3KP9A

Structure of a bacterial homolog of vitamin k epoxide reductase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
259
Chain Sequence
QRHSRLILAILAGLGSLLTAYLTYTKLTEQPAAFCTGSDLVLSSRWAEFLGIPTAAVGLLGFLGVLALAVLPLPLVKRWRWPALFGLVSAMTAFEMYMLYLMVAVLRQFCMYCTTAIILVAGLGLVTVLGHRWLDGGKLAFSYILVAFLTLVTTIGVYANQVPPPSPLAVGLAAHLRQIGGTMYGAYWCPHCQDQKELFGAAFDQVPYVECSPNGPGTPQAQECTEAGITSYPTWIINGRTYTGVRSLEALAVASGYPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VKORC1/thioredoxin domain protein
publication title Structure of a bacterial homologue of vitamin K epoxide reductase.
pubmed doi rcsb
source organism Synechococcus sp.
molecule tags Blood coagulation,oxidoreductase
total genus 71
structure length 259
sequence length 264
ec nomenclature ec 1.1.4.2: Transferred entry: 1.17.4.5.
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07884 VKOR Vitamin K epoxide reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.130 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3kp9A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kp9A02
3QDNA 3BD2A 6GSVA 4TOPA 1O85A 3LEFA 16GSA 2WDUA 1PRXA 3ZMLA 2VD0A 2OA7A 1EZKA 3NIVA 4EE0A 3TJBA 2L4QA 4K0NA 4XRDA 5DJLA 1OC8A 2K8VA 3F4SA 1KNGA 4PUAA 4WR5A 4EXJA 3HJPA 1TJDA 1PA3A 4MP4A 3L4NA 3NZNA 4MF6A 2VL2A 4HOJA 2C3TA 5ID2B 4L0UA 1XW9A 2GQLA 5E4WA 1A8LA 3NOFA 3IDVA 2FCHA 2LRTA 2GGTA 4IJIA 2HRFA 4IN0A 5JWQB 4OMVA 2HNLA 4HU9A 1YY7A 2C80A 1UVZA 4K7OA 2C3NA 5ENUA 1A8YA 2ZCTA 3LYKA 4MPFA 5KN1A 2KUCA 1GTUA 3ZL5A 1QUWA 2LEGA 3GTUA 5JCGA 4V1Ap 4ECIA 5B7CA 3Q19A 1PL1A 1YF0A 2GZYA 3LJRA 1T3BA 2BMXA 3GA4A 3W6GA 6GSYA 1K3YA 3H4KA 3N5OA 3IK7A 1VF3A 3Q6OA 2CVKA 2HZEA 1J08A 2K6VA 5GSTA 1EOGA 1CQHA 1A2LA 3QFAC 4IW9A 3IE3A 1F37A 4RI6A 2L4CA 4HQZA 4N0VA 4DVCA 5IMFA 2NVLA 4JU5A 5C04A 3KD0A 1GUKA 4WEYA 2CZ2A 3CTFA 3QOUA 3ZLPA 4HJ2A 2GT5A 3I6AA 1VF2A 1W89A 5G30A 2WCIA 3P7XA 4KGIA 5FT3A 5DJMA 2H70A 1WE0A 1O73A 4JR4A 1Q4JA 3Q18A 3ED3A 1X5CA 1BG5A 5IPGA 4XS6A 4NMUA 5ECSA 1SKSB 1SU9A 4HQSA 19GSA 1V98A 4I5QA 5DBQA 4X43A 2PU9C 20GSA 2H0IA 1PL2A 2DJ2A 2VM2A 1XOBA 3TB2A 2MZCA 2C1YA 3US3A 1JLVA 1ZGNA 3TJFA 5DCHA 3GFKA 4X0XA 1K0AA 2GDRA 4EDZA 2DBCA 2EIQA 1N8JA 3Q74A 5CP1A 5B8BA 3ZVJA 4L8EA 2H71A 4IBPA 3ZFLA 4GWRA 5CO3A 1M9AA 4TR1B 4OFTA 1KBNA 5G5EA 1TDIA 2GSTA 1B9YC 3TUEA 1K0DA 4KX4A 4V1Ag 3L9UA 3BCKA 4BWQA 5D73A 3IXRA 4I2UA 4OO5A 3J7Yk 4KCAA 5EPFA 2N5BA 4EL1A 5AISA 4HDEA 3C1RA 1HD2A 3HHVA 3PR8A 4MJAA 4MCUA 3QMXA 2H6YA 10GSA 1Z7RA 1MD4A 2VLTA 4MDCA 3P2AA 2K18A 2L6CA 3GKNA 3G7YA 1TP9A 5IOWA 3L9SA 1GRXA 1U3AA 5F06A 4TRXA 3A2WA 1K0MA 1BJXA 3VURA 3UMAA 3FRCA 2GVPA 4BA7A 1G6WA 2KOKA 4ID0A 3TRPA 12GSA 3F3RA 5JCWA 1GSSA 3GKXA 3F3QA 3RPNA 1KEBA 2HT9A 3UL3A 1SL0B 4WBRD 1FG4A 4WXTA 1LBKA 4HS1A 1QQ2A 4JEDA 5G1LA 2ON5A 2VLUA 5LCZA 4PNFA 2H6XA 4KW6A 2MMZA 5IM9A 3BBYA 1EWXA 4GSTA 2YP6A 1M7TA 4BL7A 1XVWA 3I69A 3ZMKA 4ECCA 1U6TA 2R2JA 1RQMA 5GSSA 3UJ1A 4GXZA 2C8UA 1ERVA 1SJZA 2ZNMA 4MZCA 5F07A 2XPEA 2R4VA 1OC3A 4PQIA 3GTUB 4XS4A 1V58A 2C0DA 1K0OA 1MDIA 2H1BA 4MF7A 4MA9A 2EC4A 3M9KA 3VWVA 1U88A 2QKEA 1O6JA 1QMVA 1GTAA 5AIXA 1FB6A 3VWWA 1TI3A 4PNGA 2R3XA 1XW6A 2L5OA 2OBKA 4MJCA 3FEUA 1R26A 4ZILA 2CVBA 1GSYA 3MDKA 5F8BA 2HZEB 2CAQA 4LA1A 3GSSA 2MMAA 2WGRA 2IFQA 1T7PB 3VK9A 2E2MA 2TRXA 4L5LA 1A0FA 3RPPA 2RM6A 2LQQA 3UBKA 3KH7A 3E9JB 4KAEA 5LD0A 2OJLA 3UEMA 1V40A 2VM1A 2H72A 4OD7A 4WETA 4KE3A 1E6BA 3FR3A 18GSA 4BPYA 5FWGA 2LS5A 1GULA 2PERA 4ZXGA 3DD3A 1V57A 1PSQA 4IQ1A 1RK4A 4O92A 3EINA 3DGQA 4X1UA 5J4UA 1JZOA 3HA9A 2PN8A 3C8EA 22GSA 2PGTA 4E8EA 1Z7PA 3RAZA 1G6YA 2JZRA 1TRUA 3KXOA 4GSNA 2HLSA 4Q5QA 3DKSA 2NBSA 1GSUA 2GTUA 3WD6A 4IQAA 2GS3A 4JBBA 3GX0A 2AV4A 5DAKA 3KIJA 3VPQA 2YPMA 2VO4A 5IMVA 3SBCA 2IMIA 3PGTA 4CW9A 4QL7A 3GKKA 5B6MA 2QGVA 5GAND 3IR4A 2ON7A 1FB0A 5DALA 1BQ7A 1FHEA 3GUSA 4O5RA 3F6FA 1R5PA 2B5YA 3AY8A 3MSZA 2FWEA 2YJHA 2LJRA 3GV1A 3IAM2 4ZBDA 2OE0A 3IHQA 2HZFA 4YAVA 1YEPA 3GRXA 1XZOA 1XWKA 2B7KA 4DSRA 4HU7A 1GLQA 8GSSA 2YV7A 2A4VA 1OC9A 5B8AA 5C00A 5AN1A 1AIUA 4BWSA 5ABRA 1F3BA 1YDKA 1I5GA 5KN0A 3UBLA 3D5JA 1NHYA 2DC5A 4OCEA 5HFKA 1TK5B 2H1AA 4PGTA 1XIYA 1GUMA 5JWRB 1X9WB 4ZBAA 4O7HA 1F2EA 1TOFA 3QAGA 3FW2A 5LNKe 4HZ2A 2GSRA 4GSSA 4MH2A 3PINA 2DJ1A 2X8HA 4CDOA 1X9MB 2XBIA 2YCDA 3DRNA 1ERUA 3R2QA 2O8VB 2VD1A 3FZ5A 1GLPA 3HXSA 1TXXA 1EOHA 3ERGA 1AC1A 3E0UA 1TK0B 4NV2A 1FVKA 4BVYA 2JACA 1SENA 2MBTA 2L59A 4JE1A 2DSAA 2DJ3A 3FR6A 1URMA 2WULA 3BOAA 2B1KA 3ZRDA 4G19A 4ZB9A 1I9DA 1G7OA 1XWBA 3WGXA 4K2DA 5J3RA 1NM3A 4ZL7A 5A4VA 5G5FA 2M72A 4AJ6A 4ECBA 1VGLA 4YQVA 4KA0A 1SK0A 4DSQA 1SKRB 3H8QA 2XC2A 1JZDA 2JU5A 3CSJA 1E2YA 2LJAA 5AIVA 1M99A 1C72A 2V6KA 4LL1B 6GSTA 1OKTA 4TXOB 2C0EA 2FLSA 4ZL9A 1VRSD 2B6MA 4K9ZA 4DSSA 1AUCA 1Z9HA 3HJMA 1EEJA 3HVSA 2IFQB 3EE2A 4QL9A 3ERFA 1AXDA 1XPVA 1K0BA 2JSZA 5D9TA 3CXGA 3K8NA 1SJIA 3VFIA 4IS0A 4F9ZA 1TK8B 2EIRA 2OE1A 2YZUA 4N0ZA 3D21A 2I4AA 3M1GA 1BYEA 3UIWA 3C71A 1XWCA 1ON4A 1PX7A 2LSTA 3TKQA 1XVQA 2L6DA 4PQHA 4KSMA 4MJEA 1NHOA 2GQKA 5G1KA 2PVOC 2V6OA 2C0GA 2JZSA 3DYRA 2ES7A 2RIIA 5KN3A 1G7EA 3RDWA 1DBYA 1EV4A 2VLVA 3WGDA 4K8MA 2XPDA 1YEXA 3KTBA 5GZZB 5IIZA 1B4QA 3HD5A 4F82A 1X0RA 5DQYA 3W8JA 3IBHA 3KP9A 1H75A 1MD3A 4NHZA 3LFLA 2CZ3A 4XHMA 2A2RA 1JZRA 4V2LA 3IV4A 2FY6A 1V2AA 3CTGA 2KP1A 3GYKA 3C73A 2O85A 5EL8A 4L0WA 3F63A 4YAPA 3IOSA 4FH8A 5DQSA 3QFBC 1MDKA 3ZTLA 3GH6A 4K0GA 5FHIA 2F8FA 2K8SA 2VL2C 13GSA 1A0RP 4POKA 1ERTA 5IMDA 5H5SA 5D96A 4D73B 1PQNA 1OE7A 3V1WA 3KGKA 1FVJA 4FYCA 4Q5RA 2OE3A 1Z3EA 1SJ6A 3APOA 4IKHA 4KDYA 3ZREA 2FWHA 2H30A 2OBIA 1LJRA 2REMA 1N2AA 2NDOA 3H1NA 3C1SA 4O32A 2IMEA 4EKZA 4YQMA 1EV9A 2FUG2 2YZHA 1PKWA 3EU3A 5EVOA 5HFGA 3DEXA 3KH9A 3VLNA 1R5AA 2PWJA 2VAFA 2VIMA 4WBJA 3WGEA 1AQVA 2JL4A 4TKYA 2CX3A 5J9CA 5JWOB 2DJJA 2AJQB 2J23A 2MMNA 1TW9A 4XRAA 2MMOA 2H74A 2VL9A 2CVDA 5KEJA 2E2GA 1SYXA 2WZ9A 2L57A 2MYGA 4ILFA 1ST9A 5H5RA 4HUAA 3F9UA 2G0FA 1FO5A 6GSUA 2N5AA 2H0HA 1MDJA 3M8NA 1XBSA 5IO0A 1X5EA 2VCXA 1QXHA 2CA8A 4WF4A 1A24A 3RHCA 2I9HA 2MBSA 2AUVA 1EEMA 2VCZA 1W4VA 1JFUA 1K3LA 1J9BA 2H1GA 4J56E 2VCWA 4F03A 1ZL9A 3FYGA 4GF0A 5IPHA 1YKCA 5CREA 5IQYA 1T4ZA 3J7Yb 2LTKA 1YZXA 2GZPA 2YV9A 4RQXA 1TU8A 1ABAA 3ZFBA 2IN3A 1ACVA 4OO4A 2D2ZA 1OYJA 3DMLA 3GMFA 5CNWA 4I2TA 3TKPA 1TTZA 2P0GA 3KTLA 1THOA 5GAPD 3GIXA 3TJJA 2GSSA 4ZBBA 2NTOA 2RLIA 1T1VA 2RM5A 1NSWA 2P5RA 3MAKA 1GWCA 3ZZXA 1Y6EA 2QC7A 1XOAA 1GSFA 2E0QA 1TRWA 4PURA 4IVFA 2B1LA 4KNDA 1OE8A 3GURA 3ME7A 5IMCA 2YJ7A 1XWGA 4N11A 5IMZA 1J0FA 2P31A 2WB9A 1GSEA 2O87A 6GSXA 9GSSA 1LU4A 1K0CA 3EVIA 4PXOA 1DE2A 1BX9A 4TXVA 4DSSB 1SYRA 1M2DA 1MTCA 1O8XA 4PUFC 3M0FA 3F0IA 4Z7XA 3LG6A 4FYUA 4GLTA 4Q5FA 1IYHA 3KEBA 4F0BA 3BJ5A 4KSOA 1M2BA 1PN9A 3GNJA 3GN3A 4V2NA 1HNBA 3GL3A 2AYTA 4HEA2 4MABA 3BCIA 2VCTA 2F51A 5F05A 1AQWA 2GLRA 2XHFA 1QFNA 2F3MA 2FA8A 4MJBA 2PMTA 3CRTA 3QCPA 5CRHA 3KZQA 4IP6A 2B5XA 2J9HA 3A2XA 3N9JA 1RW1A 1G0TA 2KHPA 4GRFA 4NAXA 3DIEA 2WS2A 2X8CA 3G9BA 1B8XA 3WYWA 3F4RA 3EYTA 5HR1A 3EMXA 2FWGA 4G9HA 1Q98A 5DVBA 1WPIA 2HFDA 2JADA 3UOMA 4MPGA 2H19A 4MF5A 6GSSA 4POBA 1OAZA 11GSA 4ML1A 4HI7A 3ZIJA 4K6XA 3TKSE 1GUHA 5KN2A 3A3TA 1B9XC 1F6MC 2H66A 2LUSA 3ISOA 4RQRA 4XS1A 4YH2A 3H93A 3HY2A 3LQ7A 3LWAA 3UVHA 2L5LA 2YOIA 1T8EB 2VL3A 3EMPA 2VUPA 4TR1A 4KH7A 4MZBA 2BTOT 4ISDA 1U87A 3D4MA 2V1MA 2FHEA 3SWLA 1PKZA 4LL4B 3FKFA 2DLXA 3KMNA 4AGSA 2V2GA 1SL1B 5J41A 2DIYA 3TKRA 3H79A 4MMMA 1A23A 3APSA 1TI1A 2I81A 1PMTA 4MH3A 2FD3A 4ECJA 14GSA 1HQOA 2WFCA 1SD8A 2IIYA 1GSDA 4NV5A 4H86A 1USBA 1HNAA 1KTEA 4IJ3A 2YWOA 3HVVA 3D0ZA 4TN8A 2LRCA 3MWHA 1JHBA 3ME8A 1ZOFA 1O8WA 1Z5YE 2X8GA 4EC0A 1TU7A 2YNXA 2Z9SA 3RHBA 3UAPA 3DWVA 2OADA 4GTUA 2FA4A 5AGYA 2VOCA 1XXUA 1OVNA 3KMOA 5G31A 5DCGA 2LNTA 3A2VA 4FIWA 5A4UA 2HRNA 2R6KA 2IL3A 3LXTA 5ECRB 2LKUA 5IOXA 1K0NA 3DVXA 1DSBA 2B3SA 2E7PA 2KP2A 3HKRA 4EDYA 5HR3A 1GNEA 1ZMAA 2R5GA 1CQGA 1AW9A 1WOUA 3FZAA 1EP8A 3A5WA 3UARA 2JZTA 3GL5A 1H4OA 4NPBA 1M2AA 4FYBA 4PQ1A 3QAVA 4JR6A 3LXZA 5JCUA 1VF1A 3C7MA 4MLYA 1GP1A 2FGXA 1WIKA 2ALBA 5ECMB 4ZIJA 4TR4A 2X99A 5CAXA 4XS4B 1O7UA 3CSHA 2C0FA 4IGJA 1R7HA 1ML6A 4HZ4A 2VCQA 3APQA 1Z6MA 2TIRA 4LMVA 3MNGA 5ECLB 3ERWA 2C4JA 2EIOA 3P90A 3HVXA 3VI5A 1GL8A 4OFNA 3DXBA 3TKSA 3IA1A 4JZQA 1SL2B 2GZZA 1ILOA 2H73A 3HJOA 2HE3A 2IMKA 1XFLA 2DMMA 3TRXA 1PX6A 5IMAA 2IPAA 5ECOB 4K1FA 1PGTA 2WJUA 1DUGA 5F0GA 4F2IA 4KUNA 4ML6A 1WP0A 2BJXA 1A2JA 2YWIA 4YQUA 3QR6A 4K7NA 1YJ6A 5L71A 2OKAA 4POLA 1ERWA 4KB3A 4EO3A 17GSA 3QPMA 4V2MA 2X64A 3L78A 3HDCA 4AJ7A 4I8BA 4ZB6A 2HSYA 3O3TA 4BVXA 3JCML 3WT2A 4AF2A 5ECPB 2IMFA 3KCMA 1K3OA 3IC4A 1B4PA 2HXKA 4GQCA 2OACA 1ZYEA 4KDUA 4PX1A 1AQXA 5COHA 4OCFA 4G2EA 4P3YB 2A2SA 1BEDA 2IMDA 2PVQA 5DAKB 3UVTA 4NHWA 3TGZA 1X5DA 1MEKA 4J2FA 4WF5A 1Z6NA 3VWXA 5HQPA 1M9BA 2LV3A 2GT6A 4FO5A 4EUYA 2TRCP 1GNWA 1AAZA 5INYA 4CHSA 1NW2A 2CAIA 1WMJA 5DALB 5A4WA 4LLRA 1XWAA 5D9XA 4RUVA 4Q5NA 1T00A 5EY6A 2HSHA 5CRWA 3L0HA 2CT6A 6GSWA 1SK1A 1TKDB 2CQ9A 4ZB8A 1TRVA 1ZCPA 2DJKA 4J57E 1OC9B 4TW5A 4IELA 5HR0A 3DVWA 2NPBA 3EURA 4E8HA 5E59A 2AB6A 3M3MA 1UN2A 1WWJA 2H6ZA 5ECKB 3M9JA 3GHAA 3I43A 1SK2A 3PH9A 4MZWA 1WJKA 2KLXA 1ZZYA 2O7KA 1GTBA 3FHKA 4TR0A 1GH2A 3ZIVA 2PBJA 5ECNB 3VI7A 4WKWA 3I9V2 4DEJA 2B5EA 3GKMA 3TKSC 4LMWA 1DE1A 5J5NA 3CYNA 4XTSA 5D8IA 4JRRA 2P5QA 2K9FA 1THXA 1UA5A 5ID2A 2HI7A 2M80A 2FNOA 3G7JA 1X9SB 1OKDA 1ZYQB 2LJKA 2AHEA 3P8WA 3O76A 4NWYA 3FR9A 2V32A 1YQ1A 2F8AA 5J9BA 2LNSA 3E3EA 5HR2A 2DMLA 2JSYA 2YN1A 3KM6A 2RUFA 3HZ8A 4OWYA 3U5RE 3S9FA 4GQFA 4L5OA 3G7IA 4I97A 4NXIA 1XCCA 3QAWA 4QQ7A 3VWUA 4EVMA 4WR4A 1QGVA 1FW1A 2HYXA 3VPTA 2YANA 3EC3A 2XBQA 3KP8A 3D4TA 3TDGA 3TJKA 3TOTA 3KJYA 1UC7A 5CYYA 2M46A 2WRTA 5IO2A 3TOUA 1EGOA 3U6VA 5G2ZA 2ZUPA 2V41A 3L9VA 3CSIA 3TJGA 4KCEA 3ZVJD 1JLWA 5ECIB 1JZWA 2QSIA 3D22A 2DIZA 2LRNA 3O6TA 2PUKC 3D6IA 4TXOA 4XCSA 2PPTA 4TVEA 2O89A 5DDLA 2C3QA 4AJ8A 2RUEA 2I1UA 4IP1A 7GSSA 4HJMA 4MK3A 2CX4A 1HYUA 3OR5A 5ELAA 3EU4A 5ECHB 5A5KA 1EGRA 4N10A 1F3AA 1B48A 1M0UA 4G10A 2N5FA 1GSQA 4F0CA 1O81A 3CRUA 4KDXA 1U3IA 3EWLA 1XW5A 1PD21 3IRAA 4XIHA 1EP7A 2H0GA 3LSZA 4GCIA 3ZYWA 4N30A 4ULXA 3CBUA 2G2QA 3F8UA 4EF0A 5D9VA 1WRYA 3F6DA 3FZ9A 2H1DA 3LYPA 3FK8A 2LQOA 1T4YA 5H5QA 3FY7A 2FWFA 4TR3A 3ZITA 3IK9A 2YWNA 4POMA 4I6XA 5ELGA 1BAYA 2IJYA 2I3YA 2AAWA 2VCVA 4ZL8A 2GQMA 3CMIA 3QD9A 5ECQB 2YWMA 3RBTA 3F4TA 1FOVA 1S3AA 4RI7A 1QK8A 3WT1A 3HCZA 2H76A 1Y25A 5CRDA 2DJ0A 3TRQA 4IHUA 4D73A 1IYIA 2R37A 1FAAA 3IAS2 5D93A 1YKAA 2F9SA 3GSTA 1YF1A 4ACSA 1HNCA 1VF4A 5HFIA 1A2MA 1SKWB 2GSQA 3HZ4A 3GX8A 1TRSA 4K7IA 2H75A 2IWTA 1GTIA 4OFMA 5D9WA 3LGCA 3HYPA 5CRGA 5B6NA 3FZ4A 1F9MA 1S3DA 2B7JA 2H8LA 2CV4A 3W8SA 3GH9A 1R4WA 1SD9A 2H01A 1V9WA 3LORA 3TCOA 3IPZA 1S3CA
