  1J0F A;  2PU9 C;  1A2L A;  2CAZ B;  1Z7R A;  6GSY A;  4OAV B;  4DSS B;  1U3A A;  2H71 A;  1QXH A;  4GQC A;  3N5O A;  2DJ3 A;  1EZK A;  1O8X A;  3D21 A;  3EIN A;  5DJM A;  1ZOF A;  5KN2 A;  2WZ9 A;  2A2R A;  4Q5F A;  2X8C A;  4J57 E;  3W8S A;  3TRP A;  3G7I A;  1K0A A;  3GFK A;  2FUG 2;  2LNT A;  2FU2 A;  4IBP A;  3FKF A;  2YNX A;  1EGR A;  1YF0 A;  2BL8 A;  2YFB A;  2C0G A;  3TOT A;  18GS A;  3KMO A;  4WBR D;  4E8E A;  3H4K A;  4FH8 A;  3LJ0 A;  3M8N A;  2VLT A;  1GSU A;  3EMX A;  5ABR A;  2E7P A;  3EPT A;  2AAW A;  1A2J A;  3KGK A;  4TR0 A;  2LJR A;  1W3S A;  5KN3 A;  2LRN A;  2JB2 A;  4TRX A;  4OCE A;  1PRX A;  1WP0 A;  1TU8 A;  5ECL B;  1W89 A;  4F82 A;  3CSJ A;  4TR1 A;  2FGX A;  4HI7 A;  5H5S A;  2LUS A;  2FA4 A;  4YQV A;  3Q19 A;  3D22 A;  3IOS A;  3CSH A;  1MTC A;  3FZ4 A;  1GUH A;  2KLX A;  3CTG A;  2LV3 A;  1B9Y C;  2CA8 A;  1RW1 A;  3IAM 2;  3WT1 A;  2BMX A;  3VPT A;  2MMZ A;  3L0I A;  4IHU A;  3ZIJ A;  2GGT A;  2VOC A;  1R5P A;  5G30 A;  4GXZ A;  5GSS A;  3LWA A;  3GST A;  4EC0 A;  5HFI A;  1U3I A;  3RPP A;  13GS A;  1SJ6 A;  4YQU A;  4I2T A;  2VD0 A;  4CY8 A;  7GSS A;  5ECM B;  3APQ A;  4TN8 A;  4F0B A;  4GCI A;  5E59 A;  3IC8 A;  4POM A;  3IXR A;  5DJL A;  2MMN A;  1K0M A;  2B5X A;  1GTA A;  4G19 A;  3F4S A;  1WIK A;  3CQF A;  4HS1 A;  5LNK e;  3F4M A;  2VCT A;  3IV4 A;  1QK8 A;  3L4N A;  2KHP A;  1YY7 A;  1XW9 A;  5D96 A;  4D73 B;  3C1S A;  2VUP A;  2X49 A;  2DJK A;  2JBW A;  2X8H A;  3P90 A;  5IMC A;  1O73 A;  1WE0 A;  4ZBA A;  3FZ9 A;  1OKT A;  2EIO A;  4O32 A;  2IN3 A;  4OWY A;  1C72 A;  4ZIL A;  1T4Z A;  5KOX A;  3UL3 A;  4K2D A;  3TKS C;  1X9S B;  1TK5 B;  2K8S A;  4I8B A;  1B4P A;  5B8B A;  2ALB A;  5INY A;  3HXS A;  2YPM A;  3WYW A;  1SU9 A;  5IMF A;  4TVE A;  2CT6 A;  1SL0 B;  2FWG A;  3V1W A;  3RAZ A;  3EWL A;  5FT3 A;  2HRF A;  2CVK A;  5ID2 A;  1O6J A;  5F0G A;  3LEF A; 
#chains in the Genus database with same CATH homology
