The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
27
|
sequence length |
92
|
structure length |
92
|
Chain Sequence |
GLSNIVLTCKDLPIPIDLLSLFFDILNERHPSFDEHMFLQMIRKPDDPENLSVFLKSAIWMLSHKRDLPGHYRLPLTCLVSTYSEYFVELKP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Viral protein
|
| source organism |
Rice hoja blanca virus
|
| publication title |
Structural implications into dsRNA binding and RNA silencing suppression by NS3 protein of Rice Hoja Blanca Tenuivirus
pubmed doi rcsb |
| molecule keywords |
Non-structural protein 3
|
| total genus |
27
|
| structure length |
92
|
| sequence length |
92
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature | |
| pdb deposition date | 2010-06-05 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | de novo design (two linked rop proteins) |
#chains in the Genus database with same CATH superfamily 3AJF A; #chains in the Genus database with same CATH topology 3KP9 A; 4YZ9 A; 3LJ0 A; 3L0I A; 4DWL A; 1SJ8 A; 2ZW3 A; 4YZD A; 2E8G A; 3F4M A; 2A2C A; 4AS3 A; 2QGM A; 3VA9 A; 5LNK 1; 2F66 B; 2GSC A; 2XMX A; 1JQO A; 3Q8D A; 4PL5 A; 2ZRR A; 3LJ2 A; 2RIO A; 2BL8 A; 2JAE A; 3FBV A; 2JB3 A; 3UIT A; 2QSB A; 3IAS 1; 3LJ1 A; 2FU2 A; 2RLD A; 1W3S A; 2F6M B; 4Q9V A; 4NV2 A; 2HGK A; 4AS2 A; 3I9V 1; 2CAZ B; 4NV5 A; 3IAM 1; 3DA4 A; 3B55 A; 2FEF A; 4Z7H A; 4OAU C; 4O1P A; 2L1L B; 4YZC A; 5HGI A; 4PL3 A; 2JB2 A; 2YFA A; 2YFB A; 2MJF B; 2ETD A; 4PL4 A; 3AJF A; 3SDJ A; 4G76 A; 4JCV E; 4OAV B; 4U6R A; 4O1O A; 4I1T A; 2BL7 A; 2RAD A; 3P23 A; 2XTR A; 2JB1 A; 2A2D A; 2JBW A; 2IP6 A; 3JSB A; 4HEA 1; 2FUG 1; 2KKM A; 3FVV A; 2V6E A; 1TDP A; 3FNB A; 4G75 A; 2XTQ A; 3DO9 A; 4HFV A; 1YO7 A; 2P22 B; 4Z7G A; 2K19 A; 2V1C C; 4GXT A; 2QZG A; 1U5K A; 3DA3 A; #chains in the Genus database with same CATH homology 3KP9 A; 4YZ9 A; 3LJ0 A; 3L0I A; 4DWL A; 1SJ8 A; 4YZD A; 2E8G A; 3F4M A; 2A2C A; 4AS3 A; 3VA9 A; 5LNK 1; 2F66 B; 2XMX A; 3Q8D A; 4PL5 A; 2ZRR A; 3LJ2 A; 2RIO A; 2JAE A; 3FBV A; 2JB3 A; 3UIT A; 3IAS 1; 3LJ1 A; 1W3S A; 2F6M B; 4Q9V A; 4NV2 A; 4AS2 A; 3I9V 1; 2CAZ B; 4NV5 A; 3IAM 1; 3DA4 A; 4Z7H A; 4OAU C; 4O1P A; 2L1L B; 4YZC A; 5HGI A; 4PL3 A; 2JB2 A; 2YFA A; 2YFB A; 2MJF B; 4PL4 A; 3AJF A; 3SDJ A; 4G76 A; 4JCV E; 4OAV B; 4U6R A; 4O1O A; 4I1T A; 3P23 A; 2XTR A; 2JB1 A; 2A2D A; 2IP6 A; 3JSB A; 4HEA 1; 2FUG 1; 2KKM A; 2V6E A; 4G75 A; 2XTQ A; 3DO9 A; 4HFV A; 1YO7 A; 2P22 B; 4Z7G A; 2K19 A; 2V1C C; 4GXT A; 1U5K A; 3DA3 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...