chains in the Genus database with same CATH superfamily
3QDNA 3BD2A 6GSVA 4TOPA 1O85A 3LEFA 16GSA 2WDUA 2GSCA 1PRXA 3ZMLA 2VD0A 2OA7A 1EZKA 4Z2RA 3NIVA 4EE0A 3TJBA 2L4QA 4K0NA 4XRDA 5DJLA 1OC8A 2K8VA 4YZ9A 3F4SA 1KNGA 3IHGA 4PUAA 4WR5A 4EXJA 3HJPA 1TJDA 1PA3A 4MP4A 3L4NA 3NZNA 4MF6A 2VL2A 4HOJA 2C3TA 1PN0A 5ID2B 4L0UA 1XW9A 2GQLA 5E4WA 1A8LA 3NOFA 3IDVA 2FCHA 2LRTA 1M3IA 2GGTA 4IJIA 2HRFA 4IN0A 5JWQB 4OMVA 2HNLA 4HU9A 1YY7A 2C80A 1UVZA 4K7OA 2C3NA 5ENUA 1A8YA 2ZCTA 3LYKA 4PL5A 4MPFA 5KN1A 2KUCA 1GTUA 3ZL5A 1QUWA 2LEGA 3GTUA 5JCGA 4V1Ap 4ECIA 2R0GA 5B7CA 3Q19A 1PL1A 1YF0A 2GZYA 3LJRA 1JQOA 1T3BA 2BMXA 3GA4A 3W6GA 6GSYA 1K3YA 3H4KA 3N5OA 3IK7A 1VF3A 3Q6OA 2CVKA 2HZEA 1J08A 2K6VA 5GSTA 1EOGA 1CQHA 1A2LA 3QFAC 3VA9A 4IW9A 3IE3A 1F37A 4RI6A 3FMWA 2L4CA 4HQZA 4N0VA 4DVCA 5IMFA 5BRTA 2NVLA 4JU5A 5C04A 3KD0A 1GUKA 4WEYA 2CZ2A 2L1LB 3CTFA 3QOUA 3ZLPA 2UZ8A 4A5PA 4OAVB 4HJ2A 2GT5A 3I6AA 1VF2A 1W89A 5G30A 2WCIA 3P7XA 4KGIA 5FT3A 5DJMA 2H70A 1WE0A 1O73A 4JR4A 1Q4JA 3Q18A 3ED3A 1X5CA 1BG5A 5IPGA 4XS6A 4NMUA 5ECSA 1SKSB 1SU9A 4HQSA 19GSA 2XTQA 1V98A 4I5QA 5DBQA 4X43A 2PU9C 20GSA 2H0IA 1PL2A 2DJ2A 2VM2A 1XOBA 3TB2A 2MZCA 2A2PA 2C1YA 2F66B 3US3A 1JLVA 1ZGNA 3TJFA 5DCHA 3GFKA 4X0XA 1K0AA 2GDRA 4EDZA 2DBCA 2CAZB 2EIQA 1N8JA 3IAM1 3Q74A 2HSMA 5CP1A 5B8BA 3ZVJA 4L8EA 2H71A 4IBPA 3ZFLA 4GWRA 5CO3A 1M9AA 4TR1B 4OFTA 1KBNA 5G5EA 1TDIA 2GSTA 1B9YC 3TUEA 1K0DA 4KX4A 4V1Ag 3L9UA 3BCKA 4BWQA 5D73A 3IXRA 4I2UA 4OO5A 2JB3A 3J7Yk 4KCAA 2N5BA 5EPFA 4EL1A 5AISA 4HDEA 3C1RA 1HD2A 3HHVA 3PR8A 4MJAA 4MCUA 3QMXA 2H6YA 10GSA 1Z7RA 1MD4A 2VLTA 4MDCA 3P2AA 2K18A 2L6CA 3GKNA 3G7YA 1TP9A 5IOWA 3L9SA 1GRXA 1U3AA 5F06A 2BL7A 5LNK1 4Z2UA 4TRXA 2V1CC 3A2WA 1K0MA 1BJXA 3VURA 3UMAA 3FRCA 2GVPA 4BA7A 1G6WA 2KOKA 4ID0A 3EPTA 4PL3A 3TRPA 12GSA 3F3RA 5JCWA 1GSSA 3GKXA 3F3QA 3RPNA 1KEBA 2HT9A 3UL3A 1SL0B 4WBRD 1FG4A 4WXTA 1LBKA 4HS1A 1QQ2A 4JEDA 5G1LA 2ON5A 2VLUA 5LCZA 4PNFA 2H6XA 4KW6A 2MMZA 5IM9A 3BBYA 1EWXA 4GSTA 3LJ1A 2YP6A 1M7TA 4BL7A 1XVWA 3I69A 3ZMKA 4ECCA 1U6TA 2R2JA 1RQMA 5GSSA 3UJ1A 4GXZA 2C8UA 1ERVA 1SJZA 4O5QA 2ZNMA 4MZCA 5F07A 2XPEA 2R4VA 1OC3A 4PQIA 3GTUB 4XS4A 1V58A 2C0DA 1K0OA 1MDIA 2H1BA 4MF7A 4MA9A 2EC4A 3M9KA 3VWVA 1U88A 1SJ8A 2QKEA 2JAEA 1O6JA 1QMVA 1GTAA 5AIXA 1FB6A 3VWWA 1TI3A 4PNGA 2R3XA 4PL4A 1XW6A 2L5OA 2OBKA 4MJCA 3FEUA 1R26A 4ZILA 2CVBA 1GSYA 3MDKA 5F8BA 2HZEB 2CAQA 4LA1A 3GSSA 2MMAA 2WGRA 4FQUA 2IFQA 1T7PB 3VK9A 2E2MA 2TRXA 4L5LA 1A0FA 3RPPA 2RM6A 2LQQA 3UBKA 3KH7A 3E9JB 4KAEA 5LD0A 2OJLA 3UEMA 1V40A 2VM1A 2H72A 4OD7A 4WETA 4KE3A 1E6BA 2MJFB 3FR3A 18GSA 4BPYA 5FWGA 2LS5A 1GULA 2PERA 4ZXGA 3DD3A 1V57A 1PSQA 4BVXB 4IQ1A 1RK4A 4O92A 3EINA 3DGQA 4X1UA 5J4UA 1JZOA 3HA9A 2PN8A 3C8EA 22GSA 2PGTA 4E8EA 1Z7PA 3RAZA 1G6YA 2JZRA 1TRUA 3KXOA 4GSNA 2HLSA 4Q5QA 3DKSA 2NBSA 1GSUA 2GTUA 3WD6A 4IQAA 2GS3A 4JBBA 3GX0A 2AV4A 5DAKA 3KIJA 3VPQA 2YPMA 2VO4A 5IMVA 3SBCA 2DKHA 2IMIA 3PGTA 4CW9A 4QL7A 3GKKA 5B6MA 2F6MB 2QGVA 5GAND 3IR4A 2ON7A 2FUG1 1FB0A 5DALA 1BQ7A 1FHEA 3GUSA 4O5RA 3F6FA 1R5PA 2B5YA 3AY8A 3MSZA 2FWEA 2YJHA 2LJRA 3GV1A 3IAM2 4ZBDA 2OE0A 3IHQA 2HZFA 4YAVA 1YEPA 3GRXA 1XZOA 1XWKA 2B7KA 4DSRA 4HU7A 1GLQA 8GSSA 2YV7A 2A4VA 1OC9A 5B8AA 5C00A 5AN1A 1AIUA 4BWSA 5ABRA 1F3BA 1YDKA 1I5GA 5KN0A 3UBLA 3D5JA 1NHYA 2DC5A 4OCEA 5HFKA 1TK5B 2H1AA 4PGTA 2R0CA 1XIYA 2KKMA 1GUMA 5JWRB 1X9WB 2ZRRA 4ZBAA 4O7HA 2QSBA 1F2EA 1M3JA 1TOFA 3QAGA 3FW2A 5LNKe 4HZ2A 2GSRA 4GSSA 4MH2A 3PINA 2DJ1A 2X8HA 4CDOA 1X9MB 2XBIA 4GXTA 2YCDA 3DO9A 3DRNA 1ERUA 1YO7A 3R2QA 2O8VB 2VD1A 3CQFA 3FZ5A 4YKGA 1GLPA 3HXSA 1TXXA 1EOHA 3ERGA 1AC1A 3E0UA 4CY8A 1TK0B 4NV2A 1FVKA 4BVYA 2JACA 1SENA 2MBTA 2L59A 4JE1A 2DSAA 2DJ3A 3FR6A 4BL7B 1URMA 2WULA 3BOAA 4KF9A 2B1KA 3ZRDA 4G19A 4ZB9A 1I9DA 3DA4A 1G7OA 1XWBA 3WGXA 4K2DA 5J3RA 1NM3A 4ZL7A 5A4VA 5G5FA 2M72A 4AJ6A 4ECBA 1VGLA 4YQVA 4KA0A 1SK0A 4DSQA 1SKRB 3H8QA 2XC2A 1JZDA 2JU5A 3CSJA 3LJ0A 1E2YA 2LJAA 5AIVA 1M99A 1C72A 2V6KA 4G0LA 4LL1B 6GSTA 1OKTA 2A2CA 4TXOB 2C0EA 2FLSA 4ZL9A 1VRSD 4HEA1 2B6MA 4K9ZA 4DSSA 1AUCA 1Z9HA 3HJMA 1EEJA 3HVSA 2IFQB 3EE2A 4QL9A 3ERFA 4O5UA 1AXDA 2R0PA 1XPVA 1W3SA 1K0BA 2JSZA 3F4MA 5D9TA 3CXGA 3K8NA 1SJIA 3VFIA 4IS0A 4F9ZA 1TK8B 2EIRA 4O1OA 2OE1A 2YZUA 3LW9A 4N0ZA 3D21A 2I4AA 4EIQA 3M1GA 1BYEA 3UIWA 3C71A 1XWCA 1ON4A 1PX7A 2LSTA 3TKQA 1XVQA 2L6DA 4PQHA 4KSMA 4MJEA 1NHOA 2GQKA 5G1KA 2PVOC 2V6OA 2C0GA 2JZSA 3DYRA 2ES7A 2RIIA 5KN3A 1G7EA 3RDWA 1DBYA 1EV4A 2VLVA 3WGDA 4K8MA 2XPDA 1YEXA 3KTBA 5GZZB 5IIZA 1B4QA 3HD5A 4F82A 1X0RA 5DQYA 3W8JA 3IBHA 3KP9A 1H75A 1MD3A 4NHZA 3LFLA 2CZ3A 4XHMA 2A2RA 1JZRA 4V2LA 3IV4A 2FY6A 1V2AA 3CTGA 2KP1A 3GYKA 3C73A 2O85A 5EL8A 4L0WA 3F63A 4YAPA 3IOSA 4FH8A 5DQSA 4Z7HA 3QFBC 1MDKA 3ZTLA 3GH6A 4K0GA 5FHIA 2F8FA 2K8SA 2VL2C 13GSA 1A0RP 3P23A 4POKA 1ERTA 5IMDA 5H5SA 5D96A 4D73B 1PQNA 1OE7A 3V1WA 3A5IA 4OAUC 3KGKA 1FVJA 4FYCA 4Q5RA 2OE3A 1Z3EA 1SJ6A 3APOA 4IKHA 4KDYA 3ZREA 2FWHA 2H30A 2OBIA 1LJRA 2REMA 1N2AA 2RADA 2NDOA 4JCVE 3H1NA 3MYDA 3C1SA 4O32A 2IMEA 4EKZA 4EIPA 4YQMA 1EV9A 2FUG2 2YZHA 1PKWA 3SDJA 3EU3A 5EVOA 5HFGA 3DEXA 3KH9A 3VLNA 1R5AA 2PWJA 2VAFA 2VIMA 4WBJA 3WGEA 4AS3A 2XTRA 1AQVA 2JL4A 4TKYA 2CX3A 5J9CA 5JWOB 2DJJA 2AJQB 2J23A 2MMNA 1TW9A 4XRAA 2MMOA 2H74A 2VL9A 2CVDA 5KEJA 2E2GA 1SYXA 2WZ9A 2L57A 2MYGA 4ILFA 1ST9A 5H5RA 4HUAA 3F9UA 2G0FA 1FO5A 6GSUA 2N5AA 2YFAA 2H0HA 1MDJA 3M8NA 1XBSA 5IO0A 1X5EA 2VCXA 1QXHA 1ZYPA 2CA8A 4WF4A 1A24A 3RHCA 2I9HA 2MBSA 2AUVA 1EEMA 2VCZA 1W4VA 1JFUA 1K3LA 1J9BA 2H1GA 4J56E 2VCWA 4F03A 1ZL9A 3FYGA 4GF0A 5IPHA 1YKCA 5CREA 5IQYA 1T4ZA 2DKIA 3J7Yb 2LTKA 1YZXA 2GZPA 2YV9A 4RQXA 1TU8A 4BVYB 1ABAA 3ZFBA 2IN3A 1ACVA 4OO4A 2D2ZA 1OYJA 3DMLA 3GMFA 5CNWA 4I2TA 3TKPA 1TTZA 2P0GA 3KTLA 3DA3A 1THOA 5GAPD 3GIXA 3TJJA 2GSSA 4ZBBA 2NTOA 4HFVA 2RLIA 1T1VA 2RM5A 1NSWA 2P5RA 3MAKA 1GWCA 3ZZXA 1Y6EA 2QC7A 1XOAA 1GSFA 2E0QA 1TRWA 4PURA 4IVFA 2B1LA 4KNDA 1OE8A 3GURA 3ME7A 5IMCA 2YJ7A 1XWGA 4N11A 5IMZA 1J0FA 2P31A 2WB9A 1GSEA 2O87A 6GSXA 9GSSA 1LU4A 1K0CA 3EVIA 4PXOA 1DE2A 1BX9A 4TXVA 4DSSB 1SYRA 1M2DA 1MTCA 1O8XA 4PUFC 3M0FA 3F0IA 4Z7XA 3LG6A 4FYUA 4GLTA 4Q5FA 1IYHA 2HRKA 3KEBA 4F0BA 3BJ5A 4KSOA 1M2BA 1PN9A 1ZYNA 3GNJA 3GN3A 4V2NA 1HNBA 3GL3A 2AYTA 4HEA2 4MABA 3BCIA 2VCTA 2F51A 5F05A 1AQWA 3JSBA 2GLRA 2XHFA 1QFNA 2F3MA 2FA8A 4MJBA 2PMTA 3CRTA 3QCPA 5CRHA 4U6RA 3KZQA 4IP6A 2B5XA 2J9HA 3A2XA 3N9JA 1RW1A 1G0TA 2KHPA 4GRFA 4NAXA 3DIEA 2WS2A 2X8CA 3G9BA 1B8XA 3WYWA 3F4RA 3EYTA 5HR1A 3EMXA 2FWGA 4G9HA 1Q98A 5DVBA 1WPIA 2HFDA 2JADA 3UOMA 4MNNA 4MPGA 2H19A 4MF5A 6GSSA 4POBA 1OAZA 11GSA 4ML1A 1U5KA 4HI7A 3ZIJA 4K6XA 3TKSE 1GUHA 5KN2A 3A3TA 1B9XC 1F6MC 2H66A 2LUSA 3ISOA 4RQRA 4XS1A 4YH2A 3H93A 3HY2A 2IP6A 3LQ7A 3LWAA 3UVHA 2L5LA 2YOIA 1T8EB 2VL3A 3EMPA 2VUPA 3MIXA 4TR1A 4KH7A 4MZBA 2YFBA 2BTOT 4ISDA 1U87A 3D4MA 3AJFA 2V1MA 2FHEA 3SWLA 1PKZA 4LL4B 3FKFA 2DLXA 3KMNA 4AGSA 2V2GA 1SL1B 5J41A 2DIYA 3TKRA 3H79A 4MMMA 1A23A 3APSA 1TI1A 2I81A 1PMTA 4MH3A 2FD3A 4ECJA 4G76A 14GSA 4K5RA 1HQOA 2WFCA 1SD8A 2IIYA 1GSDA 4NV5A 3I9V1 4H86A 1USBA 1HNAA 1KTEA 4IJ3A 3FNBA 2YWOA 4O1PA 2QGMA 3HVVA 3D0ZA 4TN8A 2LRCA 3MWHA 3FVVA 2JBWA 1JHBA 3ME8A 1ZOFA 1O8WA 1Z5YE 2X8GA 4EC0A 1TU7A 2YNXA 2Z9SA 3RHBA 3UAPA 3DWVA 2OADA 4GTUA 2FA4A 5AGYA 2VOCA 1XXUA 1OVNA 3KMOA 5G31A 5DCGA 2LNTA 3A2VA 4FIWA 2QA1A 5A4UA 2HRNA 2R6KA 2IL3A 3LXTA 5ECRB 2LKUA 5IOXA 1K0NA 3DVXA 1DSBA 2B3SA 2E7PA 2KP2A 2QA2A 3HKRA 4EDYA 5HR3A 2A4HA 1GNEA 1ZMAA 2R5GA 1CQGA 1AW9A 1WOUA 3FZAA 1EP8A 3A5WA 3UARA 2JZTA 3GL5A 1H4OA 4NPBA 1M2AA 4FYBA 4PQ1A 3QAVA 4JR6A 3LXZA 5JCUA 1VF1A 3C7MA 4MLYA 1GP1A 2FGXA 1WIKA 2ALBA 5ECMB 4ZIJA 4TR4A 2X99A 5CAXA 4XS4B 1O7UA 3CSHA 1XG8A 2C0FA 4IGJA 1R7HA 1ML6A 4HZ4A 2VCQA 3APQA 1Z6MA 2TIRA 4K2XA 4PTSA 4LMVA 3MNGA 5ECLB 3ERWA 2C4JA 4Z7GA 2EIOA 3P90A 3HVXA 2HRAA 3VI5A 1GL8A 4OFNA 3DXBA 3TKSA 4I1TA 3IA1A 4JZQA 1SL2B 2GZZA 1ILOA 2H73A 2JB1A 3HJOA 2HE3A 2IMKA 1FOHA 1XFLA 2DMMA 3TRXA 1PX6A 5IMAA 2IPAA 5ECOB 4K1FA 1PGTA 2WJUA 1DUGA 5F0GA 4F2IA 4KUNA 4ML6A 4BIKA 4G75A 1WP0A 2BJXA 1A2JA 3L0IA 5HGIA 2YWIA 4YQUA 3IC8A 3QR6A 4K7NA 4Z2TA 1YJ6A 5L71A 2OKAA 4POLA 1ERWA 5KOXA 4KB3A 4EO3A 17GSA 3QPMA 4V2MA 2X64A 3L78A 3HDCA 4AJ7A 4I8BA 4ZB6A 2HSYA 3O3TA 2X49A 4BVXA 3UITA 3JCML 3WT2A 4AF2A 5ECPB 2IMFA 3KCMA 1K3OA 3IC4A 1B4PA 2HXKA 4GQCA 2OACA 1ZYEA 4KDUA 4PX1A 1AQXA 5COHA 4YKFA 4OCFA 4G2EA 4P3YB 1PFOA 2A2SA 2JB2A 1BEDA 2IMDA 2PVQA 5DAKB 3UVTA 4NHWA 3TGZA 1X5DA 1MEKA 4J2FA 4WF5A 1Z6NA 3VWXA 5HQPA 1M9BA 2LV3A 2GT6A 4FO5A 4EUYA 2TRCP 2BL8A 3IAS1 1GNWA 1AAZA 5INYA 4CHSA 1NW2A 2CAIA 1WMJA 5DALB 5A4WA 4LLRA 1XWAA 4YZCA 5D9XA 4RUVA 4AS2A 4Q5NA 1T00A 5EY6A 2P22B 2K19A 2HSHA 5CRWA 3B55A 3L0HA 2CT6A 6GSWA 1SK1A 1TKDB 2CQ9A 4ZB8A 1TRVA 1ZCPA 2X4AA 2DJKA 4J57E 1OC9B 4TW5A 4IELA 5HR0A 3DVWA 2NPBA 3EURA 4E8HA 5E59A 2AB6A 3M3MA 