 3FZA A;  4MMM A;  4V1A p;  3I9V 2;  1A8L A;  3P2A A;  2F8F A;  2P31 A;  2R5G A;  3A2X A;  1TRW A;  3VFI A;  1WWJ A;  1CQH A;  5HGI A;  3BOA A;  1JZD A;  2LKU A;  3TDG A;  2J9H A;  3ZTL A;  5D9V A;  2HI7 A;  6GSS A;  4KCE A;  1H4O A;  4HZ4 A;  5HR1 A;  1GSF A;  4ECB A;  4POB A;  3W6G A;  4PX1 A;  1T00 A;  4PL5 A;  2IL3 A;  2RUE A;  2PGT A;  3VWX A;  2VD1 A;  1AQW A;  4Z2R A;  3P7X A;  3GUS A;  2H1A A;  1LBK A;  1SKR B;  1K0B A;  5HFG A;  1SYR A;  3C73 A;  2K6V A;  1GUM A;  17GS A;  2FCH A;  4N0V A;  2I9H A;  3M3M A;  4AGS A;  3E0U A;  4V1A g;  2XMX A;  1RQM A;  4Q5Q A;  4AJ7 A;  4KE3 A;  4WET A;  3A5I A;  2WFC A;  3HZ4 A;  2REM A;  3PR8 A;  4ZB6 A;  2WS2 A;  4H86 A;  1VGL A;  4KA0 A;  4TXV A;  6GSU A;  4HDE A;  2P5R A;  1MDI A;  4PQ1 A;  5DQY A;  1XVW A;  2HE3 A;  1PGT A;  1M7T A;  1XPV A;  3UVT A;  3BBY A;  2PBJ A;  3GL5 A;  3FK8 A;  4POL A;  2XBI A;  1ERU A;  1LU4 A;  4KSO A;  2EIQ A;  3J7Y b;  2VL2 C;  3UEM A;  5COH A;  5J4U A;  5JWR B;  2WUL A;  3DVX A;  2XHF A;  3LGC A;  2AHE A;  4KUN A;  2B5Y A;  1XW5 A;  2HZF A;  2HLS A;  5LCZ A;  2JZT A;  3QAG A;  2A2P A;  2FNO A;  3HKR A;  2GVP A;  4O5Q A;  2F51 A;  1T3B A;  1ZYP A;  3ZL5 A;  3TJF A;  1DBY A;  4K5R A;  2HFD A;  1HNC A;  4EVM A;  4ZL9 A;  3HHV A;  5ECR B;  4V2N A;  2XC2 A;  2H70 A;  4BVY B;  2IFQ A;  4K5S A;  5AIV A;  4I97 A;  2YWM A;  5JCU A;  4BVX B;  4TKY A;  4E8H A;  3VWW A;  4ZBB A;  2YJH A;  3H8Q A;  2L59 A;  1SK0 A;  5IMD A;  2QA1 A;  2FA8 A;  3DRN A;  3CTF A;  2A4V A;  3G7Y A;  1WPI A;  2MZC A;  4L5L A;  3GUR A;  5L71 A;  4O5R A;  2HRK A;  2VAF A;  1HD2 A;  4PUF C;  4OMV A;  4PQI A;  3WT2 A;  1YZX A;  4O92 A;  5D9W A;  3IDV A;  2V1C C;  1CQG A;  2O85 A;  2K19 A;  1XOA A;  4CY6 A;  5CNW A;  1NHO A;  5FWG A;  3CRU A;  4N11 A;  1V2A A;  2YAN A;  2AUV A;  3UAR A;  2QGV A;  2DKH A;  5JCW A;  4YKG A;  2YFA A;  1M9B A;  3DIE A;  3TB2 A;  1OC8 A;  3Q18 A;  4O7H A;  3ERW A;  4TOP A;  3EYT A;  3MAK A;  3ZZX A;  3TJB A;  3UOM A;  2GDR A;  1OC3 A;  5ECH B;  2MBT A;  5GAN D;  5HFK A;  1O7U A;  1R26 A;  1EGO A;  2LNS A;  4HU7 A;  5G1L A;  1TTZ A;  4GQF A;  3UIT A;  1GSQ A;  2V1M A;  3ZIT A;  4K0G A;  5A4W A;  2XPE A;  3FR6 A;  3ED3 A;  2R4V A;  2OBI A;  3TJK A;  3Q6O A;  2VCZ A;  2PUK C;  1SD8 A;  4G9H A;  4KF9 A;  5ELG A;  3GKM A;  2L1L B;  1TI3 A;  2CZ2 A;  20GS A;  3GH9 A;  1F6M C;  4MF6 A;  2ZCT A;  4MF7 