3AJFA

Structural insigths into dsrna binding and rna silencing suppression by ns3 protein of rice hoja blanca tenuivirus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
92
structure length
92
Chain Sequence
GLSNIVLTCKDLPIPIDLLSLFFDILNERHPSFDEHMFLQMIRKPDDPENLSVFLKSAIWMLSHKRDLPGHYRLPLTCLVSTYSEYFVELKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural implications into dsRNA binding and RNA silencing suppression by NS3 protein of Rice Hoja Blanca Tenuivirus
pubmed doi rcsb
source organism Rice hoja blanca virus
molecule tags Viral protein
molecule keywords Non-structural protein 3
total genus 27
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.190 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3ajfA00
3AJFA
chains in the Genus database with same CATH superfamily
2K19A 2JB1A 3LJ1A 5HGIA 2P22B 4HFVA 3L0IA 4PL3A 2V6EA 3AJFA 4AS3A 3JSBA 3IAM1 2RADA 3UITA 1U5KA 1TDPA 3DA4A 4Z7HA 4O1OA 4OAVB 2ETDA 2XTRA 4YZ9A 2YFBA 4AS2A 2FUG1 4NV5A 2L1LB 3FBVA 4NV2A 4G76A 2FU2A 2MJFB 3I9V1 3DO9A 2GSCA 4HEA1 1W3SA 4I1TA 3F4MA 2ZRRA 3SDJA 2BL8A 2QSBA 3KP9A 3FNBA 2F66B 4PL5A 3Q8DA 2F6MB 3LJ2A 3B55A 3VA9A 2RIOA 2XTQA 2V1CC 2QZGA 1SJ8A 2RLDA 3IAS1 4YZCA 2JB3A 5LNK1 2E8GA 2JBWA 2KKMA 1JQOA 2BL7A 4Z7GA 2XMXA 2HGKA 3FVVA 4OAUC 2A2DA 4PL4A 2A2CA 4DWLA 2CAZB 4YZDA 4O1PA 3DA3A 3LJ0A 4U6RA 4GXTA 4G75A 2YFAA 1YO7A 4Q9VA 2FEFA 2JB2A 3P23A 2QGMA 2ZW3A 4JCVE 2IP6A 2JAEA
chains in the Genus database with same CATH topology
4PL4A 2F6MB 4YZ9A 2A2CA 2XTRA 3LJ2A 4DWLA 2CAZB 2K19A 2YFBA 3VA9A 4YZDA 2JB1A 4AS2A 2FUG1 3LJ1A 4NV5A 2RIOA 2XTQA 4O1PA 3DA3A 5HGIA 2L1LB 2V1CC 3LJ0A 2P22B 3FBVA 1SJ8A 4HFVA 3L0IA 4NV2A 3IAS1 4GXTA 4PL3A 4U6RA 4YZCA 2JB3A 4G76A 5LNK1 2E8GA 4G75A 2MJFB 3I9V1 2V6EA 3DO9A 2YFAA 2KKMA 3AJFA 4HEA1 1W3SA 1YO7A 4I1TA 4AS3A 3JSBA 4Z7GA 2XMXA 3F4MA 3IAM1 3UITA 4Q9VA 2ZRRA 1U5KA 3SDJA 2JB2A 3KP9A 3P23A 4OAUC 2F66B 4PL5A 3DA4A 4JCVE 3Q8DA 4Z7HA 2IP6A 4O1OA 4OAVB 2JAEA 2A2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJF A; 
#chains in the Genus database with same CATH topology
 2K19 A;  2JB1 A;  3LJ1 A;  5HGI A;  2P22 B;  4HFV A;  3L0I A;  4PL3 A;  2V6E A;  3AJF A;  4AS3 A;  3JSB A;  3IAM 1;  2RAD A;  3UIT A;  1U5K A;  1TDP A;  3DA4 A;  4Z7H A;  4O1O A;  4OAV B;  2ETD A;  2XTR A;  4YZ9 A;  2YFB A;  4AS2 A;  2FUG 1;  4NV5 A;  2L1L B;  3FBV A;  4NV2 A;  4G76 A;  2FU2 A;  2MJF B;  3I9V 1;  3DO9 A;  2GSC A;  4HEA 1;  1W3S A;  4I1T A;  3F4M A;  2ZRR A;  3SDJ A;  2BL8 A;  2QSB A;  3KP9 A;  3FNB A;  2F66 B;  4PL5 A;  3Q8D A;  2F6M B;  3LJ2 A;  3B55 A;  3VA9 A;  2RIO A;  2XTQ A;  2V1C C;  2QZG A;  1SJ8 A;  2RLD A;  3IAS 1;  4YZC A;  2JB3 A;  5LNK 1;  2E8G A;  2JBW A;  2KKM A;  1JQO A;  2BL7 A;  4Z7G A;  2XMX A;  2HGK A;  3FVV A;  4OAU C;  2A2D A;  4PL4 A;  2A2C A;  4DWL A;  2CAZ B;  4YZD A;  4O1P A;  3DA3 A;  3LJ0 A;  4U6R A;  4GXT A;  4G75 A;  2YFA A;  1YO7 A;  4Q9V A;  2FEF A;  2JB2 A;  3P23 A;  2QGM A;  2ZW3 A;  4JCV E;  2IP6 A;  2JAE A; 
#chains in the Genus database with same CATH homology
 4PL4 A;  2F6M B;  4YZ9 A;  2A2C A;  2XTR A;  3LJ2 A;  4DWL A;  2CAZ B;  2K19 A;  2YFB A;  3VA9 A;  4YZD A;  2JB1 A;  4AS2 A;  2FUG 1;  3LJ1 A;  4NV5 A;  2RIO A;  2XTQ A;  4O1P A;  3DA3 A;  5HGI A;  2L1L B;  2V1C C;  3LJ0 A;  2P22 B;  3FBV A;  1SJ8 A;  4HFV A;  3L0I A;  4NV2 A;  3IAS 1;  4GXT A;  4PL3 A;  4U6R A;  4YZC A;  2JB3 A;  4G76 A;  5LNK 1;  2E8G A;  4G75 A;  2MJF B;  3I9V 1;  2V6E A;  3DO9 A;  2YFA A;  2KKM A;  3AJF A;  4HEA 1;  1W3S A;  1YO7 A;  4I1T A;  4AS3 A;  3JSB A;  4Z7G A;  2XMX A;  3F4M A;  3IAM 1;  3UIT A;  4Q9V A;  2ZRR A;  1U5K A;  3SDJ A;  2JB2 A;  3KP9 A;  3P23 A;  4OAU C;  2F66 B;  4PL5 A;  3DA4 A;  4JCV E;  3Q8D A;  4Z7H A;  2IP6 A;  4O1O A;  4OAV B;  2JAE A;  2A2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...