1UN2A 1WWJA 2H6ZA 5ECKB 3M9JA 3GHAA 3I43A 1SK2A 3PH9A 4YZDA 4G0IA 4MZWA 1WJKA 4DWLA 2KLXA 1ZZYA 2O7KA 1GTBA 3FHKA 4TR0A 1GH2A 3ZIVA 2E8GA 2PBJA 5ECNB 3VI7A 4WKWA 3I9V2 4DEJA 2B5EA 3GKMA 3TKSC 4LMWA 1DE1A 5J5NA 3CYNA 4XTSA 5D8IA 4JRRA 3FBVA 2P5QA 2K9FA 1THXA 1UA5A 5ID2A 2HI7A 2M80A 2FNOA 2RLDA 3G7JA 1X9SB 1OKDA 1ZYQB 4CY6A 2LJKA 2AHEA 3P8WA 3O76A 4NWYA 4USSA 3FR9A 2V32A 1YQ1A 2F8AA 5J9BA 4G0KA 2LNSA 3E3EA 5HR2A 2DMLA 2JSYA 2YN1A 3KM6A 2RUFA 3HZ8A 4OWYA 3U5RE 3S9FA 4GQFA 4L5OA 3G7IA 4I97A 4NXIA 1XCCA 3QAWA 4QQ7A 3VWUA 4EVMA 4WR4A 2FU2A 1QGVA 4K5SA 1FW1A 2HYXA 3VPTA 2YANA 3EC3A 3PPUA 2XBQA 3KP8A 3D4TA 3LJ2A 3TDGA 3TJKA 3TOTA 3KJYA 1UC7A 5CYYA 2M46A 2WRTA 5IO2A 3TOUA 1EGOA 3U6VA 5G2ZA 2ZUPA 2V41A 3L9VA 3CSIA 3TJGA 4KCEA 3ZVJD 1JLWA 5ECIB 1JZWA 2QSIA 3D22A 2DIZA 2LRNA 3O6TA 2PUKC 3D6IA 4TXOA 4XCSA 2PPTA 4TVEA 2O89A 5DDLA 2C3QA 4AJ8A 2RUEA 2I1UA 4IP1A 7GSSA 4HJMA 4MK3A 2CX4A 1HYUA 3OR5A 5ELAA 3EU4A 5ECHB 5A5KA 1EGRA 4N10A 1F3AA 1B48A 1M0UA 4G10A 2N5FA 1GSQA 4F0CA 1O81A 5KOWA 3CRUA 4KDXA 1U3IA 3EWLA 3HVNA 1XW5A 1PD21 3IRAA 4XIHA 1EP7A 2H0GA 3LSZA 4GCIA 3ZYWA 4N30A 3Q8DA 4ULXA 3CBUA 2G2QA 3F8UA 4EF0A 5D9VA 2RIOA 1WRYA 3F6DA 3FZ9A 2H1DA 3LYPA 3FK8A 2LQOA 3R3EA 1TDPA 1T4YA 5H5QA 3FY7A 2FWFA 4TR3A 3ZITA 2ZW3A 3IK9A 2YWNA 4POMA 4ICYA 4I6XA 5ELGA 1BAYA 2IJYA 2I3YA 2AAWA 2VCVA 4ZL8A 2GQMA 2XMXA 3CMIA 1S3RA 2QZGA 3QD9A 5ECQB 2YWMA 3RBTA 3F4TA 1FOVA 1S3AA 4RI7A 1QK8A 3WT1A 3HCZA 4X4JA 5BMUA 2H76A 1Y25A 2HGKA 2ETDA 5CRDA 2DJ0A 3TRQA 4Q9VA 4IHUA 4D73A 1IYIA 2R37A 2A2DA 1FAAA 3IAS2 5D93A 1YKAA 2F9SA 3GSTA 1YF1A 4ACSA 1HNCA 1VF4A 5HFIA 1A2MA 1SKWB 2GSQA 2V6EA 3HZ4A 3GX8A 1TRSA 4K7IA 2H75A 2IWTA 1GTIA 4HSCX 4OFMA 5D9WA 3LGCA 3HYPA 5CRGA 5B6NA 3FZ4A 1F9MA 1S3DA 2FEFA 2B7JA 2H8LA 2CV4A 3W8SA 3GH9A 1R4WA 1SD9A 2H01A 1V9WA 3LORA 3TCOA 3IPZA 1S3CA
chains in the Genus database with same CATH topology
3QDNA 3BD2A 6GSVA 4TOPA 1O85A 3LEFA 16GSA 2WDUA 1PRXA 3ZMLA 2VD0A 2OA7A 1EZKA 4Z2RA 3NIVA 4EE0A 3TJBA 2L4QA 4K0NA 4XRDA 5DJLA 1OC8A 2K8VA 4YZ9A 3F4SA 1KNGA 3IHGA 4PUAA 4WR5A 4EXJA 3HJPA 1TJDA 1PA3A 4MP4A 3L4NA 3NZNA 4MF6A 2VL2A 4HOJA 2C3TA 1PN0A 5ID2B 4L0UA 1XW9A 2GQLA 5E4WA 1A8LA 3NOFA 3IDVA 2FCHA 2LRTA 2GGTA 4IJIA 2HRFA 4IN0A 5JWQB 4OMVA 2HNLA 4HU9A 1YY7A 2C80A 1UVZA 4K7OA 2C3NA 5ENUA 1A8YA 2ZCTA 3LYKA 4PL5A 4MPFA 5KN1A 2KUCA 1GTUA 3ZL5A 1QUWA 2LEGA 3GTUA 5JCGA 4V1Ap 4ECIA 2R0GA 5B7CA 3Q19A 1PL1A 1YF0A 2GZYA 3LJRA 1T3BA 2BMXA 3GA4A 3W6GA 6GSYA 1K3YA 3H4KA 3N5OA 3IK7A 1VF3A 3Q6OA 2CVKA 2HZEA 1J08A 2K6VA 5GSTA 1EOGA 1CQHA 1A2LA 3QFAC 3VA9A 4IW9A 3IE3A 1F37A 4RI6A 3FMWA 2L4CA 4HQZA 4N0VA 4DVCA 5IMFA 5BRTA 2NVLA 4JU5A 5C04A 3KD0A 1GUKA 4WEYA 2CZ2A 2L1LB 3CTFA 3QOUA 3ZLPA 2UZ8A 4A5PA 4OAVB 4HJ2A 2GT5A 3I6AA 1VF2A 1W89A 5G30A 2WCIA 3P7XA 4KGIA 5FT3A 5DJMA 2H70A 1WE0A 1O73A 4JR4A 1Q4JA 3Q18A 3ED3A 1X5CA 1BG5A 5IPGA 4XS6A 4NMUA 5ECSA 1SKSB 1SU9A 4HQSA 19GSA 2XTQA 1V98A 4I5QA 5DBQA 4X43A 2PU9C 20GSA 2H0IA 1PL2A 2DJ2A 2VM2A 1XOBA 3TB2A 2MZCA 2A2PA 2C1YA 2F66B 3US3A 1JLVA 1ZGNA 3TJFA 5DCHA 3GFKA 4X0XA 1K0AA 2GDRA 4EDZA 2DBCA 2CAZB 2EIQA 1N8JA 3IAM1 3Q74A 2HSMA 5CP1A 5B8BA 3ZVJA 4L8EA 2H71A 4IBPA 3ZFLA 4GWRA 5CO3A 1M9AA 4TR1B 4OFTA 1KBNA 5G5EA 1TDIA 2GSTA 1B9YC 3TUEA 1K0DA 4KX4A 4V1Ag 3L9UA 3BCKA 4BWQA 5D73A 3IXRA 4I2UA 4OO5A 2JB3A 3J7Yk 4KCAA 2N5BA 5EPFA 4EL1A 5AISA 4HDEA 3C1RA 1HD2A 3HHVA 3PR8A 4MJAA 4MCUA 3QMXA 2H6YA 10GSA 1Z7RA 1MD4A 2VLTA 4MDCA 3P2AA 2K18A 2L6CA 3GKNA 3G7YA 1TP9A 5IOWA 3L9SA 1GRXA 1U3AA 5F06A 5LNK1 4Z2UA 4TRXA 2V1CC 3A2WA 1K0MA 1BJXA 3VURA 3UMAA 3FRCA 2GVPA 4BA7A 1G6WA 2KOKA 4ID0A 3EPTA 4PL3A 3TRPA 12GSA 3F3RA 5JCWA 1GSSA 3GKXA 3F3QA 3RPNA 1KEBA 2HT9A 3UL3A 1SL0B 4WBRD 1FG4A 4WXTA 1LBKA 4HS1A 1QQ2A 4JEDA 5G1LA 2ON5A 2VLUA 5LCZA 4PNFA 2H6XA 4KW6A 2MMZA 5IM9A 3BBYA 1EWXA 4GSTA 3LJ1A 2YP6A 1M7TA 4BL7A 1XVWA 3I69A 3ZMKA 4ECCA 1U6TA 2R2JA 1RQMA 5GSSA 3UJ1A 4GXZA 2C8UA 1ERVA 1SJZA 4O5QA 2ZNMA 4MZCA 5F07A 2XPEA 2R4VA 1OC3A 4PQIA 3GTUB 4XS4A 1V58A 2C0DA 1K0OA 1MDIA 2H1BA 4MF7A 4MA9A 2EC4A 3M9KA 3VWVA 1U88A 1SJ8A 2QKEA 2JAEA 1O6JA 1QMVA 1GTAA 5AIXA 1FB6A 3VWWA 1TI3A 4PNGA 2R3XA 4PL4A 1XW6A 2L5OA 2OBKA 4MJCA 3FEUA 1R26A 4ZILA 2CVBA 1GSYA 3MDKA 5F8BA 2HZEB 2CAQA 4LA1A 3GSSA 2MMAA 2WGRA 4FQUA 2IFQA 1T7PB 3VK9A 2E2MA 2TRXA 4L5LA 1A0FA 3RPPA 2RM6A 2LQQA 3UBKA 3KH7A 3E9JB 4KAEA 5LD0A 2OJLA 3UEMA 1V40A 2VM1A 2H72A 4OD7A 4WETA 4KE3A 1E6BA 2MJFB 3FR3A 18GSA 4BPYA 5FWGA 2LS5A 1GULA 2PERA 4ZXGA 3DD3A 1V57A 1PSQA 4BVXB 4IQ1A 1RK4A 4O92A 3EINA 3DGQA 4X1UA 5J4UA 1JZOA 3HA9A 2PN8A 3C8EA 22GSA 2PGTA 4E8EA 1Z7PA 3RAZA 1G6YA 2JZRA 1TRUA 3KXOA 4GSNA 2HLSA 4Q5QA 3DKSA 2NBSA 1GSUA 2GTUA 3WD6A 4IQAA 2GS3A 4JBBA 3GX0A 2AV4A 5DAKA 3KIJA 3VPQA 2YPMA 2VO4A 5IMVA 3SBCA 2DKHA 2IMIA 3PGTA 4CW9A 4QL7A 3GKKA 5B6MA 2F6MB 2QGVA 5GAND 3IR4A 2ON7A 2FUG1 1FB0A 5DALA 1BQ7A 1FHEA 3GUSA 4O5RA 3F6FA 1R5PA 2B5YA 3AY8A 3MSZA 2FWEA 2YJHA 2LJRA 3GV1A 3IAM2 4ZBDA 2OE0A 3IHQA 2HZFA 4YAVA 1YEPA 3GRXA 1XZOA 1XWKA 2B7KA 4DSRA 4HU7A 1GLQA 8GSSA 2YV7A 2A4VA 1OC9A 5B8AA 5C00A 5AN1A 1AIUA 4BWSA 5ABRA 1F3BA 1YDKA 1I5GA 5KN0A 3UBLA 3D5JA 1NHYA 2DC5A 4OCEA 5HFKA 1TK5B 2H1AA 4PGTA 2R0CA 1XIYA 2KKMA 1GUMA 5JWRB 1X9WB 2ZRRA 4ZBAA 4O7HA 1F2EA 1TOFA 3QAGA 3FW2A 5LNKe 4HZ2A 2GSRA 4GSSA 4MH2A 3PINA 2DJ1A 2X8HA 4CDOA 1X9MB 2XBIA 4GXTA 2YCDA 3DO9A 3DRNA 1ERUA 1YO7A 3R2QA 2O8VB 2VD1A 3FZ5A 4YKGA 1GLPA 3HXSA 1TXXA 1EOHA 3ERGA 1AC1A 3E0UA 4CY8A 1TK0B 4NV2A 1FVKA 4BVYA 2JACA 1SENA 2MBTA 2L59A 4JE1A 2DSAA 2DJ3A 3FR6A 4BL7B 1URMA 2WULA 3BOAA 4KF9A 2B1KA 3ZRDA 4G19A 4ZB9A 1I9DA 3DA4A 1G7OA 1XWBA 3WGXA 4K2DA 5J3RA 1NM3A 4ZL7A 5A4VA 5G5FA 2M72A 4AJ6A 4ECBA 1VGLA 4YQVA 4KA0A 1SK0A 4DSQA 1SKRB 3H8QA 2XC2A 1JZDA 2JU5A 3CSJA 3LJ0A 1E2YA 2LJAA 5AIVA 1M99A 1C72A 2V6KA 4G0LA 4LL1B 6GSTA 1OKTA 2A2CA 4TXOB 2C0EA 2FLSA 4ZL9A 1VRSD 4HEA1 2B6MA 4K9ZA 4DSSA 1AUCA 1Z9HA 3HJMA 1EEJA 3HVSA 2IFQB 3EE2A 4QL9A 3ERFA 4O5UA 1AXDA 2R0PA 1XPVA 1W3SA 1K0BA 2JSZA 3F4MA 5D9TA 3CXGA 3K8NA 1SJIA 3VFIA 4IS0A 4F9ZA 1TK8B 2EIRA 4O1OA 2OE1A 2YZUA 3LW9A 4N0ZA 3D21A 2I4AA 4EIQA 3M1GA 1BYEA 3UIWA 3C71A 1XWCA 1ON4A 1PX7A 2LSTA 3TKQA 1XVQA 2L6DA 4PQHA 4KSMA 4MJEA 1NHOA 2GQKA 5G1KA 2PVOC 2V6OA 2C0GA 2JZSA 3DYRA 2ES7A 2RIIA 5KN3A 1G7EA 3RDWA 1DBYA 1EV4A 2VLVA 3WGDA 4K8MA 2XPDA 1YEXA 3KTBA 5GZZB 5IIZA 1B4QA 3HD5A 4F82A 1X0RA 5DQYA 3W8JA 3IBHA 3KP9A 1H75A 1MD3A 4NHZA 3LFLA 2CZ3A 4XHMA 2A2RA 1JZRA 4V2LA 3IV4A 2FY6A 1V2AA 3CTGA 2KP1A 3GYKA 3C73A 2O85A 5EL8A 4L0WA 3F63A 4YAPA 3IOSA 4FH8A 5DQSA 4Z7HA 3QFBC 1MDKA 3ZTLA 3GH6A 4K0GA 5FHIA 2F8FA 2K8SA 2VL2C 13GSA 1A0RP 3P23A 4POKA 1ERTA 5IMDA 5H5SA 5D96A 4D73B 1PQNA 1OE7A 3V1WA 3A5IA 4OAUC 3KGKA 1FVJA 4FYCA 4Q5RA 2OE3A 1Z3EA 1SJ6A 3APOA 4IKHA 4KDYA 3ZREA 2FWHA 2H30A 2OBIA 1LJRA 2REMA 1N2AA 2NDOA 4JCVE 3H1NA 3MYDA 3C1SA 4O32A 2IMEA 4EKZA 4EIPA 4YQMA 1EV9A 2FUG2 2YZHA 1PKWA 3SDJA 3EU3A 5EVOA 5HFGA 3DEXA 3KH9A 3VLNA 1R5AA 2PWJA 2VAFA 2VIMA 4WBJA 3WGEA 4AS3A 2XTRA 1AQVA 2JL4A 4TKYA 2CX3A 5J9CA 5JWOB 2DJJA 2AJQB 2J23A 2MMNA 1TW9A 4XRAA 2MMOA 2H74A 2VL9A 2CVDA 5KEJA 2E2GA 1SYXA 2WZ9A 2L57A 2MYGA 4ILFA 1ST9A 5H5RA 4HUAA 3F9UA 2G0FA 1FO5A 6GSUA 2N5AA 2YFAA 2H0HA 1MDJA 3M8NA 1XBSA 5IO0A 1X5EA 2VCXA 1QXHA 1ZYPA 2CA8A 4WF4A 1A24A 3RHCA 2I9HA 2MBSA 2AUVA 1EEMA 2VCZA 1W4VA 1JFUA 1K3LA 1J9BA 2H1GA 4J56E 2VCWA 4F03A 1ZL9A 3FYGA 4GF0A 5IPHA 1YKCA 5CREA 5IQYA 1T4ZA 2DKIA 3J7Yb 2LTKA 1YZXA 2GZPA 2YV9A 4RQXA 1TU8A 4BVYB 1ABAA 3ZFBA 2IN3A 1ACVA 4OO4A 2D2ZA 1OYJA 3DMLA 3GMFA 5CNWA 4I2TA 3TKPA 1TTZA 2P0GA 3KTLA 3DA3A 1THOA 5GAPD 3GIXA 3TJJA 2GSSA 4ZBBA 2NTOA 4HFVA 2RLIA 1T1VA 2RM5A 1NSWA 2P5RA 3MAKA 1GWCA 3ZZXA 1Y6EA 2QC7A 1XOAA 1GSFA 2E0QA 1TRWA 4PURA 4IVFA 2B1LA 4KNDA 1OE8A 3GURA 3ME7A 5IMCA 2YJ7A 1XWGA 4N11A 5IMZA 1J0FA 2P31A 2WB9A 1GSEA 2O87A 6GSXA 9GSSA 1LU4A 1K0CA 3EVIA 4PXOA 1DE2A 1BX9A 4TXVA 4DSSB 1SYRA 1M2DA 1MTCA 1O8XA 4PUFC 3M0FA 3F0IA 4Z7XA 3LG6A 4FYUA 4GLTA 4Q5FA 1IYHA 2HRKA 3KEBA 4F0BA 3BJ5A 4KSOA 1M2BA 1PN9A 1ZYNA 3GNJA 3GN3A 4V2NA 1HNBA 3GL3A 2AYTA 4HEA2 4MABA 3BCIA 2VCTA 2F51A 5F05A 1AQWA 3JSBA 2GLRA 2XHFA 1QFNA 2F3MA 2FA8A 4MJBA 2PMTA 3CRTA 3QCPA 5CRHA 4U6RA 3KZQA 4IP6A 2B5XA 2J9HA 3A2XA 3N9JA 1RW1A 1G0TA 2KHPA 4GRFA 4NAXA 3DIEA 2WS2A 2X8CA 3G9BA 1B8XA 3WYWA 3F4RA 3EYTA 5HR1A 3EMXA 2FWGA 4G9HA 1Q98A 5DVBA 1WPIA 2HFDA 2JADA 3UOMA 4MNNA 4MPGA 2H19A 4MF5A 6GSSA 4POBA 1OAZA 11GSA 4ML1A 1U5KA 4HI7A 3ZIJA 4K6XA 3TKSE 1GUHA 5KN2A 3A3TA 1B9XC 1F6MC 2H66A 2LUSA 3ISOA 4RQRA 4XS1A 4YH2A 3H93A 3HY2A 2IP6A 3LQ7A 3LWAA 3UVHA 2L5LA 2YOIA 1T8EB 2VL3A 3EMPA 2VUPA 3MIXA 4TR1A 4KH7A 4MZBA 2YFBA 2BTOT 4ISDA 1U87A 3D4MA 3AJFA 2V1MA 2FHEA 3SWLA 1PKZA 4LL4B 3FKFA 2DLXA 3KMNA 4AGSA 2V2GA 1SL1B 5J41A 2DIYA 3TKRA 3H79A 4MMMA 1A23A 3APSA 1TI1A 2I81A 1PMTA 4MH3A 2FD3A 4ECJA 4G76A 14GSA 4K5RA 1HQOA 2WFCA 1SD8A 2IIYA 1GSDA 4NV5A 3I9V1 4H86A 1USBA 1HNAA 1KTEA 4IJ3A 2YWOA 4O1PA 3HVVA 3D0ZA 4TN8A 2LRCA 3MWHA 1JHBA 3ME8A 1ZOFA 1O8WA 1Z5YE 2X8GA 4EC0A 1TU7A 2YNXA 2Z9SA 3RHBA 3UAPA 3DWVA 2OADA 4GTUA 2FA4A 5AGYA 2VOCA 1XXUA 1OVNA 3KMOA 5G31A 5DCGA 2LNTA 3A2VA 4FIWA 2QA1A 5A4UA 2HRNA 2R6KA 2IL3A 3LXTA 5ECRB 2LKUA 5IOXA 1K0NA 3DVXA 1DSBA 2B3SA 2E7PA 2KP2A 2QA2A 3HKRA 4EDYA 5HR3A 2A4HA 1GNEA 1ZMAA 2R5GA 1CQGA 1AW9A 1WOUA 3FZAA 1EP8A 3A5WA 3UARA 2JZTA 3GL5A 1H4OA 4NPBA 1M2AA 4FYBA 4PQ1A 3QAVA 4JR6A 3LXZA 5JCUA 1VF1A 3C7MA 4MLYA 1GP1A 2FGXA 1WIKA 2ALBA 5ECMB 4ZIJA 4TR4A 2X99A 5CAXA 4XS4B 1O7UA 3CSHA 2C0FA 4IGJA 1R7HA 1ML6A 4HZ4A 2VCQA 3APQA 1Z6MA 2TIRA 4K2XA 4PTSA 4LMVA 3MNGA 5ECLB 3ERWA 2C4JA 4Z7GA 2EIOA 3P90A 3HVXA 2HRAA 3VI5A 1GL8A 4OFNA 3DXBA 3TKSA 4I1TA 3IA1A 4JZQA 1SL2B 2GZZA 1ILOA 2H73A 2JB1A 3HJOA 2HE3A 2IMKA 1FOHA 1XFLA 2DMMA 3TRXA 1PX6A 5IMAA 2IPAA 5ECOB 4K1FA 1PGTA 2WJUA 