A;  1F3B A;  1JZW A;  5B7C A;  2VM1 A;  4MJC A;  2F8A A;  1AQV A;  1MD3 A;  4KB3 A;  3WGE A;  2LEG A;  4MJE A;  2F9S A;  4PQH A;  4QQ7 A;  1V9W A;  2H01 A;  2K9F A;  3F0I A;  4MA9 A;  2LRC A;  2N5F A;  3QFB C;  1Y6E A;  3QAV A;  3LYP A;  2Z9S A;  2X99 A;  2CZ3 A;  1GL8 A;  4MZB A;  3GMF A;  4AS3 A;  3IRA A;  3IAS 2;  3H93 A;  3GTU B;  1I9D A;  3TUE A;  4FIW A;  3HZ8 A;  5G2Z A;  1AW9 A;  2B1K A;  2H74 A;  2A2D A;  4ULX A;  4DEJ A;  4K9Z A;  1U5K A;  2JB1 A;  2CVD A;  3AJF A;  1BG5 A;  1F9M A;  4ECJ A;  4YZ9 A;  2VM2 A;  1K0C A;  4IQA A;  3KEB A;  3PH9 A;  2HNL A;  3R3E A;  2NBS A;  5IPH A;  2CVB A;  5J41 A;  3LJ1 A;  2OE3 A;  4EXJ A;  4F9Z A;  3DXB A;  5HQP A;  2A2C A;  1EOG A;  2J23 A;  1GTU A;  3TJJ A;  5DAK B;  1TDI A;  5KN0 A;  5G5F A;  3KZQ A;  4KDY A;  2B5E A;  3KP9 A;  1MDK A;  4MP4 A;  2C0D A;  2DJ2 A;  1ILO A;  5G1K A;  2BTO T;  2JSY A;  1A24 A;  1AQX A;  1Q4J A;  4TXO B;  1BYE A;  2E0Q A;  3BCI A;  4HOJ A;  1M2D A;  3SBC A;  2YOI A;  3G9B A;  4FYC A;  4IGJ A;  1TK8 B;  6GSV A;  2I1U A;  5DAK A;  1ST9 A;  2LST A;  4ZL8 A;  3S9F A;  5KN1 A;  3IC4 A;  3QCP A;  4BWQ A;  3RDW A;  3HJM A;  4IP6 A;  3KMN A;  5H5Q A;  1TRU A;  2GQK A;  1GSS A;  5G5E A;  1F3A A;  2ON7 A;  5ECQ B;  2H0I A;  1FVK A;  3HYP A;  1M99 A;  3UAP A;  2AB6 A;  1SYX A;  3L0H A;  4NAX A;  1QUW A;  3FZ5 A;  1THO A;  2H0H A;  5KOW A;  6GSW A;  5BMU A;  5E4W A;  5ECS A;  2B3S A;  2ON5 A;  5D93 A;  4KDX A;  4POK A;  2QC7 A;  3CXG A;  3F4T A;  3VUR A;  3QPM A;  4ZL7 A;  4ZB9 A;  1PSQ A;  2R6K A;  3SWL A;  3TGZ A;  2VL9 A;  2DML A;  2TIR A;  3LYK A;  1PQN A;  4JCV E;  3TKS E;  3KCM A;  4MF5 A;  1AXD A;  3DYR A;  2I4A A;  12GS A;  5LNK 1;  1MEK A;  3A2V A;  2YCD A;  2TRX A;  2GZZ A;  4YH2 A;  2NPB A;  2L5L A;  11GS A;  3IAS 1;  3W8J A;  4IQ1 A;  1NM3 A;  4AS2 A;  3IPZ A;  1ZMA A;  3DEX A;  2DLX A;  3I43 A;  2O87 A;  4MAB A;  2IP6 A;  5IO2 A;  2M72 A;  3HY2 A;  4EIP A;  2VL2 A;  2IIY A;  4GLT A;  3KXO A;  3UVH A;  14GS A;  5A4V A;  2N5A A;  2C8U A;  3DD3 A;  2I3Y A;  1X5E A;  4F03 A;  1PMT A;  1N2A A;  3LQ7 A;  2B6M A;  2KKM A;  1BJX A;  2R0C A;  2KP1 A;  1YEX A;  1FG4 A;  3GNJ A;  4WBJ A;  4IJ3 A;  4G10 A;  4RQX A;  1V98 A;  1QGV A;  4ID0 A;  2K18 A;  2PVQ A;  1SL1 B;  5JWQ B;  1HNB A;  4YAV A;  3IHQ A;  5CP1 A;  3JSB A;  4N30 A;  1M9A A;  3VK9 A;  3BJ5 A;  4IP1 A;  4K7I A;  5D9T A;  2ZNM A;  1H75 A;  5F05 A;  1EOH A;  4QL7 A;  4EE0 A;  2GS3 A;  4OAU C;  5ECO B;  3NZN A;  4IVF A;  2IWT A;  2H30 A;  4RUV A;  4BL7 A;  2MMA A;  2HSY A;  3VWV A;  4X4J A;  5DAL B;  1LJR A;  3A5W A;  2C3N A;  3CMI A;  4U6R A;  2GT6 A;  4I5Q A;  4XS1 A;  4MDC A;  4Z2U A;  2MYG A;  3CRT A;  1URM A;  1PKZ A;  4FO5 A;  4KGI A;  4RI7 A;  2F3M A;  4BWS A;  3MIX A;  3HDC A;  3EU3 A;  3HJP A;  1AUC A;  4GTU A;  4IEL A;  2JU5 A;  1G0T A;  4PNF A;  3TJG A;  2VL3 A;  4LLR A;  3VI7 A;  1XOB A;  4GF0 A;  2ES7 A;  3I6A A;  3UMA A;  2PWJ A;  1T7P B;  1OC9 A;  3ZMK A;  5GAP D;  4NV5 A;  1TXX A;  3KJY A;  2QSI A;  3HVS A;  1ABA A;  4FYU A;  2X64 A;  1SJI A;  2IJY A;  1OYJ A;  2EC4 A;  3TOU A;  1TRS A;  4BVX A;  4P3Y B;  4ZBD A;  2DKI A;  3ME7 A;  4JU5 A;  3MWH A;  4KSM A;  3F6D A;  1WRY A;  5AGY A;  2RII A;  1DE1 A;  3VPQ A;  1TK0 B;  1GRX A;  4GRF A;  2WDU A;  4LMV A;  4OD7 A;  5EY6 A;  4NPB A;  4WR5 A;  3IK7 A;  3ZYW A;  3D0Z A;  2GSQ A;  2JB3 A;  2FWE A;  4Q5R A;  4NXI A;  4GWR A;  5DDL A;  1SEN A;  1RK4 A;  2PER A;  4ECC A;  2A2S A;  2MBS A;  3M1G A;  2L6D A;  3AY8 A;  5GST A;  3MSZ A;  1JZR A;  3QMX A;  3PGT A;  3C1R A;  4F2I A;  4MLY A;  4CDO A;  5JCG A;  1JFU A;  2AYT A;  1XXU A;  2V2G A;  2OKA A;  4BA7 A;  2IMD A;  4ISD A;  4EDY A;  1K0O A;  4PL4 A;  3Q74 A;  1TW9 A;  2ZRR A;  4K2X A;  1G7E A;  4GSS A;  2EIR A;  3L9S A;  2LJA A;  2GSR A;  4XIH A;  1A0R P;  4Z7X A;  1E6B A;  1Z6N A;  4G0I A;  3U5R E;  5DAL A;  5IIZ A;  3I9V 1;  1I5G A;  3ERG A;  4NMU A;  2RIO A;  4QL9 A;  19GS A;  3GL3 A;  4DSR A;  1FAA A;  3A3T A;  1HQO A;  1ZYQ B;  2R2J A;  4Q5N A;  3D4T A;  1Y25 A;  2N5B A;  4MNN A;  3TCO A;  1A2M A;  5HR2 A;  1FB0 A;  2M46 A;  3U6V A;  5J9C A;  1OAZ A;  5F8B A;  4L8E A;  5IM9 A;  1ERV A;  1ZL9 A;  4K6X A;  1WOU A;  5IO0 A;  5DVB A;  1UA5 A;  3O76 A;  2OAD A;  4F0C A;  5D9X A;  4EUY A;  2L5O A;  1X5C A;  1A0F A;  2PN8 A;  2YZU A;  2JAD A;  3EU4 A;  2AV4 A;  4IKH A;  