1DUGA 5F0GA 4F2IA 4KUNA 4ML6A 4G75A 1WP0A 2BJXA 1A2JA 3L0IA 5HGIA 2YWIA 4YQUA 3IC8A 3QR6A 4K7NA 4Z2TA 1YJ6A 5L71A 2OKAA 4POLA 1ERWA 5KOXA 4KB3A 4EO3A 17GSA 3QPMA 4V2MA 2X64A 3L78A 3HDCA 4AJ7A 4I8BA 4ZB6A 2HSYA 3O3TA 2X49A 4BVXA 3UITA 3JCML 3WT2A 4AF2A 5ECPB 2IMFA 3KCMA 1K3OA 3IC4A 1B4PA 2HXKA 4GQCA 2OACA 1ZYEA 4KDUA 4PX1A 1AQXA 5COHA 4YKFA 4OCFA 4G2EA 4P3YB 2A2SA 2JB2A 1BEDA 2IMDA 2PVQA 5DAKB 3UVTA 4NHWA 3TGZA 1X5DA 1MEKA 4J2FA 4WF5A 1Z6NA 3VWXA 5HQPA 1M9BA 2LV3A 2GT6A 4FO5A 4EUYA 2TRCP 3IAS1 1GNWA 1AAZA 5INYA 4CHSA 1NW2A 2CAIA 1WMJA 5DALB 5A4WA 4LLRA 1XWAA 4YZCA 5D9XA 4RUVA 4AS2A 4Q5NA 1T00A 5EY6A 2P22B 2K19A 2HSHA 5CRWA 3L0HA 2CT6A 6GSWA 1SK1A 1TKDB 2CQ9A 4ZB8A 1TRVA 1ZCPA 2X4AA 2DJKA 4J57E 1OC9B 4TW5A 4IELA 5HR0A 3DVWA 2NPBA 3EURA 4E8HA 5E59A 2AB6A 3M3MA 1UN2A 1WWJA 2H6ZA 5ECKB 3M9JA 3GHAA 3I43A 1SK2A 3PH9A 4YZDA 4G0IA 4MZWA 1WJKA 4DWLA 2KLXA 1ZZYA 2O7KA 1GTBA 3FHKA 4TR0A 1GH2A 3ZIVA 2E8GA 2PBJA 5ECNB 3VI7A 4WKWA 3I9V2 4DEJA 2B5EA 3GKMA 3TKSC 4LMWA 1DE1A 5J5NA 3CYNA 4XTSA 5D8IA 4JRRA 3FBVA 2P5QA 2K9FA 1THXA 1UA5A 5ID2A 2HI7A 2M80A 2FNOA 3G7JA 1X9SB 1OKDA 1ZYQB 4CY6A 2LJKA 2AHEA 3P8WA 3O76A 4NWYA 4USSA 3FR9A 2V32A 1YQ1A 2F8AA 5J9BA 4G0KA 2LNSA 3E3EA 5HR2A 2DMLA 2JSYA 2YN1A 3KM6A 2RUFA 3HZ8A 4OWYA 3U5RE 3S9FA 4GQFA 4L5OA 3G7IA 4I97A 4NXIA 1XCCA 3QAWA 4QQ7A 3VWUA 4EVMA 4WR4A 1QGVA 4K5SA 1FW1A 2HYXA 3VPTA 2YANA 3EC3A 3PPUA 2XBQA 3KP8A 3D4TA 3LJ2A 3TDGA 3TJKA 3TOTA 3KJYA 1UC7A 5CYYA 2M46A 2WRTA 5IO2A 3TOUA 1EGOA 3U6VA 5G2ZA 2ZUPA 2V41A 3L9VA 3CSIA 3TJGA 4KCEA 3ZVJD 1JLWA 5ECIB 1JZWA 2QSIA 3D22A 2DIZA 2LRNA 3O6TA 2PUKC 3D6IA 4TXOA 4XCSA 2PPTA 4TVEA 2O89A 5DDLA 2C3QA 4AJ8A 2RUEA 2I1UA 4IP1A 7GSSA 4HJMA 4MK3A 2CX4A 1HYUA 3OR5A 5ELAA 3EU4A 5ECHB 5A5KA 1EGRA 4N10A 1F3AA 1B48A 1M0UA 4G10A 2N5FA 1GSQA 4F0CA 1O81A 5KOWA 3CRUA 4KDXA 1U3IA 3EWLA 1XW5A 1PD21 3IRAA 4XIHA 1EP7A 2H0GA 3LSZA 4GCIA 3ZYWA 4N30A 3Q8DA 4ULXA 3CBUA 2G2QA 3F8UA 4EF0A 5D9VA 2RIOA 1WRYA 3F6DA 3FZ9A 2H1DA 3LYPA 3FK8A 2LQOA 3R3EA 1T4YA 5H5QA 3FY7A 2FWFA 4TR3A 3ZITA 3IK9A 2YWNA 4POMA 4ICYA 4I6XA 5ELGA 1BAYA 2IJYA 2I3YA 2AAWA 2VCVA 4ZL8A 2GQMA 2XMXA 3CMIA 3QD9A 5ECQB 2YWMA 3RBTA 3F4TA 1FOVA 1S3AA 4RI7A 1QK8A 3WT1A 3HCZA 4X4JA 5BMUA 2H76A 1Y25A 5CRDA 2DJ0A 3TRQA 4Q9VA 4IHUA 4D73A 1IYIA 2R37A 2A2DA 1FAAA 3IAS2 5D93A 1YKAA 2F9SA 3GSTA 1YF1A 4ACSA 1HNCA 1VF4A 5HFIA 1A2MA 1SKWB 2GSQA 2V6EA 3HZ4A 3GX8A 1TRSA 4K7IA 2H75A 2IWTA 1GTIA 4OFMA 5D9WA 3LGCA 3HYPA 5CRGA 5B6NA 3FZ4A 1F9MA 1S3DA 2B7JA 2H8LA 2CV4A 3W8SA 3GH9A 1R4WA 1SD9A 2H01A 1V9WA 3LORA 3TCOA 3IPZA 1S3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDN A;  3BD2 A;  6GSV A;  4TOP A;  1O85 A;  3LEF A;  16GS A;  2WDU A;  1PRX A;  3ZML A;  2VD0 A;  2OA7 A;  1EZK A;  3NIV A;  4EE0 A;  3TJB A;  2L4Q A;  4K0N A;  4XRD A;  5DJL A;  1OC8 A;  2K8V A;  3F4S A;  1KNG A;  4PUA A;  4WR5 A;  4EXJ A;  3HJP A;  1TJD A;  1PA3 A;  4MP4 A;  3L4N A;  3NZN A;  4MF6 A;  2VL2 A;  4HOJ A;  2C3T A;  5ID2 B;  4L0U A;  1XW9 A;  2GQL A;  5E4W A;  1A8L A;  3NOF A;  3IDV A;  2FCH A;  2LRT A;  2GGT A;  4IJI A;  2HRF A;  4IN0 A;  5JWQ B;  4OMV A;  2HNL A;  4HU9 A;  1YY7 A;  2C80 A;  1UVZ A;  4K7O A;  2C3N A;  5ENU A;  1A8Y A;  2ZCT A;  3LYK A;  4MPF A;  5KN1 A;  2KUC A;  1GTU A;  3ZL5 A;  1QUW A;  2LEG A;  3GTU A;  5JCG A;  4V1A p;  4ECI A;  5B7C A;  3Q19 A;  1PL1 A;  1YF0 A;  2GZY A;  3LJR A;  1T3B A;  2BMX A;  3GA4 A;  3W6G A;  6GSY A;  1K3Y A;  3H4K A;  3N5O A;  3IK7 A;  1VF3 A;  3Q6O A;  2CVK A;  2HZE A;  1J08 A;  2K6V A;  5GST A;  1EOG A;  1CQH A;  1A2L A;  3QFA C;  4IW9 A;  3IE3 A;  1F37 A;  4RI6 A;  2L4C A;  4HQZ A;  4N0V A;  4DVC A;  5IMF A;  2NVL A;  4JU5 A;  5C04 A;  3KD0 A;  1GUK A;  4WEY A;  2CZ2 A;  3CTF A;  3QOU A;  3ZLP A;  4HJ2 A;  2GT5 A;  3I6A A;  1VF2 A;  1W89 A;  5G30 A;  2WCI A;  3P7X A;  4KGI A;  5FT3 A;  5DJM A;  2H70 A;  1WE0 A;  1O73 A;  4JR4 A;  1Q4J A;  3Q18 A;  3ED3 A;  1X5C A;  1BG5 A;  5IPG A;  4XS6 A;  4NMU A;  5ECS A;  1SKS B;  1SU9 A;  4HQS A;  19GS A;  1V98 A;  4I5Q A;  5DBQ A;  4X43 A;  2PU9 C;  20GS A;  2H0I A;  1PL2 A;  2DJ2 A;  2VM2 A;  1XOB A;  3TB2 A;  2MZC A;  2C1Y A;  3US3 A;  1JLV A;  1ZGN A;  3TJF A;  5DCH A;  3GFK A;  4X0X A;  1K0A A;  2GDR A;  4EDZ A;  2DBC A;  2EIQ A;  1N8J A;  3Q74 A;  5CP1 A;  5B8B A;  3ZVJ A;  4L8E A;  2H71 A;  4IBP A;  3ZFL A;  4GWR A;  5CO3 A;  1M9A A;  4TR1 B;  4OFT A;  1KBN A;  5G5E A;  1TDI A;  2GST A;  1B9Y C;  3TUE A;  1K0D A;  4KX4 A;  4V1A g;  3L9U A;  3BCK A;  4BWQ A;  5D73 A;  3IXR A;  4I2U A;  4OO5 A;  3J7Y k;  4KCA A;  5EPF A;  2N5B A;  4EL1 A;  5AIS A;  4HDE A;  3C1R A;  1HD2 A;  3HHV A;  3PR8 A;  4MJA A;  4MCU A;  3QMX A;  2H6Y A;  10GS A;  1Z7R A;  1MD4 A;  2VLT A;  4MDC A;  3P2A A;  2K18 A;  2L6C A;  3GKN A;  3G7Y A;  1TP9 A;  5IOW A;  3L9S A;  1GRX A;  1U3A A;  5F06 A;  4TRX A;  3A2W A;  1K0M A;  1BJX A;  3VUR A;  3UMA A;  3FRC A;  2GVP A;  4BA7 A;  1G6W A;  2KOK A;  4ID0 A;  3TRP A;  12GS A;  3F3R A;  5JCW A;  1GSS A;  3GKX A;  3F3Q A;  3RPN A;  1KEB A;  2HT9 A;  3UL3 A;  1SL0 B;  4WBR D;  1FG4 A;  4WXT A;  1LBK A;  4HS1 A;  1QQ2 A;  4JED A;  5G1L A;  2ON5 A;  2VLU A;  5LCZ A;  4PNF A;  2H6X A;  4KW6 A;  2MMZ A;  5IM9 A;  3BBY A;  1EWX A;  4GST A;  2YP6 A;  1M7T A;  4BL7 A;  1XVW A;  3I69 A;  3ZMK A;  4ECC A;  1U6T A;  2R2J A;  1RQM A;  5GSS A;  3UJ1 A;  4GXZ A;  2C8U A;  1ERV A;  1SJZ A;  2ZNM A;  4MZC A;  5F07 A;  2XPE A;  2R4V A;  1OC3 A;  4PQI A;  3GTU B;  4XS4 A;  1V58 A;  2C0D A;  1K0O A;  1MDI A;  2H1B A;  4MF7 A;  4MA9 A;  2EC4 A;  3M9K A;  3VWV A;  1U88 A;  2QKE A;  1O6J A;  1QMV A;  1GTA A;  5AIX A;  1FB6 A;  3VWW A;  1TI3 A;  4PNG A;  2R3X A;  1XW6 A;  2L5O A;  2OBK A;  4MJC A;  3FEU A;  1R26 A;  4ZIL A;  2CVB A;  1GSY A;  3MDK A;  5F8B A;  2HZE B;  2CAQ A;  4LA1 A;  3GSS A;  2MMA A;  2WGR A;  2IFQ A;  1T7P B;  3VK9 A;  2E2M A;  2TRX A;  4L5L A;  1A0F A;  3RPP A;  2RM6 A;  2LQQ A;  3UBK A;  3KH7 A;  3E9J B;  4KAE A;  5LD0 A;  2OJL A;  3UEM A;  1V40 A;  2VM1 A;  2H72 A;  4OD7 A;  4WET A;  4KE3 A;  1E6B A;  3FR3 A;  18GS A;  4BPY A;  5FWG A;  2LS5 A;  1GUL A;  2PER A;  4ZXG A;  3DD3 A;  1V57 A;  1PSQ A;  4IQ1 A;  1RK4 A;  4O92 A;  3EIN A;  3DGQ A;  4X1U A;  5J4U A;  1JZO A;  3HA9 A;  2PN8 A;  3C8E A;  22GS A;  2PGT A;  4E8E A;  1Z7P A;  3RAZ A;  1G6Y A;  2JZR A;  1TRU A;  3KXO A;  4GSN A;  2HLS A;  4Q5Q A;  3DKS A;  2NBS A;  1GSU A;  2GTU A;  3WD6 A;  4IQA A;  2GS3 A;  4JBB A;  3GX0 A;  2AV4 A;  5DAK A;  3KIJ A;  3VPQ A;  2YPM A;  2VO4 A;  5IMV A;  3SBC A;  2IMI A;  3PGT A;  4CW9 A;  4QL7 A;  3GKK A;  5B6M A;  2QGV A;  5GAN D;  3IR4 A;  2ON7 A;  1FB0 A;  5DAL A;  1BQ7 A;  1FHE A;  3GUS A;  4O5R A;  3F6F A;  1R5P A;  2B5Y A;  3AY8 A;  3MSZ A;  2FWE A;  2YJH A;  2LJR A;  3GV1 A;  3IAM 2;  4ZBD A;  2OE0 A;  3IHQ A;  2HZF A;  4YAV A;  1YEP A;  3GRX A;  1XZO A;  1XWK A;  2B7K A;  4DSR A;  4HU7 A;  1GLQ A;  8GSS A;  2YV7 A;  2A4V A;  1OC9 A;  5B8A A;  5C00 A;  5AN1 A;  1AIU A;  4BWS A;  5ABR A;  1F3B A;  1YDK A;  1I5G A;  5KN0 A;  3UBL A;  3D5J A;  1NHY A;  2DC5 A;  4OCE A;  5HFK A;  1TK5 B;  2H1A A;  4PGT A;  1XIY A;  1GUM A;  5JWR B;  1X9W B;  4ZBA A;  4O7H A;  1F2E A;  1TOF A;  3QAG A;  3FW2 A;  5LNK e;  4HZ2 A;  2GSR A;  4GSS A;  4MH2 A;  3PIN A;  2DJ1 A;  2X8H A;  4CDO A;  1X9M B;  2XBI A;  2YCD A;  3DRN A;  1ERU A;  3R2Q A;  2O8V B;  2VD1 A;  3FZ5 A;  1GLP A;  3HXS A;  1TXX A;  1EOH A;  3ERG A;  1AC1 A;  3E0U A;  1TK0 B;  4NV2 A;  1FVK A;  4BVY A;  2JAC A;  1SEN A;  2MBT A;  2L59 A;  4JE1 A;  2DSA A;  2DJ3 A;  3FR6 A;  1URM A;  2WUL A;  3BOA A;  2B1K A;  3ZRD A;  4G19 A;  4ZB9 A;  1I9D A;  1G7O A;  1XWB A;  3WGX A;  4K2D A;  5J3R A;  1NM3 A;  4ZL7 A;  5A4V A;  5G5F A;  2M72 A;  4AJ6 A;  4ECB A;  1VGL A;  4YQV A;  4KA0 A;  1SK0 A;  4DSQ A;  1SKR B;  3H8Q A;  2XC2 A;  1JZD A;  2JU5 A;  3CSJ A;  1E2Y A;  2LJA A;  5AIV A;  1M99 A;  1C72 A;  2V6K A;  4LL1 B;  6GST A;  1OKT A;  4TXO B;  2C0E A;  2FLS A;  4ZL9 A;  1VRS D;  2B6M A;  4K9Z A;  4DSS A;  1AUC A;  1Z9H A;  3HJM A;  1EEJ A;  3HVS A;  2IFQ B;  3EE2 A;  4QL9 A;  3ERF A;  1AXD A;  1XPV A;  1K0B A;  2JSZ A;  5D9T A;  3CXG A;  3K8N A;  1SJI A;  3VFI A;  4IS0 A;  4F9Z A;  1TK8 B;  2EIR A;  2OE1 A;  2YZU A;  4N0Z A;  3D21 A;  2I4A A;  3M1G A;  1BYE A;  3UIW A;  3C71 A;  1XWC A;  1ON4 A;  1PX7 A;  2LST A;  3TKQ A;  1XVQ A;  2L6D A;  4PQH A;  4KSM A;  4MJE A;  1NHO A;  2GQK A;  5G1K A;  2PVO C;  2V6O A;  2C0G A;  2JZS A;  3DYR A;  2ES7 A;  2RII A;  5KN3 A;  1G7E A;  3RDW A;  1DBY A;  1EV4 A;  2VLV A;  3WGD A;  4K8M A;  2XPD A;  1YEX A;  3KTB A;  5GZZ B;  5IIZ A;  1B4Q A;  3HD5 A;  4F82 A;  1X0R A;  5DQY A;  3W8J A;  3IBH A;  3KP9 A;  1H75 A;  1MD3 A;  4NHZ A;  3LFL A;  2CZ3 A;  4XHM A;  2A2R A;  1JZR A;  4V2L A;  3IV4 A;  2FY6 A;  1V2A A;  3CTG A;  2KP1 A;  3GYK A;  3C73 A;  2O85 A;  5EL8 A;  4L0W A;  3F63 A;  4YAP A;  3IOS A;  4FH8 A;  5DQS A;  3QFB C;  1MDK A;  3ZTL A;  3GH6 A;  4K0G A;  5FHI A;  2F8F A;  2K8S A;  2VL2 C;  13GS A;  1A0R P;  4POK A;  1ERT A;  5IMD A;  5H5S A;  5D96 A;  4D73 B;  1PQN A;  1OE7 A;  3V1W A;  3KGK A;  1FVJ A;  4FYC A;  4Q5R A;  2OE3 A;  1Z3E A;  1SJ6 A;  3APO A;  4IKH A;  4KDY A;  3ZRE A;  2FWH A;  2H30 A;  2OBI A;  1LJR A;  2REM A;  1N2A A;  2NDO A;  3H1N A;  3C1S A;  4O32 A;  2IME A;  4EKZ A;  4YQM A;  1EV9 A;  2FUG 2;  2YZH A;  1PKW A;  3EU3 A;  5EVO A;  5HFG A;  3DEX A;  3KH9 A;  3VLN A;  1R5A A;  2PWJ A;  2VAF A;  2VIM A;  4WBJ A;  3WGE A;  1AQV A;  2JL4 A;  4TKY A;  2CX3 A;  5J9C A;  5JWO B;  2DJJ A;  2AJQ B;  2J23 A;  2MMN A;  1TW9 A;  4XRA A;  2MMO A;  2H74 A;  2VL9 A;  2CVD A;  5KEJ A;  