1M0U A;  3US3 A;  3FR9 A;  5DCH A;  1J9B A;  1TRV A;  2VCV A;  1XVQ A;  4YAP A;  4JZQ A;  2C0F A;  2E2G A;  1IYH A;  4OO4 A;  2GT5 A;  1A8Y A;  3LFL A;  1EV9 A;  1VF2 A;  4ICY A;  1Z9H A;  4YZD A;  5BRT A;  4CW9 A;  3ZVJ D;  1XCC A;  5CRW A;  2C1Y A;  2CX4 A;  5ENU A;  4BL7 B;  5GZZ B;  4OFN A;  4Z2T A;  5AN1 A;  5J5N A;  2L4Q A;  3KH9 A;  1THX A;  1GTI A;  3OR5 A;  2C0E A;  4OFM A;  5B6N A;  4WXT A;  1T1V A;  3KP8 A;  1JLV A;  2YWI A;  2H0G A;  3GA4 A;  1K3O A;  4HQZ A;  4KX4 A;  5HR3 A;  1DSB A;  4HQS A;  1X5D A;  1PX6 A;  3C71 A;  4X43 A;  2IMI A;  5CYY A;  2CAI A;  3TRX A;  3L78 A;  4WF5 A;  1ZYE A;  1QQ2 A;  4NV2 A;  1O85 A;  4OCF A;  2H75 A;  1SJ8 A;  3DA3 A;  2WRT A;  6GST A;  3ZLP A;  5CRG A;  2H1B A;  4BVY A;  2YWO A;  2B7J A;  3D5J A;  4ML1 A;  2R3X A;  3M9J A;  2UZ8 A;  2GTU A;  2L4C A;  1UC7 A;  1K0D A;  4L0U A;  1V40 A;  3F9U A;  2YV9 A;  2V6O A;  3GX8 A;  4XS4 A;  4L0W A;  1FHE A;  3IHG A;  3IR4 A;  3UBL A;  3J7Y k;  1FB6 A;  1GSD A;  3IK9 A;  4OO5 A;  5D8I A;  3Q8D A;  3RPN A;  3GX0 A;  3FBV A;  3GH6 A;  1ON4 A;  1YEP A;  3P8W A;  2C4J A;  3PIN A;  1X9W B;  5C04 A;  2YN1 A;  1YO7 A;  4HUA A;  3RHC A;  4ZXG A;  2LQO A;  4J2F A;  4ZIJ A;  2R0P A;  1HYU A;  3CYN A;  4EDZ A;  5IOW A;  2WJU A;  3LXZ A;  5H5R A;  3D6I A;  1U88 A;  2RM6 A;  2R37 A;  5A5K A;  2CX3 A;  1B9X C;  4G0L A;  3DGQ A;  3NOF A;  3F6F A;  2QA2 A;  3F3R A;  4K8M A;  1MD4 A;  1ZGN A;  2HRA A;  4KCA A;  1XWK A;  3BCK A;  3ZML A;  2TRC P;  2HT9 A;  2XPD A;  2H8L A;  4IN0 A;  3ISO A;  1EWX A;  4RQR A;  4PNG A;  2M80 A;  5LD0 A;  3LXT A;  1PL1 A;  3IE3 A;  1GUL A;  4MZC A;  1SD9 A;  3VWU A;  3HVV A;  4MH3 A;  2FUG 1;  2G0F A;  1GLQ A;  1OC9 B;  1T4Y A;  1GH2 A;  1PA3 A;  4TR4 A;  1JZO A;  4O5U A;  2YZH A;  3P23 A;  1ZCP A;  2E8G A;  1F37 A;  1TP9 A;  3FHK A;  3QD9 A;  5IMZ A;  1FVJ A;  1SK2 A;  4PUA A;  1TOF A;  4Z7G A;  1S3C A;  4I6X A;  3ERF A;  1GUK A;  4EO3 A;  2FLS A;  5EPF A;  4AJ6 A;  2JSZ A;  2IMF A;  2DSA A;  1K0N A;  3VA9 A;  1B48 A;  1S3D A;  3LSZ A;  3VI5 A;  3EUR A;  2PMT A;  1TU7 A;  3MNG A;  4X1U A;  2GZP A;  4XRD A;  2VLU A;  4ECI A;  3MDK A;  2X8G A;  3O3T A;  5AIX A;  5IPG A;  3UIW A;  2GLR A;  1R4W A;  1X9M B;  1V57 A;  4Q9V A;  1Z6M A;  3LW9 A;  4L5O A;  2X4A A;  1M2B A;  6GSX A;  1KEB A;  1UN2 A;  4ZB8 A;  2QKE A;  2PPT A;  2XTR A;  3R2Q A;  5ID2 B;  2DIZ A;  4LL1 B;  2NDO A;  4PXO A;  2IPA A;  2O89 A;  5HR0 A;  1ACV A;  4MH2 A;  5ECN B;  3E9J B;  3GN3 A;  1SJZ A;  1PD2 1;  4HZ2 A;  3TKQ A;  1QFN A;  22GS A;  4PGT A;  4TXO A;  4A5P A;  2I81 A;  1XWG A;  4USS A;  3FRC A;  5CO3 A;  4O1P A;  2RLI A;  3FMW A;  3GKN A;  2O8V B;  3GTU A;  4EL1 A;  1NSW A;  1PN9 A;  1MDJ A;  3IA1 A;  3WGD A;  2C3Q A;  2IME A;  5B8A A;  4N0Z A;  5FHI A;  1AC1 A;  3C8E A;  1YDK A;  2P0G A;  2OJL A;  4GXT A;  1Z7P A;  1JLW A;  3KD0 A;  4KAE A;  3E3E A;  2V6E A;  4N10 A;  5KEJ A;  2E2M A;  3FR3 A;  4MPF A;  1R5A A;  3LJR A;  4AJ8 A;  4ACS A;  4J56 E;  3IBH A;  3QFA C;  5EL8 A;  4MK3 A;  4D73 A;  3GKK A;  2F6M B;  5J9B A;  5CRH A;  1S3A A;  2D2Z A;  1T8E B;  4IW9 A;  3F4R A;  2XTQ A;  3DVW A;  2JL4 A;  1Q98 A;  2CAQ A;  2C3T A;  3FY7 A;  3JCM L;  2FY6 A;  1GNW A;  3DWV A;  4I1T A;  2DC5 A;  2YWN A;  4MPG A;  1JHB A;  2H6Z A;  5EVO A;  3QAW A;  5DBQ A;  2YJ7 A;  2NVL A;  4JR4 A;  2ZUP A;  3LOR A;  1EV4 A;  5DCG A;  2OE1 A;  1GLP A;  4TR1 B;  4DSQ A;  2FWF A;  4GST A;  1K3Y A;  4JBB A;  2AJQ B;  1VF3 A;  2DBC A;  2GZY A;  3HD5 A;  4ML6 A;  2HZE B;  2VIM A;  3DML A;  3GIX A;  2JAC A;  4YZC A;  1W4V A;  4NWY A;  5B6M A;  1GP1 A;  1EEM A;  5ECP B;  2IFQ B;  3DA4 A;  3FYG A;  3ZVJ A;  3QR6 A;  3RBT A;  2RM5 A;  1FOH A;  5D73 A;  5A4U A;  2HSM A;  3HA9 A;  4JE1 A;  1FO5 A;  3ZFB A;  2GST A;  5IOX A;  1M2A A;  2GSS A;  3CBU A;  5DQS A;  5AIS A;  1BED A;  4DVC A;  1AIU A;  3ZRD A;  1KBN A;  1OE7 A;  4X0X A;  5IQY A;  3N9J A;  2V6K A;  1USB A;  1A23 A;  1PX7 A;  2VLV A;  2HXK A;  1SKS B;  2V32 A;  4Z7H A;  5ECK B;  2O7K A;  3TKP A;  2NTO A;  1YQ1 A;  3HCZ A;  2RUF A;  2JZS A;  4IS0 A;  4PL3 A;  3DO9 A;  2VCX A;  2P22 B;  2VCW A;  3EVI A;  1OE8 A;  3KH7 A;  3A2W A;  5CRE A;  1EP7 A;  2HSH A;  3GRX A;  2H66 A;  2HZE A;  4YQM A;  1NW2 A;  3RHB A;  4K0N A;  1E2Y A;  4PUR A;  1ZZY A;  4FYB A;  1DE2 A;  1V58 A;  2OA7 A;  2YP6 A;  1XWA A;  2LQQ A;  4HJ2 A;  