2E2G A;  1SYX A;  2WZ9 A;  2L57 A;  2MYG A;  4ILF A;  1ST9 A;  5H5R A;  4HUA A;  3F9U A;  2G0F A;  1FO5 A;  6GSU A;  2N5A A;  2H0H A;  1MDJ A;  3M8N A;  1XBS A;  5IO0 A;  1X5E A;  2VCX A;  1QXH A;  2CA8 A;  4WF4 A;  1A24 A;  3RHC A;  2I9H A;  2MBS A;  2AUV A;  1EEM A;  2VCZ A;  1W4V A;  1JFU A;  1K3L A;  1J9B A;  2H1G A;  4J56 E;  2VCW A;  4F03 A;  1ZL9 A;  3FYG A;  4GF0 A;  5IPH A;  1YKC A;  5CRE A;  5IQY A;  1T4Z A;  3J7Y b;  2LTK A;  1YZX A;  2GZP A;  2YV9 A;  4RQX A;  1TU8 A;  1ABA A;  3ZFB A;  2IN3 A;  1ACV A;  4OO4 A;  2D2Z A;  1OYJ A;  3DML A;  3GMF A;  5CNW A;  4I2T A;  3TKP A;  1TTZ A;  2P0G A;  3KTL A;  1THO A;  5GAP D;  3GIX A;  3TJJ A;  2GSS A;  4ZBB A;  2NTO A;  2RLI A;  1T1V A;  2RM5 A;  1NSW A;  2P5R A;  3MAK A;  1GWC A;  3ZZX A;  1Y6E A;  2QC7 A;  1XOA A;  1GSF A;  2E0Q A;  1TRW A;  4PUR A;  4IVF A;  2B1L A;  4KND A;  1OE8 A;  3GUR A;  3ME7 A;  5IMC A;  2YJ7 A;  1XWG A;  4N11 A;  5IMZ A;  1J0F A;  2P31 A;  2WB9 A;  1GSE A;  2O87 A;  6GSX A;  9GSS A;  1LU4 A;  1K0C A;  3EVI A;  4PXO A;  1DE2 A;  1BX9 A;  4TXV A;  4DSS B;  1SYR A;  1M2D A;  1MTC A;  1O8X A;  4PUF C;  3M0F A;  3F0I A;  4Z7X A;  3LG6 A;  4FYU A;  4GLT A;  4Q5F A;  1IYH A;  3KEB A;  4F0B A;  3BJ5 A;  4KSO A;  1M2B A;  1PN9 A;  3GNJ A;  3GN3 A;  4V2N A;  1HNB A;  3GL3 A;  2AYT A;  4HEA 2;  4MAB A;  3BCI A;  2VCT A;  2F51 A;  5F05 A;  1AQW A;  2GLR A;  2XHF A;  1QFN A;  2F3M A;  2FA8 A;  4MJB A;  2PMT A;  3CRT A;  3QCP A;  5CRH A;  3KZQ A;  4IP6 A;  2B5X A;  2J9H A;  3A2X A;  3N9J A;  1RW1 A;  1G0T A;  2KHP A;  4GRF A;  4NAX A;  3DIE A;  2WS2 A;  2X8C A;  3G9B A;  1B8X A;  3WYW A;  3F4R A;  3EYT A;  5HR1 A;  3EMX A;  2FWG A;  4G9H A;  1Q98 A;  5DVB A;  1WPI A;  2HFD A;  2JAD A;  3UOM A;  4MPG A;  2H19 A;  4MF5 A;  6GSS A;  4POB A;  1OAZ A;  11GS A;  4ML1 A;  4HI7 A;  3ZIJ A;  4K6X A;  3TKS E;  1GUH A;  5KN2 A;  3A3T A;  1B9X C;  1F6M C;  2H66 A;  2LUS A;  3ISO A;  4RQR A;  4XS1 A;  4YH2 A;  3H93 A;  3HY2 A;  3LQ7 A;  3LWA A;  3UVH A;  2L5L A;  2YOI A;  1T8E B;  2VL3 A;  3EMP A;  2VUP A;  4TR1 A;  4KH7 A;  4MZB A;  2BTO T;  4ISD A;  1U87 A;  3D4M A;  2V1M A;  2FHE A;  3SWL A;  1PKZ A;  4LL4 B;  3FKF A;  2DLX A;  3KMN A;  4AGS A;  2V2G A;  1SL1 B;  5J41 A;  2DIY A;  3TKR A;  3H79 A;  4MMM A;  1A23 A;  3APS A;  1TI1 A;  2I81 A;  1PMT A;  4MH3 A;  2FD3 A;  4ECJ A;  14GS A;  1HQO A;  2WFC A;  1SD8 A;  2IIY A;  1GSD A;  4NV5 A;  4H86 A;  1USB A;  1HNA A;  1KTE A;  4IJ3 A;  2YWO A;  3HVV A;  3D0Z A;  4TN8 A;  2LRC A;  3MWH A;  1JHB A;  3ME8 A;  1ZOF A;  1O8W A;  1Z5Y E;  2X8G A;  4EC0 A;  1TU7 A;  2YNX A;  2Z9S A;  3RHB A;  3UAP A;  3DWV A;  2OAD A;  4GTU A;  2FA4 A;  5AGY A;  2VOC A;  1XXU A;  1OVN A;  3KMO A;  5G31 A;  5DCG A;  2LNT A;  3A2V A;  4FIW A;  5A4U A;  2HRN A;  2R6K A;  2IL3 A;  3LXT A;  5ECR B;  2LKU A;  5IOX A;  1K0N A;  3DVX A;  1DSB A;  2B3S A;  2E7P A;  2KP2 A;  3HKR A;  4EDY A;  5HR3 A;  1GNE A;  1ZMA A;  2R5G A;  1CQG A;  1AW9 A;  1WOU A;  3FZA A;  1EP8 A;  3A5W A;  3UAR A;  2JZT A;  3GL5 A;  1H4O A;  4NPB A;  1M2A A;  4FYB A;  4PQ1 A;  3QAV A;  4JR6 A;  3LXZ A;  5JCU A;  1VF1 A;  3C7M A;  4MLY A;  1GP1 A;  2FGX A;  1WIK A;  2ALB A;  5ECM B;  4ZIJ A;  4TR4 A;  2X99 A;  5CAX A;  4XS4 B;  1O7U A;  3CSH A;  2C0F A;  4IGJ A;  1R7H A;  1ML6 A;  4HZ4 A;  2VCQ A;  3APQ A;  1Z6M A;  2TIR A;  4LMV A;  3MNG A;  5ECL B;  3ERW A;  2C4J A;  2EIO A;  3P90 A;  3HVX A;  3VI5 A;  1GL8 A;  4OFN A;  3DXB A;  3TKS A;  3IA1 A;  4JZQ A;  1SL2 B;  2GZZ A;  1ILO A;  2H73 A;  3HJO A;  2HE3 A;  2IMK A;  1XFL A;  2DMM A;  3TRX A;  1PX6 A;  5IMA A;  2IPA A;  5ECO B;  4K1F A;  1PGT A;  2WJU A;  1DUG A;  5F0G A;  4F2I A;  4KUN A;  4ML6 A;  1WP0 A;  2BJX A;  1A2J A;  2YWI A;  4YQU A;  3QR6 A;  4K7N A;  1YJ6 A;  5L71 A;  2OKA A;  4POL A;  1ERW A;  4KB3 A;  4EO3 A;  17GS A;  3QPM A;  4V2M A;  2X64 A;  3L78 A;  3HDC A;  4AJ7 A;  4I8B A;  4ZB6 A;  2HSY A;  3O3T A;  4BVX A;  3JCM L;  3WT2 A;  4AF2 A;  5ECP B;  2IMF A;  3KCM A;  1K3O A;  3IC4 A;  1B4P A;  2HXK A;  4GQC A;  2OAC A;  1ZYE A;  4KDU A;  4PX1 A;  1AQX A;  5COH A;  4OCF A;  4G2E A;  4P3Y B;  2A2S A;  1BED A;  2IMD A;  2PVQ A;  5DAK B;  3UVT A;  4NHW A;  3TGZ A;  1X5D A;  1MEK A;  4J2F A;  4WF5 A;  1Z6N A;  3VWX A;  5HQP A;  1M9B A;  2LV3 A;  2GT6 A;  4FO5 A;  4EUY A;  2TRC P;  1GNW A;  1AAZ A;  5INY A;  4CHS A;  1NW2 A;  2CAI A;  1WMJ A;  5DAL B;  5A4W A;  4LLR A;  1XWA A;  5D9X A;  4RUV A;  4Q5N A;  1T00 A;  5EY6 A;  2HSH A;  5CRW A;  3L0H A;  2CT6 A;  6GSW A;  1SK1 A;  1TKD B;  2CQ9 A;  4ZB8 A;  1TRV A;  1ZCP A;  2DJK A;  4J57 E;  1OC9 B;  4TW5 A;  4IEL A;  5HR0 A;  3DVW A;  2NPB A;  3EUR A;  4E8H A;  5E59 A;  2AB6 A;  3M3M A;  1UN2 A;  1WWJ A;  2H6Z A;  5ECK B;  3M9J A;  3GHA A;  3I43 A;  1SK2 A;  3PH9 A;  4MZW A;  1WJK A;  2KLX A;  1ZZY A;  2O7K A;  1GTB A;  3FHK A;  4TR0 A;  1GH2 A;  3ZIV A;  2PBJ A;  5ECN B;  3VI7 A;  4WKW A;  3I9V 2;  4DEJ A;  2B5E A;  3GKM A;  3TKS C;  4LMW A;  1DE1 A;  5J5N A;  3CYN A;  4XTS A;  5D8I A;  4JRR A;  2P5Q A;  2K9F A;  1THX A;  1UA5 A;  5ID2 A;  2HI7 A;  2M80 A;  2FNO A;  3G7J A;  1X9S B;  1OKD A;  1ZYQ B;  2LJK A;  2AHE A;  3P8W A;  3O76 A;  4NWY A;  3FR9 A;  2V32 A;  1YQ1 A;  2F8A A;  5J9B A;  2LNS A;  3E3E A;  5HR2 A;  2DML A;  2JSY A;  2YN1 A;  3KM6 A;  2RUF A;  3HZ8 A;  4OWY A;  3U5R E;  3S9F A;  4GQF A;  4L5O A;  3G7I A;  4I97 A;  4NXI A;  1XCC A;  3QAW A;  4QQ7 A;  3VWU A;  4EVM A;  4WR4 A;  1QGV A;  1FW1 A;  2HYX A;  3VPT A;  2YAN A;  3EC3 A;  2XBQ A;  3KP8 A;  3D4T A;  3TDG A;  3TJK A;  3TOT A;  3KJY A;  1UC7 A;  5CYY A;  2M46 A;  2WRT A;  5IO2 A;  3TOU A;  1EGO A;  3U6V A;  5G2Z A;  2ZUP A;  2V41 A;  3L9V A;  3CSI A;  3TJG A;  4KCE A;  3ZVJ D;  1JLW A;  5ECI B;  1JZW A;  2QSI A;  3D22 A;  2DIZ A;  2LRN A;  3O6T A;  2PUK C;  3D6I A;  4TXO A;  4XCS A;  2PPT A;  4TVE A;  2O89 A;  5DDL A;  2C3Q A;  4AJ8 A;  2RUE A;  2I1U A;  4IP1 A;  7GSS A;  4HJM A;  4MK3 A;  2CX4 A;  1HYU A;  3OR5 A;  5ELA A;  3EU4 A;  5ECH B;  5A5K A;  1EGR A;  4N10 A;  1F3A A;  1B48 A;  1M0U A;  4G10 A;  2N5F A;  1GSQ A;  4F0C A;  1O81 A;  3CRU A;  4KDX A;  1U3I A;  3EWL A;  1XW5 A;  1PD2 1;  3IRA A;  4XIH A;  1EP7 A;  2H0G A;  3LSZ A;  4GCI A;  3ZYW A;  4N30 A;  4ULX A;  3CBU A;  2G2Q A;  3F8U A;  4EF0 A;  5D9V A;  1WRY A;  3F6D A;  3FZ9 A;  2H1D A;  3LYP A;  3FK8 A;  2LQO A;  1T4Y A;  5H5Q A;  3FY7 A;  2FWF A;  4TR3 A;  3ZIT A;  3IK9 A;  2YWN A;  4POM A;  4I6X A;  5ELG A;  1BAY A;  2IJY A;  2I3Y A;  2AAW A;  2VCV A;  4ZL8 A;  2GQM A;  3CMI A;  3QD9 A;  5ECQ B;  2YWM A;  3RBT A;  3F4T A;  1FOV A;  1S3A A;  4RI7 A;  1QK8 A;  3WT1 A;  3HCZ A;  2H76 A;  1Y25 A;  5CRD A;  2DJ0 A;  3TRQ A;  4IHU A;  4D73 A;  1IYI A;  2R37 A;  1FAA A;  3IAS 2;  5D93 A;  1YKA A;  2F9S A;  3GST A;  1YF1 A;  4ACS A;  1HNC A;  1VF4 A;  5HFI A;  1A2M A;  1SKW B;  2GSQ A;  3HZ4 A;  3GX8 A;  1TRS A;  4K7I A;  2H75 A;  2IWT A;  1GTI A;  4OFM A;  5D9W A;  3LGC A;  3HYP A;  5CRG A;  5B6N A;  3FZ4 A;  1F9M A;  1S3D A;  2B7J A;  2H8L A;  2CV4 A;  3W8S A;  3GH9 A;  1R4W A;  1SD9 A;  2H01 A;  1V9W A;  3LOR A;  3TCO A;  3IPZ A;  1S3C A; 
#chains in the Genus database with same CATH topology
 3QDN A;  3BD2 A;  6GSV A;  4TOP A;  1O85 A;  3LEF A;  16GS A;  2WDU A;  2GSC A;  1PRX A;  3ZML A;  2VD0 A;  2OA7 A;  1EZK A;  4Z2R A;  3NIV A;  4EE0 A;  3TJB A;  2L4Q A;  4K0N A;  4XRD A;  5DJL A;  1OC8 A;  2K8V A;  4YZ9 A;  3F4S A;  1KNG A;  3IHG A;  4PUA A;  4WR5 A;  4EXJ A;  3HJP A;  1TJD A;  1PA3 A;  4MP4 A;  3L4N A;  3NZN A;  4MF6 A;  2VL2 A;  4HOJ A;  2C3T A;  1PN0 A;  5ID2 B;  4L0U A;  1XW9 A;  2GQL A;  5E4W A;  1A8L A;  3NOF A;  3IDV A;  2FCH A;  2LRT A;  1M3I A;  2GGT A;  4IJI A;  2HRF A;  4IN0 A;  5JWQ B;  4OMV A;  2HNL A;  4HU9 A;  1YY7 A;  2C80 A;  1UVZ A;  4K7O A;  2C3N A;  5ENU A;  1A8Y A;  2ZCT A;  3LYK A;  4PL5 A;  4MPF A;  5KN1 A;  2KUC A;  1GTU A;  3ZL5 A;  1QUW A;  2LEG A;  3GTU A;  5JCG A;  4V1A p;  4ECI A;  2R0G A;  5B7C A;  3Q19 A;  1PL1 A;  1YF0 A;  2GZY A;  3LJR A;  1JQO A;  1T3B A;  2BMX A;  3GA4 A;  3W6G A;  6GSY A;  1K3Y A;  3H4K A;  3N5O A;  3IK7 A;  1VF3 A;  3Q6O A;  2CVK A;  2HZE A;  1J08 A;  2K6V A;  5GST A;  1EOG A;  1CQH A;  1A2L A;  3QFA C;  3VA9 A;  4IW9 A;  3IE3 A;  1F37 A;  4RI6 A;  3FMW A;  2L4C A;  4HQZ A;  4N0V A;  4DVC A;  5IMF A;  5BRT A;  2NVL A;  4JU5 A;  5C04 A;  3KD0 A;  1GUK A;  4WEY A;  2CZ2 A;  2L1L B;  3CTF A;  3QOU A;  3ZLP A;  2UZ8 A;  4A5P A;  4OAV B;  4HJ2 A;  2GT5 A;  3I6A A;  1VF2 A;  1W89 A;  5G30 A;  2WCI A;  3P7X A;  4KGI A;  5FT3 A;  5DJM A;  2H70 A;  1WE0 A;  1O73 A;  4JR4 A;  1Q4J A;  3Q18 A;  3ED3 A;  1X5C A;  1BG5 A;  5IPG A;  4XS6 A;  4NMU A;  5ECS A;  1SKS B;  1SU9 A;  4HQS A;  19GS A;  2XTQ A;  1V98 A;  4I5Q A;  5DBQ A;  4X43 A;  2PU9 C;  20GS A;  2H0I A;  1PL2 A;  2DJ2 A;  2VM2 A;  1XOB A;  3TB2 A;  2MZC A;  2A2P A;  2C1Y A;  2F66 B;  3US3 A;  1JLV A;  1ZGN A;  3TJF A;  5DCH A;  3GFK A;  4X0X A;  1K0A A;  2GDR A;  4EDZ A;  2DBC A;  2CAZ B;  2EIQ A;  1N8J A;  3IAM 1;  3Q74 A;  2HSM A;  5CP1 A;  5B8B A;  3ZVJ A;  4L8E A;  2H71 A;  4IBP A;  3ZFL A;  4GWR A;  5CO3 A;  1M9A A;  4TR1 B;  4OFT A;  1KBN A;  5G5E A;  1TDI A;  2GST A;  1B9Y C;  3TUE A;  1K0D A;  4KX4 A;  4V1A g;  3L9U A;  3BCK A;  4BWQ A;  5D73 A;  3IXR A;  4I2U A;  4OO5 A;  2JB3 A;  3J7Y k;  4KCA A;  2N5B A;  5EPF A;  4EL1 A;  5AIS A;  4HDE A;  3C1R A;  1HD2 A;  3HHV A;  3PR8 A;  4MJA A;  4MCU A;  3QMX A;  2H6Y A;  10GS A;  1Z7R A;  1MD4 A;  2VLT A;  4MDC A;  3P2A A;  2K18 A;  2L6C A;  3GKN A;  3G7Y A;  1TP9 A;  5IOW A;  3L9S A;  1GRX A;  