2GQM A;  4K7N A;  4BPY A;  2FHE A;  2WCI A;  3EE2 A;  3BD2 A;  2FD3 A;  3LG6 A;  3EC3 A;  2MJF B;  1BX9 A;  1OKD A;  4FQU A;  2PVO C;  2F66 B;  5C00 A;  1G7O A;  1FW1 A;  4IJI A;  3GSS A;  4LMW A;  4LL4 B;  4WKW A;  2H6Y A;  1G6Y A;  2V41 A;  1O8W A;  4JED A;  4MZW A;  1YJ6 A;  1XZO A;  4V2M A;  3GYK A;  4MJA A;  4XHM A;  1XIY A;  2GQL A;  1YKC A;  2A4H A;  2H1D A;  4MCU A;  3WGX A;  1X0R A;  1XWB A;  4I2U A;  3MYD A;  1PKW A;  4OFT A;  3D4M A;  3C7M A;  4DWL A;  1GNE A;  1PN0 A;  5ELA A;  3I69 A;  2DIY A;  3IAM 1;  4LA1 A;  1K3L A;  16GS A;  2KOK A;  1ZYN A;  4K1F A;  4RI6 A;  2IMK A;  1XWC A;  2LS5 A;  4KDU A;  3L9V A;  4XS6 A;  4JRR A;  1GWC A;  3TKR A;  3F63 A;  3QDN A;  4G76 A;  4AF2 A;  4TW5 A;  4CHS A;  1YF1 A;  3NIV A;  1B8X A;  3GHA A;  4WF4 A;  3KM6 A;  4YKF A;  1F2E A;  3HVX A;  4XTS A;  3PPU A;  4O1O A;  2K8V A;  3F8U A;  2CQ9 A;  2OE0 A;  2BJX A;  2DJ0 A;  4WR4 A;  1GTB A;  1O81 A;  4GSN A;  1AAZ A;  3QOU A;  2XBQ A;  3APO A;  4KH7 A;  3GV1 A;  1BQ7 A;  5F07 A;  4G75 A;  2H76 A;  3ZIV A;  3KTB A;  4EKZ A;  4EF0 A;  3SDJ A;  4MJB A;  4KW6 A;  1TJD A;  4KND A;  5IMV A;  2LTK A;  1ML6 A;  3M0F A;  5F06 A;  1TKD B;  4TR3 A;  1U6T A;  3M9K A;  4HFV A;  3DKS A;  8GSS A;  4NHZ A;  3GKX A;  4DSS A;  2JZR A;  2C80 A;  1OVN A;  2R0G A;  3L9U A;  4G2E A;  1SL2 B;  3UJ1 A;  4HU9 A;  1Z5Y E;  1VF4 A;  4XRA A;  1Z3E A;  3TKS A;  4V2L A;  4G0K A;  2DMM A;  3ZFL A;  2DJJ A;  3H79 A;  4K7O A;  4HEA 2;  2HYX A;  2KUC A;  2H72 A;  1SK1 A;  3H1N A;  1XBS A;  2H6X A;  2OBK A;  1FOV A;  2HRN A;  5JWO B;  2FWH A;  3G7J A;  1BAY A;  2L6C A;  3LJ2 A;  3KIJ A;  2MMO A;  1TI1 A;  3CSI A;  1GSY A;  5IMA A;  1PL2 A;  2CV4 A;  2LRT A;  4HEA 1;  1VRS D;  5ECI B;  1KNG A;  1IYI A;  2KP2 A;  1QMV A;  1ERT A;  1WMJ A;  1ERW A;  1VF1 A;  1EEJ A;  4PTS A;  1G6W A;  4XCS A;  2JAE A;  1HNA A;  4HJM A;  3UBK A;  1XFL A;  3APS A;  5CAX A;  1XW6 A;  2L57 A;  4WEY A;  1NHY A;  3TRQ A;  4JR6 A;  3KTL A;  2OAC A;  1GSE A;  2LJK A;  1WJK A;  3O6T A;  5G31 A;  3FEU A;  2YV7 A;  1YKA A;  3HJO A;  2G2Q A;  1R7H A;  2H73 A;  1SKW B;  3FW2 A;  9GSS A;  10GS A;  4EIQ A;  1J08 A;  2VO4 A;  2H1G A;  1UVZ A;  5J3R A;  1DUG A;  2DJ1 A;  2H19 A;  2B1L A;  1U87 A;  5CRD A;  2P5Q A;  4ILF A;  2B7K A;  3K8N A;  1KTE A;  3VLN A;  3ZRE A;  1EP8 A;  3WD6 A;  3ME8 A;  2VCQ A;  1B4Q A;  4NHW A;  2WGR A;  3F3Q A;  3EMP A;  4XS4 B;  1N8J A;  2WB9 A;  1J0F A;  2PU9 C;  1A2L A;  2CAZ B;  1Z7R A;  6GSY A;  4OAV B;  4DSS B;  1U3A A;  2H71 A;  1QXH A;  4GQC A;  3N5O A;  2DJ3 A;  1EZK A;  1O8X A;  3D21 A;  3EIN A;  5DJM A;  1ZOF A;  5KN2 A;  2WZ9 A;  2A2R A;  4Q5F A;  2X8C A;  4J57 E;  3W8S A;  3TRP A;  3G7I A;  1K0A A;  3GFK A;  2FUG 2;  2LNT A;  4IBP A;  3FKF A;  2YNX A;  1EGR A;  1YF0 A;  2YFB A;  2C0G A;  3TOT A;  18GS A;  3KMO A;  4WBR D;  4E8E A;  3H4K A;  4FH8 A;  3LJ0 A;  3M8N A;  2VLT A;  1GSU A;  3EMX A;  5ABR A;  2E7P A;  3EPT A;  2AAW A;  1A2J A;  3KGK A;  4TR0 A;  2LJR A;  1W3S A;  5KN3 A;  2LRN A;  2JB2 A;  4TRX A;  4OCE A;  1PRX A;  1WP0 A;  1TU8 A;  5ECL B;  1W89 A;  4F82 A;  3CSJ A;  4TR1 A;  2FGX A;  4HI7 A;  5H5S A;  2LUS A;  2FA4 A;  4YQV A;  3Q19 A;  3D22 A;  3IOS A;  3CSH A;  1MTC A;  3FZ4 A;  1GUH A;  2KLX A;  3CTG A;  2LV3 A;  1B9Y C;  2CA8 A;  1RW1 A;  3IAM 2;  3WT1 A;  2BMX A;  3VPT A;  2MMZ A;  3L0I A;  4IHU A;  3ZIJ A;  2GGT A;  2VOC A;  1R5P A;  5G30 A;  4GXZ A;  5GSS A;  3LWA A;  3GST A;  4EC0 A;  5HFI A;  1U3I A;  3RPP A;  13GS A;  1SJ6 A;  4YQU A;  4I2T A;  2VD0 A;  4CY8 A;  7GSS A;  5ECM B;  3APQ A;  4TN8 A;  4F0B A;  4GCI A;  5E59 A;  3IC8 A;  4POM A;  3IXR A;  5DJL A;  2MMN A;  1K0M A;  2B5X A;  1GTA A;  4G19 A;  3F4S A;  1WIK A;  4HS1 A;  5LNK e;  3F4M A;  2VCT A;  3IV4 A;  1QK8 A;  3L4N A;  2KHP A;  1YY7 A;  1XW9 A;  5D96 A;  4D73 B;  3C1S A;  2VUP A;  2X49 A;  2DJK A;  2X8H A;  3P90 A;  5IMC A;  1O73 A;  1WE0 A;  4ZBA A;  3FZ9 A;  1OKT A;  2EIO A;  4O32 A;  2IN3 A;  4OWY A;  1C72 A;  4ZIL A;  1T4Z A;  5KOX A;  3UL3 A;  4K2D A;  3TKS C;  1X9S B;  1TK5 B;  2K8S A;  4I8B A;  1B4P A;  5B8B A;  2ALB A;  5INY A;  3HXS A;  2YPM A;  3WYW A;  1SU9 A;  5IMF A;  4TVE A;  2CT6 A;  1SL0 B;  2FWG A;  3V1W A;  3RAZ A;  5FT3 A;  3EWL A;  2HRF A;  2CVK A;  5ID2 A;  1O6J A;  5F0G A;  3LEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...