1U3A A;  5F06 A;  2BL7 A;  5LNK 1;  4Z2U A;  4TRX A;  2V1C C;  3A2W A;  1K0M A;  1BJX A;  3VUR A;  3UMA A;  3FRC A;  2GVP A;  4BA7 A;  1G6W A;  2KOK A;  4ID0 A;  3EPT A;  4PL3 A;  3TRP A;  12GS A;  3F3R A;  5JCW A;  1GSS A;  3GKX A;  3F3Q A;  3RPN A;  1KEB A;  2HT9 A;  3UL3 A;  1SL0 B;  4WBR D;  1FG4 A;  4WXT A;  1LBK A;  4HS1 A;  1QQ2 A;  4JED A;  5G1L A;  2ON5 A;  2VLU A;  5LCZ A;  4PNF A;  2H6X A;  4KW6 A;  2MMZ A;  5IM9 A;  3BBY A;  1EWX A;  4GST A;  3LJ1 A;  2YP6 A;  1M7T A;  4BL7 A;  1XVW A;  3I69 A;  3ZMK A;  4ECC A;  1U6T A;  2R2J A;  1RQM A;  5GSS A;  3UJ1 A;  4GXZ A;  2C8U A;  1ERV A;  1SJZ A;  4O5Q A;  2ZNM A;  4MZC A;  5F07 A;  2XPE A;  2R4V A;  1OC3 A;  4PQI A;  3GTU B;  4XS4 A;  1V58 A;  2C0D A;  1K0O A;  1MDI A;  2H1B A;  4MF7 A;  4MA9 A;  2EC4 A;  3M9K A;  3VWV A;  1U88 A;  1SJ8 A;  2QKE A;  2JAE A;  1O6J A;  1QMV A;  1GTA A;  5AIX A;  1FB6 A;  3VWW A;  1TI3 A;  4PNG A;  2R3X A;  4PL4 A;  1XW6 A;  2L5O A;  2OBK A;  4MJC A;  3FEU A;  1R26 A;  4ZIL A;  2CVB A;  1GSY A;  3MDK A;  5F8B A;  2HZE B;  2CAQ A;  4LA1 A;  3GSS A;  2MMA A;  2WGR A;  4FQU A;  2IFQ A;  1T7P B;  3VK9 A;  2E2M A;  2TRX A;  4L5L A;  1A0F A;  3RPP A;  2RM6 A;  2LQQ A;  3UBK A;  3KH7 A;  3E9J B;  4KAE A;  5LD0 A;  2OJL A;  3UEM A;  1V40 A;  2VM1 A;  2H72 A;  4OD7 A;  4WET A;  4KE3 A;  1E6B A;  2MJF B;  3FR3 A;  18GS A;  4BPY A;  5FWG A;  2LS5 A;  1GUL A;  2PER A;  4ZXG A;  3DD3 A;  1V57 A;  1PSQ A;  4BVX B;  4IQ1 A;  1RK4 A;  4O92 A;  3EIN A;  3DGQ A;  4X1U A;  5J4U A;  1JZO A;  3HA9 A;  2PN8 A;  3C8E A;  22GS A;  2PGT A;  4E8E A;  1Z7P A;  3RAZ A;  1G6Y A;  2JZR A;  1TRU A;  3KXO A;  4GSN A;  2HLS A;  4Q5Q A;  3DKS A;  2NBS A;  1GSU A;  2GTU A;  3WD6 A;  4IQA A;  2GS3 A;  4JBB A;  3GX0 A;  2AV4 A;  5DAK A;  3KIJ A;  3VPQ A;  2YPM A;  2VO4 A;  5IMV A;  3SBC A;  2DKH A;  2IMI A;  3PGT A;  4CW9 A;  4QL7 A;  3GKK A;  5B6M A;  2F6M B;  2QGV A;  5GAN D;  3IR4 A;  2ON7 A;  2FUG 1;  1FB0 A;  5DAL A;  1BQ7 A;  1FHE A;  3GUS A;  4O5R A;  3F6F A;  1R5P A;  2B5Y A;  3AY8 A;  3MSZ A;  2FWE A;  2YJH A;  2LJR A;  3GV1 A;  3IAM 2;  4ZBD A;  2OE0 A;  3IHQ A;  2HZF A;  4YAV A;  1YEP A;  3GRX A;  1XZO A;  1XWK A;  2B7K A;  4DSR A;  4HU7 A;  1GLQ A;  8GSS A;  2YV7 A;  2A4V A;  1OC9 A;  5B8A A;  5C00 A;  5AN1 A;  1AIU A;  4BWS A;  5ABR A;  1F3B A;  1YDK A;  1I5G A;  5KN0 A;  3UBL A;  3D5J A;  1NHY A;  2DC5 A;  4OCE A;  5HFK A;  1TK5 B;  2H1A A;  4PGT A;  2R0C A;  1XIY A;  2KKM A;  1GUM A;  5JWR B;  1X9W B;  2ZRR A;  4ZBA A;  4O7H A;  2QSB A;  1F2E A;  1M3J A;  1TOF A;  3QAG A;  3FW2 A;  5LNK e;  4HZ2 A;  2GSR A;  4GSS A;  4MH2 A;  3PIN A;  2DJ1 A;  2X8H A;  4CDO A;  1X9M B;  2XBI A;  4GXT A;  2YCD A;  3DO9 A;  3DRN A;  1ERU A;  1YO7 A;  3R2Q A;  2O8V B;  2VD1 A;  3CQF A;  3FZ5 A;  4YKG A;  1GLP A;  3HXS A;  1TXX A;  1EOH A;  3ERG A;  1AC1 A;  3E0U A;  4CY8 A;  1TK0 B;  4NV2 A;  1FVK A;  4BVY A;  2JAC A;  1SEN A;  2MBT A;  2L59 A;  4JE1 A;  2DSA A;  2DJ3 A;  3FR6 A;  4BL7 B;  1URM A;  2WUL A;  3BOA A;  4KF9 A;  2B1K A;  3ZRD A;  4G19 A;  4ZB9 A;  1I9D A;  3DA4 A;  1G7O A;  1XWB A;  3WGX A;  4K2D A;  5J3R A;  1NM3 A;  4ZL7 A;  5A4V A;  5G5F A;  2M72 A;  4AJ6 A;  4ECB A;  1VGL A;  4YQV A;  4KA0 A;  1SK0 A;  4DSQ A;  1SKR B;  3H8Q A;  2XC2 A;  1JZD A;  2JU5 A;  3CSJ A;  3LJ0 A;  1E2Y A;  2LJA A;  5AIV A;  1M99 A;  1C72 A;  2V6K A;  4G0L A;  4LL1 B;  6GST A;  1OKT A;  2A2C A;  4TXO B;  2C0E A;  2FLS A;  4ZL9 A;  1VRS D;  4HEA 1;  2B6M A;  4K9Z A;  4DSS A;  1AUC A;  1Z9H A;  3HJM A;  1EEJ A;  3HVS A;  2IFQ B;  3EE2 A;  4QL9 A;  3ERF A;  4O5U A;  1AXD A;  2R0P A;  1XPV A;  1W3S A;  1K0B A;  2JSZ A;  3F4M A;  5D9T A;  3CXG A;  3K8N A;  1SJI A;  3VFI A;  4IS0 A;  4F9Z A;  1TK8 B;  2EIR A;  4O1O A;  2OE1 A;  2YZU A;  3LW9 A;  4N0Z A;  3D21 A;  2I4A A;  4EIQ A;  3M1G A;  1BYE A;  3UIW A;  3C71 A;  1XWC A;  1ON4 A;  1PX7 A;  2LST A;  3TKQ A;  1XVQ A;  2L6D A;  4PQH A;  4KSM A;  4MJE A;  1NHO A;  2GQK A;  5G1K A;  2PVO C;  2V6O A;  2C0G A;  2JZS A;  3DYR A;  2ES7 A;  2RII A;  5KN3 A;  1G7E A;  3RDW A;  1DBY A;  1EV4 A;  2VLV A;  3WGD A;  4K8M A;  2XPD A;  1YEX A;  3KTB A;  5GZZ B;  5IIZ A;  1B4Q A;  3HD5 A;  4F82 A;  1X0R A;  5DQY A;  3W8J A;  3IBH A;  3KP9 A;  1H75 A;  1MD3 A;  4NHZ A;  3LFL A;  2CZ3 A;  4XHM A;  2A2R A;  1JZR A;  4V2L A;  3IV4 A;  2FY6 A;  1V2A A;  3CTG A;  2KP1 A;  3GYK A;  3C73 A;  2O85 A;  5EL8 A;  4L0W A;  3F63 A;  4YAP A;  3IOS A;  4FH8 A;  5DQS A;  4Z7H A;  3QFB C;  1MDK A;  3ZTL A;  3GH6 A;  4K0G A;  5FHI A;  2F8F A;  2K8S A;  2VL2 C;  13GS A;  1A0R P;  3P23 A;  4POK A;  1ERT A;  5IMD A;  5H5S A;  5D96 A;  4D73 B;  1PQN A;  1OE7 A;  3V1W A;  3A5I A;  4OAU C;  3KGK A;  1FVJ A;  4FYC A;  4Q5R A;  2OE3 A;  1Z3E A;  1SJ6 A;  3APO A;  4IKH A;  4KDY A;  3ZRE A;  2FWH A;  2H30 A;  2OBI A;  1LJR A;  2REM A;  1N2A A;  2RAD A;  2NDO A;  4JCV E;  3H1N A;  3MYD A;  3C1S A;  4O32 A;  2IME A;  4EKZ A;  4EIP A;  4YQM A;  1EV9 A;  2FUG 2;  2YZH A;  1PKW A;  3SDJ A;  3EU3 A;  5EVO A;  5HFG A;  3DEX A;  3KH9 A;  3VLN A;  1R5A A;  2PWJ A;  2VAF A;  2VIM A;  4WBJ A;  3WGE A;  4AS3 A;  2XTR A;  1AQV A;  2JL4 A;  4TKY A;  2CX3 A;  5J9C A;  5JWO B;  2DJJ A;  2AJQ B;  2J23 A;  2MMN A;  1TW9 A;  4XRA A;  2MMO A;  2H74 A;  2VL9 A;  2CVD A;  5KEJ A;  2E2G A;  1SYX A;  2WZ9 A;  2L57 A;  2MYG A;  4ILF A;  1ST9 A;  5H5R A;  4HUA A;  3F9U A;  2G0F A;  1FO5 A;  6GSU A;  2N5A A;  2YFA A;  2H0H A;  1MDJ A;  3M8N A;  1XBS A;  5IO0 A;  1X5E A;  2VCX A;  1QXH A;  1ZYP A;  2CA8 A;  4WF4 A;  1A24 A;  3RHC A;  2I9H A;  2MBS A;  2AUV A;  1EEM A;  2VCZ A;  1W4V A;  1JFU A;  1K3L A;  1J9B A;  2H1G A;  4J56 E;  2VCW A;  4F03 A;  1ZL9 A;  3FYG A;  4GF0 A;  5IPH A;  1YKC A;  5CRE A;  5IQY A;  1T4Z A;  2DKI A;  3J7Y b;  2LTK A;  1YZX A;  2GZP A;  2YV9 A;  4RQX A;  1TU8 A;  4BVY B;  1ABA A;  3ZFB A;  2IN3 A;  1ACV A;  4OO4 A;  2D2Z A;  1OYJ A;  3DML A;  3GMF A;  5CNW A;  4I2T A;  3TKP A;  1TTZ A;  2P0G A;  3KTL A;  3DA3 A;  1THO A;  5GAP D;  3GIX A;  3TJJ A;  2GSS A;  4ZBB A;  2NTO A;  4HFV A;  2RLI A;  1T1V A;  2RM5 A;  1NSW A;  2P5R A;  3MAK A;  1GWC A;  3ZZX A;  1Y6E A;  2QC7 A;  1XOA A;  1GSF A;  2E0Q A;  1TRW A;  4PUR A;  4IVF A;  2B1L A;  4KND A;  1OE8 A;  3GUR A;  3ME7 A;  5IMC A;  2YJ7 A;  1XWG A;  4N11 A;  5IMZ A;  1J0F A;  2P31 A;  2WB9 A;  1GSE A;  2O87 A;  6GSX A;  9GSS A;  1LU4 A;  1K0C A;  3EVI A;  4PXO A;  1DE2 A;  1BX9 A;  4TXV A;  4DSS B;  1SYR A;  1M2D A;  1MTC A;  1O8X A;  4PUF C;  3M0F A;  3F0I A;  4Z7X A;  3LG6 A;  4FYU A;  4GLT A;  4Q5F A;  1IYH A;  2HRK A;  3KEB A;  4F0B A;  3BJ5 A;  4KSO A;  1M2B A;  1PN9 A;  1ZYN A;  3GNJ A;  3GN3 A;  4V2N A;  1HNB A;  3GL3 A;  2AYT A;  4HEA 2;  4MAB A;  3BCI A;  2VCT A;  2F51 A;  5F05 A;  1AQW A;  3JSB A;  2GLR A;  2XHF A;  1QFN A;  2F3M A;  2FA8 A;  4MJB A;  2PMT A;  3CRT A;  3QCP A;  5CRH A;  4U6R A;  3KZQ A;  4IP6 A;  2B5X A;  2J9H A;  3A2X A;  3N9J A;  1RW1 A;  1G0T A;  2KHP A;  4GRF A;  4NAX A;  3DIE A;  2WS2 A;  2X8C A;  3G9B A;  1B8X A;  3WYW A;  3F4R A;  3EYT A;  5HR1 A;  3EMX A;  2FWG A;  4G9H A;  1Q98 A;  5DVB A;  1WPI A;  2HFD A;  2JAD A;  3UOM A;  4MNN A;  4MPG A;  2H19 A;  4MF5 A;  6GSS A;  4POB A;  1OAZ A;  11GS A;  4ML1 A;  1U5K A;  4HI7 A;  3ZIJ A;  4K6X A;  3TKS E;  1GUH A;  5KN2 A;  3A3T A;  1B9X C;  1F6M C;  2H66 A;  2LUS A;  3ISO A;  4RQR A;  4XS1 A;  4YH2 A;  3H93 A;  3HY2 A;  2IP6 A;  3LQ7 A;  3LWA A;  3UVH A;  2L5L A;  2YOI A;  1T8E B;  2VL3 A;  3EMP A;  2VUP A;  3MIX A;  4TR1 A;  4KH7 A;  4MZB A;  2YFB A;  2BTO T;  4ISD A;  1U87 A;  3D4M A;  3AJF A;  2V1M A;  2FHE A;  3SWL A;  1PKZ A;  4LL4 B;  3FKF A;  2DLX A;  3KMN A;  4AGS A;  2V2G A;  1SL1 B;  5J41 A;  2DIY A;  3TKR A;  3H79 A;  4MMM A;  1A23 A;  3APS A;  1TI1 A;  2I81 A;  1PMT A;  4MH3 A;  2FD3 A;  4ECJ A;  4G76 A;  14GS A;  4K5R A;  1HQO A;  2WFC A;  1SD8 A;  2IIY A;  1GSD A;  4NV5 A;  3I9V 1;  4H86 A;  1USB A;  1HNA A;  1KTE A;  4IJ3 A;  3FNB A;  2YWO A;  4O1P A;  2QGM A;  3HVV A;  3D0Z A;  4TN8 A;  2LRC A;  3MWH A;  3FVV A;  2JBW A;  1JHB A;  3ME8 A;  1ZOF A;  1O8W A;  1Z5Y E;  2X8G A;  4EC0 A;  1TU7 A;  2YNX A;  2Z9S A;  3RHB A;  3UAP A;  3DWV A;  2OAD A;  4GTU A;  2FA4 A;  5AGY A;  2VOC A;  1XXU A;  1OVN A;  3KMO A;  5G31 A;  5DCG A;  2LNT A;  3A2V A;  4FIW A;  2QA1 A;  5A4U A;  2HRN A;  2R6K A;  2IL3 A;  3LXT A;  5ECR B;  2LKU A;  5IOX A;  1K0N A;  3DVX A;  1DSB A;  2B3S A;  2E7P A;  2KP2 A;  2QA2 A;  3HKR A;  4EDY A;  5HR3 A;  2A4H A;  1GNE A;  1ZMA A;  2R5G A;  1CQG A;  1AW9 A;  1WOU A;  3FZA A;  1EP8 A;  3A5W A;  3UAR A;  2JZT A;  3GL5 A;  1H4O A;  4NPB A;  1M2A A;  4FYB A;  4PQ1 A;  3QAV A;  4JR6 A;  3LXZ A;  5JCU A;  1VF1 A;  3C7M A;  4MLY A;  1GP1 A;  2FGX A;  1WIK A;  2ALB A;  5ECM B;  4ZIJ A;  4TR4 A;  2X99 A;  5CAX A;  4XS4 B;  1O7U A;  3CSH A;  1XG8 A;  2C0F A;  4IGJ A;  1R7H A;  1ML6 A;  4HZ4 A;  2VCQ A;  3APQ A;  1Z6M A;  2TIR A;  4K2X A;  4PTS A;  4LMV A;  3MNG A;  5ECL B;  3ERW A;  2C4J A;  4Z7G A;  2EIO A;  3P90 A;  3HVX A;  2HRA A;  3VI5 A;  1GL8 A;  4OFN A;  3DXB A;  3TKS A;  4I1T A;  3IA1 A;  4JZQ A;  1SL2 B;  2GZZ A;  1ILO A;  2H73 A;  2JB1 A;  3HJO A;  2HE3 A;  2IMK A;  1FOH A;  1XFL A;  2DMM A;  3TRX A;  1PX6 A;  5IMA A;  2IPA A;  5ECO B;  4K1F A;  1PGT A;  2WJU A;  1DUG A;  5F0G A;  4F2I A;  4KUN A;  4ML6 A;  4BIK A;  4G75 A;  1WP0 A;  2BJX A;  1A2J A;  3L0I A;  5HGI A;  2YWI A;  4YQU A;  3IC8 A;  3QR6 A;  4K7N A;  4Z2T A;  1YJ6 A;  5L71 A;  2OKA A;  4POL A;  1ERW A;  5KOX A;  4KB3 A;  4EO3 A;  17GS A;  3QPM A;  4V2M A;  2X64 A;  3L78 A;  3HDC A;  4AJ7 A;  4I8B A;  4ZB6 A;  2HSY A;  3O3T A;  2X49 A;  4BVX A;  3UIT A;  3JCM L;  3WT2 A;  4AF2 A;  5ECP B;  2IMF A;  3KCM A;  1K3O A;  3IC4 A;  1B4P A;  2HXK A;  4GQC A;  2OAC A;  1ZYE A;  4KDU A;  4PX1 A;  1AQX A;  5COH A;  4YKF A;  4OCF A;  4G2E A;  4P3Y B;  1PFO A;  2A2S A;  2JB2 A;  1BED A;  2IMD A;  2PVQ A;  5DAK B;  3UVT A;  4NHW A;  3TGZ A;  1X5D A;  1MEK A;  4J2F A;  4WF5 A;  1Z6N A;  3VWX A;  5HQP A;  1M9B A;  2LV3 A;  2GT6 A;  4FO5 A;  4EUY A;  2TRC P;  2BL8 A;  3IAS 1;  1GNW A;  1AAZ A;  5INY A;  4CHS A;  1NW2 A;  2CAI A;  1WMJ A;  5DAL B;  5A4W A;  4LLR A;  1XWA A;  4YZC A;  5D9X A;  4RUV A;  4AS2 A;  4Q5N A;  1T00 A;  5EY6 A;  2P22 B;  2K19 A;  2HSH A;  5CRW A;  3B55 A;  3L0H A;  2CT6 A;  6GSW A;  1SK1 A;  1TKD B;  2CQ9 A;  4ZB8 A;  1TRV A;  1ZCP A;  2X4A A;  2DJK A;  4J57 E;  1OC9 B;  4TW5 A;  4IEL A;  5HR0 A;  3DVW A;  2NPB A;  3EUR A;  4E8H A;  5E59 A;  2AB6 A;  3M3M A;  1UN2 A;  1WWJ A;  2H6Z A;  5ECK B;  3M9J A;  3GHA A;  3I43 A;  1SK2 A;  3PH9 A;  4YZD A;  4G0I A;  4MZW A;  1WJK A;  4DWL A;  2KLX A;  1ZZY A;  2O7K A;  1GTB A;  3FHK A;  4TR0 A;  1GH2 A;  3ZIV A;  2E8G A;  2PBJ A;  5ECN B;  3VI7 A;  4WKW A;  3I9V 2;  4DEJ A;  2B5E A;  3GKM A;  3TKS C;  4LMW A;  1DE1 A;  5J5N A;  3CYN A;  4XTS A;  5D8I A;  4JRR A;  3FBV A;  2P5Q A;  2K9F A;  1THX A;  1UA5 A;  5ID2 A;  2HI7 A;  2M80 A;  2FNO A;  2RLD A;  3G7J A;  1X9S B;  1OKD A;  1ZYQ B;  4CY6 A;  2LJK A;  2AHE A;  3P8W A;  3O76 A;  4NWY A;  4USS A;  3FR9 A;  2V32 A;  1YQ1 A;  2F8A A;  5J9B A;  4G0K A;  2LNS A;  3E3E A;  5HR2 A;  2DML A;  2JSY A;  2YN1 A;  3KM6 A;  2RUF A;  3HZ8 A;  4OWY A;  3U5R E;  3S9F A;  4GQF A;  4L5O A;  3G7I A;  4I97 A;  4NXI A;  1XCC A;  3QAW A;  4QQ7 A;  3VWU A;  4EVM A;  4WR4 A;  2FU2 A;  1QGV A;  4K5S A;  1FW1 A;  2HYX A;  3VPT A;  2YAN A;  3EC3 A;  3PPU A;  2XBQ A;  3KP8 A;  3D4T A;  3LJ2 A;  3TDG A;  3TJK A;  3TOT A;  3KJY A;  1UC7 A;  5CYY A;  2M46 A;  2WRT A;  5IO2 A;  3TOU A;  1EGO A;  3U6V A;  5G2Z A;  2ZUP A;  2V41 A;  3L9V A;  3CSI A;  3TJG A;  4KCE A;  3ZVJ D;  1JLW A;  5ECI B;  1JZW A;  2QSI A;  3D22 A;  2DIZ A;  2LRN A;  3O6T A;  2PUK C;  3D6I A;  4TXO A;  4XCS A;  2PPT A;  4TVE A;  2O89 A;  5DDL A;  2C3Q A;  4AJ8 A;  2RUE A;  2I1U A;  4IP1 A;  7GSS A;  4HJM A;  4MK3 A;  2CX4 A;  1HYU A;  3OR5 A;  5ELA A;  3EU4 A;  5ECH B;  5A5K A;  1EGR A;  4N10 A;  1F3A A;  1B48 A;  1M0U A;  4G10 A;  2N5F A;  1GSQ A;  4F0C A;  1O81 A;  5KOW A;  3CRU A;  4KDX A;  1U3I A;  3EWL A;  3HVN A;  1XW5 A;  1PD2 1;  3IRA A;  4XIH A;  1EP7 A;  2H0G A;  3LSZ A;  4GCI A;  3ZYW A;  4N30 A;  3Q8D A;  4ULX A;  3CBU A;  2G2Q A;  3F8U A;  4EF0 A;  5D9V A;  2RIO A;  1WRY A;  3F6D A;  3FZ9 A;  2H1D A;  3LYP A;  3FK8 A;  2LQO A;  3R3E A;  1TDP A;  1T4Y A;  5H5Q A;  3FY7 A;  2FWF A;  4TR3 A;  3ZIT A;  2ZW3 A;  3IK9 A;  2YWN A;  4POM A;  4ICY A;  4I6X A;  5ELG A;  1BAY A;  2IJY A;  2I3Y A;  2AAW A;  2VCV A;  4ZL8 A;  2GQM A;  2XMX A;  3CMI A;  1S3R A;  2QZG A;  3QD9 A;  5ECQ B;  2YWM A;  3RBT A;  3F4T A;  1FOV A;  1S3A A;  4RI7 A;  1QK8 A;  3WT1 A;  3HCZ A;  4X4J A;  5BMU A;  2H76 A;  1Y25 A;  2HGK A;  2ETD A;  5CRD A;  2DJ0 A;  3TRQ A;  4Q9V A;  4IHU A;  4D73 A;  1IYI A;  2R37 A;  2A2D A;  1FAA A;  3IAS 2;  5D93 A;  1YKA A;  2F9S A;  3GST A;  1YF1 A;  4ACS A;  1HNC A;  1VF4 A;  5HFI A;  1A2M A;  1SKW B;  2GSQ A;  2V6E A;  3HZ4 A;  3GX8 A;  1TRS A;  4K7I A;  2H75 A;  2IWT A;  1GTI A;  4HSC X;  4OFM A;  5D9W A;  3LGC A;  3HYP A;  5CRG A;  5B6N A;  3FZ4 A;  1F9M A;  1S3D A;  2FEF A;  2B7J A;  2H8L A;  2CV4 A;  3W8S A;  3GH9 A;  1R4W A;  1SD9 A;  2H01 A;  1V9W A;  3LOR A;  3TCO A;  3IPZ A;  1S3C A; 
#chains in the Genus database with same CATH homology
 3QDN A;  3BD2 A;  6GSV A;  4TOP A;  1O85 A;  3LEF A;  16GS A;  2WDU A;  1PRX A;  3ZML A;  2VD0 A;  2OA7 A;  1EZK A;  4Z2R A;  3NIV A;  4EE0 A;  3TJB A;  2L4Q A;  4K0N A;  4XRD A;  5DJL A;  1OC8 A;  2K8V A;  4YZ9 A;  3F4S A;  1KNG A;  3IHG A;  4PUA A;  4WR5 A;  4EXJ A;  3HJP A;  1TJD A;  1PA3 A;  4MP4 A;  3L4N A;  3NZN A;  4MF6 A;  2VL2 A;  4HOJ A;  2C3T A;  1PN0 A;  5ID2 B;  4L0U A;  1XW9 A;  2GQL A;  5E4W A;  1A8L A;  3NOF A;  3IDV A;  2FCH A;  2LRT A;  2GGT A;  4IJI A;  2HRF A;  4IN0 A;  5JWQ B;  4OMV A;  2HNL A;  4HU9 A;  1YY7 A;  2C80 A;  1UVZ A;  4K7O A;  2C3N A;  5ENU A;  1A8Y A;  2ZCT A;  3LYK A;  4PL5 A;  4MPF A;  5KN1 A;  2KUC A;  1GTU A;  3ZL5 A;  1QUW A;  2LEG A;  3GTU A;  5JCG A;  4V1A p;  4ECI A;  2R0G A;  5B7C A;  3Q19 A;  1PL1 A;  1YF0 A;  2GZY A;  3LJR A;  1T3B A;  2BMX A;  3GA4 A;  3W6G A;  6GSY A;  1K3Y A;  3H4K A;  3N5O A;  3IK7 A;  1VF3 A;  3Q6O A;  2CVK A;  2HZE A;  1J08 A;  2K6V A;  5GST A;  1EOG A;  1CQH A;  1A2L A;  3QFA C;  3VA9 A;  4IW9 A;  3IE3 A;  1F37 A;  4RI6 A;  3FMW A;  2L4C A;  4HQZ A;  4N0V A;  4DVC A;  5IMF A;  5BRT A;  2NVL A;  4JU5 A;  5C04 A;  3KD0 A;  1GUK A;  4WEY A;  2CZ2 A;  2L1L B;  3CTF A;  3QOU A;  3ZLP A;  2UZ8 A;  4A5P A;  4OAV B;  4HJ2 A;  2GT5 A;  3I6A A;  1VF2 A;  1W89 A;  5G30 A;  2WCI A;  3P7X A;  4KGI A;  5FT3 A;  5DJM A;  2H70 A;  1WE0 A;  1O73 A;  4JR4 A;  1Q4J A;  3Q18 A;  3ED3 A;  1X5C A;  1BG5 A;  5IPG A;  4XS6 A;  4NMU A;  5ECS A;  1SKS B;  1SU9 A;  4HQS A;  19GS A;  2XTQ A;  1V98 A;  4I5Q A;  5DBQ A;  4X43 A;  2PU9 C;  20GS A;  2H0I A;  1PL2 A;  2DJ2 A;  2VM2 A;  1XOB A;  3TB2 A;  2MZC A;  2A2P A;  2C1Y A;  2F66 B;  3US3 A;  1JLV A;  1ZGN A;  3TJF A;  5DCH A;  3GFK A;  4X0X A;  1K0A A;  2GDR A;  4EDZ A;  2DBC A;  2CAZ B;  2EIQ A;  1N8J A;  3IAM 1;  3Q74 A;  2HSM A;  5CP1 A;  5B8B A;  3ZVJ A;  4L8E A;  2H71 A;  4IBP A;  3ZFL A;  4GWR A;  5CO3 A;  1M9A A;  4TR1 B;  4OFT A;  1KBN A;  5G5E A;  1TDI A;  2GST A;  1B9Y C;  3TUE A;  1K0D A;  4KX4 A;  4V1A g;  3L9U A;  3BCK A;  4BWQ A;  5D73 A;  3IXR A;  4I2U A;  4OO5 A;  2JB3 A;  3J7Y k;  4KCA A;  2N5B A;  5EPF A;  4EL1 A;  5AIS A;  4HDE A;  3C1R A;  1HD2 A;  3HHV A;  3PR8 A;  4MJA A;  4MCU A;  3QMX A;  2H6Y A;  10GS A;  1Z7R A;  1MD4 A;  2VLT A;  4MDC A;  3P2A A;  2K18 A;  2L6C A;  3GKN A;  3G7Y A;  1TP9 A;  5IOW A;  3L9S A;  1GRX A;  1U3A A;  5F06 A;  5LNK 1;  4Z2U A;  4TRX A;  2V1C C;  3A2W A;  1K0M A;  1BJX A;  3VUR A;  3UMA A;  3FRC A;  2GVP A;  4BA7 A;  1G6W A;  2KOK A;  4ID0 A;  3EPT A;  4PL3 A;  3TRP A;  12GS A;  3F3R A;  5JCW A;  1GSS A;  3GKX A;  3F3Q A;  3RPN A;  1KEB A;  2HT9 A;  3UL3 A;  1SL0 B;  4WBR D;  1FG4 A;  4WXT A;  1LBK A;  4HS1 A;  1QQ2 A;  4JED A;  5G1L A;  2ON5 A;  2VLU A;  5LCZ A;  4PNF A;  2H6X A;  4KW6 A;  2MMZ A;  5IM9 A;  3BBY A;  1EWX A;  4GST A;  3LJ1 A;  2YP6 A;  1M7T A;  4BL7 A;  1XVW A;  3I69 A;  3ZMK A;  4ECC A;  1U6T A;  2R2J A;  1RQM A;  5GSS A;  3UJ1 A;  4GXZ A;  2C8U A;  1ERV A;  1SJZ A;  4O5Q A;  2ZNM A;  4MZC A;  5F07 A;  2XPE A;  2R4V A;  1OC3 A;  4PQI A;  3GTU B;  4XS4 A;  1V58 A;  2C0D A;  1K0O A;  1MDI A;  2H1B A;  4MF7 A;  4MA9 A;  2EC4 A;  3M9K A;  3VWV A;  1U88 A;  1SJ8 A;  2QKE A;  2JAE A;  1O6J A;  1QMV A;  1GTA A;  5AIX A;  1FB6 A;  3VWW A;  1TI3 A;  4PNG A;  2R3X A;  4PL4 A;  1XW6 A;  2L5O A;  2OBK A;  4MJC A;  3FEU A;  1R26 A;  4ZIL A;  2CVB A;  1GSY A;  3MDK A;  5F8B A;  2HZE B;  2CAQ A;  4LA1 A;  3GSS A;  2MMA A;  2WGR A;  4FQU A;  2IFQ A;  1T7P B;  3VK9 A;  2E2M A;  2TRX A;  4L5L A;  1A0F A;  3RPP A;  2RM6 A;  2LQQ A;  3UBK A;  3KH7 A;  3E9J B;  4KAE A;  5LD0 A;  2OJL A;  3UEM A;  1V40 A;  2VM1 A;  2H72 A;  4OD7 A;  4WET A;  4KE3 A;  1E6B A;  2MJF B;  3FR3 A;  18GS A;  4BPY A;  5FWG A;  2LS5 A;  1GUL A;  2PER A;  4ZXG A;  3DD3 A;  1V57 A;  1PSQ A;  4BVX B;  4IQ1 A;  1RK4 A;  4O92 A;  3EIN A;  3DGQ A;  4X1U A;  5J4U A;  1JZO A;  3HA9 A;  2PN8 A;  3C8E A;  22GS A;  2PGT A;  4E8E A;  1Z7P A;  3RAZ A;  1G6Y A;  2JZR A;  1TRU A;  3KXO A;  4GSN A;  2HLS A;  4Q5Q A;  3DKS A;  2NBS A;  1GSU A;  2GTU A;  3WD6 A;  4IQA A;  2GS3 A;  4JBB A;  3GX0 A;  2AV4 A;  5DAK A;  3KIJ A;  3VPQ A;  2YPM A;  2VO4 A;  5IMV A;  3SBC A;  2DKH A;  2IMI A;  3PGT A;  4CW9 A;  4QL7 A;  3GKK A;  5B6M A;  2F6M B;  2QGV A;  5GAN D;  3IR4 A;  2ON7 A;  2FUG 1;  1FB0 A;  5DAL A;  1BQ7 A;  1FHE A;  3GUS A;  4O5R A;  3F6F A;  1R5P A;  2B5Y A;  3AY8 A;  3MSZ A;  2FWE A;  2YJH A;  2LJR A;  3GV1 A;  3IAM 2;  4ZBD A;  2OE0 A;  3IHQ A;  2HZF A;  4YAV A;  1YEP A;  3GRX A;  1XZO A;  1XWK A;  2B7K A;  4DSR A;  4HU7 A;  1GLQ A;  8GSS A;  2YV7 A;  2A4V A;  1OC9 A;  5B8A A;  5C00 A;  5AN1 A;  1AIU A;  4BWS A;  5ABR A;  1F3B A;  1YDK A;  1I5G A;  5KN0 A;  3UBL A;  3D5J A;  1NHY A;  2DC5 A;  4OCE A;  5HFK A;  1TK5 B;  2H1A A;  4PGT A;  2R0C A;  1XIY A;  2KKM A;  1GUM A;  5JWR B;  1X9W B;  2ZRR A;  4ZBA A;  4O7H A;  1F2E A;  1TOF A;  3QAG A;  3FW2 A;  5LNK e;  4HZ2 A;  2GSR A;  4GSS A;  4MH2 A;  3PIN A;  2DJ1 A;  2X8H A;  4CDO A;  1X9M B;  2XBI A;  4GXT A;  2YCD A;  3DO9 A;  3DRN A;  1ERU A;  1YO7 A;  3R2Q A;  2O8V B;  2VD1 A;  3FZ5 A;  4YKG A;  1GLP A;  3HXS A;  1TXX A;  1EOH A;  3ERG A;  1AC1 A;  3E0U A;  4CY8 A;  1TK0 B;  4NV2 A;  1FVK A;  4BVY A;  2JAC A;  1SEN A;  2MBT A;  2L59 A;  4JE1 A;  2DSA A;  2DJ3 A;  3FR6 A;  4BL7 B;  1URM A;  2WUL A;  3BOA A;  4KF9 A;  2B1K A;  3ZRD A;  4G19 A;  4ZB9 A;  1I9D A;  3DA4 A;  1G7O A;  1XWB A;  3WGX A;  4K2D A;  5J3R A;  1NM3 A;  4ZL7 A;  5A4V A;  5G5F A;  2M72 A;  4AJ6 A;  4ECB A;  1VGL A;  4YQV A;  4KA0 A;  1SK0 A;  4DSQ A;  1SKR B;  3H8Q A;  2XC2 A;  1JZD A;  2JU5 A;  3CSJ A;  3LJ0 A;  1E2Y A;  2LJA A;  5AIV A;  1M99 A;  1C72 A;  2V6K A;  4G0L A;  4LL1 B;  6GST A;  1OKT A;  2A2C A;  4TXO B;  2C0E A;  2FLS A;  4ZL9 A;  1VRS D;  4HEA 1;  2B6M A;  4K9Z A;  4DSS A;  1AUC A;  1Z9H A;  3HJM A;  1EEJ A;  3HVS A;  2IFQ B;  3EE2 A;  4QL9 A;  3ERF A;  4O5U A;  1AXD A;  2R0P A;  1XPV A;  1W3S A;  1K0B A;  2JSZ A;  3F4M A;  5D9T A;  3CXG A;  3K8N A;  1SJI A;  3VFI A;  4IS0 A;  4F9Z A;  1TK8 B;  2EIR A;  4O1O A;  2OE1 A;  2YZU A;  3LW9 A;  4N0Z A;  3D21 A;  2I4A A;  4EIQ A;  3M1G A;  1BYE A;  3UIW A;  3C71 A;  1XWC A;  1ON4 A;  1PX7 A;  2LST A;  3TKQ A;  1XVQ A;  2L6D A;  4PQH A;  4KSM A;  4MJE A;  1NHO A;  2GQK A;  5G1K A;  2PVO C;  2V6O A;  2C0G A;  2JZS A;  3DYR A;  2ES7 A;  2RII A;  5KN3 A;  1G7E A;  3RDW A;  1DBY A;  1EV4 A;  2VLV A;  3WGD A;  4K8M A;  2XPD A;  1YEX A;  3KTB A;  5GZZ B;  5IIZ A;  1B4Q A;  3HD5 A;  4F82 A;  1X0R A;  5DQY A;  3W8J A;  3IBH A;  3KP9 A;  1H75 A;  1MD3 A;  4NHZ A;  3LFL A;  2CZ3 A;  4XHM A;  2A2R A;  1JZR A;  4V2L A;  3IV4 A;  2FY6 A;  1V2A A;  3CTG A;  2KP1 A;  3GYK A;  3C73 A;  2O85 A;  5EL8 A;  4L0W A;  3F63 A;  4YAP A;  3IOS A;  4FH8 A;  5DQS A;  4Z7H A;  3QFB C;  1MDK A;  3ZTL A;  3GH6 A;  4K0G A;  5FHI A;  2F8F A;  2K8S A;  2VL2 C;  13GS A;  1A0R P;  3P23 A;  4POK A;  1ERT A;  5IMD A;  5H5S A;  5D96 A;  4D73 B;  1PQN A;  1OE7 A;  3V1W A;  3A5I A;  4OAU C;  3KGK A;  1FVJ A;  4FYC A;  4Q5R A;  2OE3 A;  1Z3E A;  1SJ6 A;  3APO A;  4IKH A;  4KDY A;  3ZRE A;  2FWH A;  2H30 A;  2OBI A;  1LJR A;  2REM A;  1N2A A;  2NDO A;  4JCV E;  3H1N A;  3MYD A;  3C1S A;  4O32 A;  2IME A;  4EKZ A;  4EIP A;  4YQM A;  1EV9 A;  2FUG 2;  2YZH A;  1PKW A;  3SDJ A;  3EU3 A;  5EVO A;  5HFG A;  3DEX A;  3KH9 A;  3VLN A;  1R5A A;  2PWJ A;  2VAF A;  2VIM A;  4WBJ A;  3WGE A;  4AS3 A;  2XTR A;  1AQV A;  2JL4 A;  4TKY A;  2CX3 A;  5J9C A;  5JWO B;  2DJJ A;  2AJQ B;  2J23 A;  2MMN A;  1TW9 A;  4XRA A;  2MMO A;  2H74 A;  2VL9 A;  2CVD A;  5KEJ A;  2E2G A;  1SYX A;  2WZ9 A;  2L57 A;  2MYG A;  4ILF A;  1ST9 A;  5H5R A;  4HUA A;  3F9U A;  2G0F A;  1FO5 A;  6GSU A;  2N5A A;  2YFA A;  2H0H A;  1MDJ A;  3M8N A;  1XBS A;  5IO0 A;  1X5E A;  2VCX A;  1QXH A;  1ZYP A;  2CA8 A;  4WF4 A;  1A24 A;  3RHC A;  2I9H A;  2MBS A;  2AUV A;  1EEM A;  2VCZ A;  1W4V A;  1JFU A;  1K3L A;  1J9B A;  2H1G A;  4J56 E;  2VCW A;  4F03 A;  1ZL9 A;  3FYG A;  4GF0 A;  5IPH A;  1YKC A;  5CRE A;  5IQY A;  1T4Z A;  2DKI A;  3J7Y b;  2LTK A;  1YZX A;  2GZP A;  2YV9 A;  4RQX A;  1TU8 A;  4BVY B;  1ABA A;  3ZFB A;  2IN3 A;  1ACV A;  4OO4 A;  2D2Z A;  1OYJ A;  3DML A;  3GMF A;  5CNW A;  4I2T A;  3TKP A;  1TTZ A;  2P0G A;  3KTL A;  3DA3 A;  1THO A;  5GAP D;  3GIX A;  3TJJ A;  2GSS A;  4ZBB A;  2NTO A;  4HFV A;  2RLI A;  1T1V A;  2RM5 A;  1NSW A;  2P5R A;  3MAK A;  1GWC A;  3ZZX A;  1Y6E A;  2QC7 A;  1XOA A;  1GSF A;  2E0Q A;  1TRW A;  4PUR A;  4IVF A;  2B1L A;  4KND A;  1OE8 A;  3GUR A;  3ME7 A;  5IMC A;  2YJ7 A;  1XWG A;  4N11 A;  5IMZ A;  1J0F A;  2P31 A;  2WB9 A;  1GSE A;  2O87 A;  6GSX A;  9GSS A;  1LU4 A;  1K0C A;  3EVI A;  4PXO A;  1DE2 A;  1BX9 A;  4TXV A;  4DSS B;  1SYR A;  1M2D A;  1MTC A;  1O8X A;  4PUF C;  3M0F A;  3F0I A;  4Z7X A;  3LG6 A;  4FYU A;  4GLT A;  4Q5F A;  1IYH A;  2HRK A;  3KEB A;  4F0B A;  3BJ5 A;  4KSO A;  1M2B A;  1PN9 A;  1ZYN A;  3GNJ A;  3GN3 A;  4V2N A;  1HNB A;  3GL3 A;  2AYT A;  4HEA 2;  4MAB A;  3BCI A;  2VCT A;  2F51 A;  5F05 A;  1AQW A;  3JSB A;  2GLR A;  2XHF A;  1QFN A;  2F3M A;  2FA8 A;  4MJB A;  2PMT A;  3CRT A;  3QCP A;  5CRH A;  4U6R A;  3KZQ A;  4IP6 A;  2B5X A;  2J9H A;  3A2X A;  3N9J A;  1RW1 A;  1G0T A;  2KHP A;  4GRF A;  4NAX A;  3DIE A;  2WS2 A;  2X8C A;  3G9B A;  1B8X A;  3WYW A;  3F4R A;  3EYT A;  5HR1 A;  3EMX A;  2FWG A;  4G9H A;  1Q98 A;  5DVB A;  1WPI A;  2HFD A;  2JAD A;  3UOM A;  4MNN A;  4MPG A;  2H19 A;  4MF5 A;  6GSS A;  4POB A;  1OAZ A;  11GS A;  4ML1 A;  1U5K A;  4HI7 A;  3ZIJ A;  4K6X A;  3TKS E;  1GUH A;  5KN2 A;  3A3T A;  1B9X C;  1F6M C;  2H66 A;  2LUS A;  3ISO A;  4RQR A;  4XS1 A;  4YH2 A;  3H93 A;  3HY2 A;  2IP6 A;  3LQ7 A;  3LWA A;  3UVH A;  2L5L A;  2YOI A;  1T8E B;  2VL3 A;  3EMP A;  2VUP A;  3MIX A;  4TR1 A;  4KH7 A;  4MZB A;  2YFB A;  2BTO T;  4ISD A;  1U87 A;  3D4M A;  3AJF A;  2V1M A;  2FHE A;  3SWL A;  1PKZ A;  4LL4 B;  3FKF A;  2DLX A;  3KMN A;  4AGS A;  2V2G A;  1SL1 B;  5J41 A;  2DIY A;  3TKR A;  3H79 A;  4MMM A;  1A23 A;  3APS A;  1TI1 A;  2I81 A;  1PMT A;  4MH3 A;  2FD3 A;  4ECJ A;  4G76 A;  14GS A;  4K5R A;  1HQO A;  2WFC A;  1SD8 A;  2IIY A;  1GSD A;  4NV5 A;  3I9V 1;  4H86 A;  1USB A;  1HNA A;  1KTE A;  4IJ3 A;  2YWO A;  4O1P A;  3HVV A;  3D0Z A;  4TN8 A;  2LRC A;  3MWH A;  1JHB A;  3ME8 A;  1ZOF A;  1O8W A;  1Z5Y E;  2X8G A;  4EC0 A;  1TU7 A;  2YNX A;  2Z9S A;  3RHB A;  3UAP A;  3DWV A;  2OAD A;  4GTU A;  2FA4 A;  5AGY A;  2VOC A;  1XXU A;  1OVN A;  3KMO A;  5G31 A;  5DCG A;  2LNT A;  3A2V A;  4FIW A;  2QA1 A;  5A4U A;  2HRN A;  2R6K A;  2IL3 A;  3LXT A;  5ECR B;  2LKU A;  5IOX A;  1K0N A;  3DVX A;  1DSB A;  2B3S A;  2E7P A;  2KP2 A;  2QA2 A;  3HKR A;  4EDY A;  5HR3 A;  2A4H A;  1GNE A;  1ZMA A;  2R5G A;  1CQG A;  1AW9 A;  1WOU A;  3FZA A;  1EP8 A;  3A5W A;  3UAR A;  2JZT A;  3GL5 A;  1H4O A;  4NPB A;  1M2A A;  4FYB A;  4PQ1 A;  3QAV A;  4JR6 A;  3LXZ A;  5JCU A;  1VF1 A;  3C7M A;  4MLY A;  1GP1 A;  2FGX A;  1WIK A;  2ALB A;  5ECM B;  4ZIJ A;  4TR4 A;  2X99 A;  5CAX A;  4XS4 B;  1O7U A;  3CSH A;  2C0F A;  4IGJ A;  1R7H A;  1ML6 A;  4HZ4 A;  2VCQ A;  3APQ A;  1Z6M A;  2TIR A;  4K2X A;  4PTS A;  4LMV A;  3MNG A;  5ECL B;  3ERW A;  2C4J A;  4Z7G A;  2EIO A;  3P90 A;  3HVX A;  2HRA A;  3VI5 A;  1GL8 A;  4OFN A;  3DXB A;  3TKS A;  4I1T A;  3IA1 A;  4JZQ A;  1SL2 B;  2GZZ A;  1ILO A;  2H73 A;  2JB1 A;  3HJO A;  2HE3 A;  2IMK A;  1FOH A;  1XFL A;  2DMM A;  3TRX A;  1PX6 A;  5IMA A;  2IPA A;  5ECO B;  4K1F A;  1PGT A;  2WJU A;  1DUG A;  5F0G A;  4F2I A;  4KUN A;  4ML6 A;  4G75 A;  1WP0 A;  2BJX A;  1A2J A;  3L0I A;  5HGI A;  2YWI A;  4YQU A;  3IC8 A;  3QR6 A;  4K7N A;  4Z2T A;  1YJ6 A;  5L71 A;  2OKA A;  4POL A;  1ERW A;  5KOX A;  4KB3 A;  4EO3 A;  17GS A;  3QPM A;  4V2M A;  2X64 A;  3L78 A;  3HDC A;  4AJ7 A;  4I8B A;  4ZB6 A;  2HSY A;  3O3T A;  2X49 A;  4BVX A;  3UIT A;  3JCM L;  3WT2 A;  4AF2 A;  5ECP B;  2IMF A;  3KCM A;  1K3O A;  3IC4 A;  1B4P A;  2HXK A;  4GQC A;  2OAC A;  1ZYE A;  4KDU A;  4PX1 A;  1AQX A;  5COH A;  4YKF A;  4OCF A;  4G2E A;  4P3Y B;  2A2S A;  2JB2 A;  1BED A;  2IMD A;  2PVQ A;  5DAK B;  3UVT A;  4NHW A;  3TGZ A;  1X5D A;  1MEK A;  4J2F A;  4WF5 A;  1Z6N A;  3VWX A;  5HQP A;  1M9B A;  2LV3 A;  2GT6 A;  4FO5 A;  4EUY A;  2TRC P;  3IAS 1;  1GNW A;  1AAZ A;  5INY A;  4CHS A;  1NW2 A;  2CAI A;  1WMJ A;  5DAL B;  5A4W A;  4LLR A;  1XWA A;  4YZC A;  5D9X A;  4RUV A;  4AS2 A;  4Q5N A;  1T00 A;  5EY6 A;  2P22 B;  2K19 A;  2HSH A;  5CRW A;  3L0H A;  2CT6 A;  6GSW A;  1SK1 A;  1TKD B;  2CQ9 A;  4ZB8 A;  1TRV A;  1ZCP A;  2X4A A;  2DJK A;  4J57 E;  1OC9 B;  4TW5 A;  4IEL A;  5HR0 A;  3DVW A;  2NPB A;  3EUR A;  4E8H A;  5E59 A;  2AB6 A;  3M3M A;  1UN2 A;  1WWJ A;  2H6Z A;  5ECK B;  3M9J A;  3GHA A;  3I43 A;  1SK2 A;  3PH9 A;  4YZD A;  4G0I A;  4MZW A;  1WJK A;  4DWL A;  2KLX A;  1ZZY A;  2O7K A;  1GTB A;  3FHK A;  4TR0 A;  1GH2 A;  3ZIV A;  2E8G A;  2PBJ A;  5ECN B;  3VI7 A;  4WKW A;  3I9V 2;  4DEJ A;  2B5E A;  3GKM A;  3TKS C;  4LMW A;  1DE1 A;  5J5N A;  3CYN A;  4XTS A;  5D8I A;  4JRR A;  3FBV A;  2P5Q A;  2K9F A;  1THX A;  1UA5 A;  5ID2 A;  2HI7 A;  2M80 A;  2FNO A;  3G7J A;  1X9S B;  1OKD A;  1ZYQ B;  4CY6 A;  2LJK A;  2AHE A;  3P8W A;  3O76 A;  4NWY A;  4USS A;  3FR9 A;  2V32 A;  1YQ1 A;  2F8A A;  5J9B A;  4G0K A;  2LNS A;  3E3E A;  5HR2 A;  2DML A;  2JSY A;  2YN1 A;  3KM6 A;  2RUF A;  3HZ8 A;  4OWY A;  3U5R E;  3S9F A;  4GQF A;  4L5O A;  3G7I A;  4I97 A;  4NXI A;  1XCC A;  3QAW A;  4QQ7 A;  3VWU A;  4EVM A;  4WR4 A;  1QGV A;  4K5S A;  1FW1 A;  2HYX A;  3VPT A;  2YAN A;  3EC3 A;  3PPU A;  2XBQ A;  3KP8 A;  3D4T A;  3LJ2 A;  3TDG A;  3TJK A;  3TOT A;  3KJY A;  1UC7 A;  5CYY A;  2M46 A;  2WRT A;  5IO2 A;  3TOU A;  1EGO A;  3U6V A;  5G2Z A;  2ZUP A;  2V41 A;  3L9V A;  3CSI A;  3TJG A;  4KCE A;  3ZVJ D;  1JLW A;  5ECI B;  1JZW A;  2QSI A;  3D22 A;  2DIZ A;  2LRN A;  3O6T A;  2PUK C;  3D6I A;  4TXO A;  4XCS A;  2PPT A;  4TVE A;  2O89 A;  5DDL A;  2C3Q A;  4AJ8 A;  2RUE A;  2I1U A;  4IP1 A;  7GSS A;  4HJM A;  4MK3 A;  2CX4 A;  1HYU A;  3OR5 A;  5ELA A;  3EU4 A;  5ECH B;  5A5K A;  1EGR A;  4N10 A;  1F3A A;  1B48 A;  1M0U A;  4G10 A;  2N5F A;  1GSQ A;  4F0C A;  1O81 A;  5KOW A;  3CRU A;  4KDX A;  1U3I A;  3EWL A;  1XW5 A;  1PD2 1;  3IRA A;  4XIH A;  1EP7 A;  2H0G A;  3LSZ A;  4GCI A;  3ZYW A;  4N30 A;  3Q8D A;  4ULX A;  3CBU A;  2G2Q A;  3F8U A;  4EF0 A;  5D9V A;  2RIO A;  1WRY A;  3F6D A;  3FZ9 A;  2H1D A;  3LYP A;  3FK8 A;  2LQO A;  3R3E A;  1T4Y A;  5H5Q A;  3FY7 A;  2FWF A;  4TR3 A;  3ZIT A;  3IK9 A;  2YWN A;  4POM A;  4ICY A;  4I6X A;  5ELG A;  1BAY A;  2IJY A;  2I3Y A;  2AAW A;  2VCV A;  4ZL8 A;  2GQM A;  2XMX A;  3CMI A;  3QD9 A;  5ECQ B;  2YWM A;  3RBT A;  3F4T A;  1FOV A;  1S3A A;  4RI7 A;  1QK8 A;  3WT1 A;  3HCZ A;  4X4J A;  5BMU A;  2H76 A;  1Y25 A;  5CRD A;  2DJ0 A;  3TRQ A;  4Q9V A;  4IHU A;  4D73 A;  1IYI A;  2R37 A;  2A2D A;  1FAA A;  3IAS 2;  5D93 A;  1YKA A;  2F9S A;  3GST A;  1YF1 A;  4ACS A;  1HNC A;  1VF4 A;  5HFI A;  1A2M A;  1SKW B;  2GSQ A;  2V6E A;  3HZ4 A;  3GX8 A;  1TRS A;  4K7I A;  2H75 A;  2IWT A;  1GTI A;  4OFM A;  5D9W A;  3LGC A;  3HYP A;  5CRG A;  5B6N A;  3FZ4 A;  1F9M A;  1S3D A;  2B7J A;  2H8L A;  2CV4 A;  3W8S A;  3GH9 A;  1R4W A;  1SD9 A;  2H01 A;  1V9W A;  3LOR A;  3TCO A;  3IPZ A;  1S3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...