3JSBA

Crystal structure of the n-terminal domain of the lymphocytic choriomeningitis virus l protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
173
structure length
173
Chain Sequence
HHDEIISELRELCLNYIEQDERLSRQKLNFLGQREPRMVLIEGLKLLSRCIEIDSADKSGCTHNHDDKSVETILVESGIVCPGLPLIIPDGYKLIDNSLILLECFVRSTPASFEKKFIEDTNKLACIREDLAVAGVTLVPIVDGRCDYDNSFMPEWANFKFRDLLFKLLEYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RNA-directed RNA polymerase
publication title The N-terminal domain of the arenavirus L protein is an RNA endonuclease essential in mRNA transcription
pubmed doi rcsb
source organism Lymphocytic choriomeningitis virus
total genus 62
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3jsbA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsbA02
5J1PA 5J1NA 4MIWA 4I1TA 3JSBA 5IZHA
chains in the Genus database with same CATH superfamily
4HT7A 1FT8A 3QT6A 2HK2A 3CO9A 2WSCC 3FZBA 2XYHB 4B3MJ 1F6TA 3K5PA 2B6AA 1E6YB 4J9UE 1N34F 3OSNA 4C2MA 1IBMJ 3CJQA 3HZEA 2MZJA 5CYMB 3AB4B 3FKBA 2V1CC 5IC6B 2DYAA 1D9AA 2YKOA 5KFYA 4QWAA 4USMA 1T9VA 2F9JA 2FEFA 4QZVB 1GEHA 2HFZA 2FLNA 2W4CA 2EG1A 4J9LA 2AYGA 2DR5A 2YNIB 3CJ4A 4RR5A 1BWVA 3CW2C 2DRDA 4KY3A 5AXLA 5B7WA 2MQLA 2HHSA 5KFCA 3G6ES 4ATNA 1CQNA 2L41A 3RRHA 3W2VB 1K44A 1W2BR 5GAGU 4A8YA 4O23A 6FD1A 1CJUA 2UXDF 2IYIA 4LVOP 1URRA 3RTVA 4KGKA 2Q6BA 4IDKA 1YRTA 4TXSA 3HKWA 1N5TA 4JI7J 1F9FA 3MCOA 2VG7A 2RMLA 1ACMB 1AFIA 1WF1A 1XMQF 2FLPA 4RKUC 4L75A 1HD1A 3SDJA 1U4BA 2RRBA 4DUYJ 1Z1ZA 4NLXA 4QR1A 2GMHA 3KHGA 1N5QA 3M2VA 2XC9A 2R42A 5D0RA 1BXNA 1FRKA 1IN0A 1SKWA 3KJVA 3NNCA 4MYTA 3MR2A 2JWNA 1VOMA 2HQGA 3EWGA 4C8LA 3M8PA 5KG7A 2DGUA 4Y34A 1YWXA 3K5NA 2A18A 4U96A 4RNOA 2DHXA 1HWKA 2HBQB 1NHKL 2E9TA 3Q8DA 2L9DA 4ZLLA 1JLFB 4PXBA 3TAMB 3H4BA 3QGIA 1WF0A 3DMJA 4CT8A 3VTIA 5GMKa 5F8JA 2MXYA 4FXVA 2PGCA 1LWFA 1EETA 4L76A 4FS2A 2CZVC 3ISND 2YWFA 4UF4A 1OIAA 4NEZA 1Y00A 2B8QA 3BS9A 2YQ3A 3GU0A 3M1VB 2MHNA 3K5OA 3D66A 3FBEA 2ZJPQ 1H2UX 4H4MB 3SSRA 5KG0A 4OJGA 2JHEA 4DSJA 2J0SD 1TELA 4J91A 1KVKA 1T05B 4HHUA 2NCKL 1U45A 2ZBIA 5IZHA 1YGYA 1KKHA 2LQ5A 4LF6F 1F9EB 2ZOMA 3MOZA 1WG4A 2VPZB 1MWZA 4F4ZA 3MMAA 3NGUA 3FCVA 1DURA 4UOCA 2HHUA 1ULRA 4Q2MA 4MFBA 3FEZA 4DDFA 2EBGA 2RNEA 4HEA1 1DZ5A 1RABB 2WVDA 1FKOA 4I2QB 4P72A 3U1MA 1HWIA 3MMCB 1YJTA 4RWWA 1RA7A 2YFAA 2ZFHA 2QE5A 3LTOA 3CCQS 1VQNS 1UCNA 1M1HA 5ETOA 3TVKA 1BQNA 2MGZA 1WHVA 4KO0A 3EM1A 4A47A 3GCWP 2ZM6J 2HFNA 2M52A 1OYDA 4UUXA 3M8QB 2CAJA 1YHQS 1GX6A 5IWAF 3MURP 3JTNA 2JBWA 2CUYA 4DV6J 1F1BB 1X9MA 1HR0F 5AE3A 5J2MA 4LSZB 3H2UB 1D8YA 4JI4F 1S7IA 4NZ0A 4N7TA 3CDEA 3UFCX 1N36F 2EPIA 2AWZA 4C8KA 1KP6A 4F4KA 1H2VZ 2HBZB 1EARA 2HLTA 2HQCA 2FVSA 2V5HG 4ZJLA 1M1GA 2DHHA 3ZZUA 1WHXA 4DPXA 1U0HA 4PCQA 2ZDPA 4LBIA 4H54A 3UR3C 2BXJA 4NLGA 2HLUA 1WKLA 3TVYA 2MQQA 2YVSA 1X9WA 2YKNB 3UD4P 4PRFA 4KGXB 5D77A 2JEIA 3N6MA 2HBYB 3QAUA 3KLHA 2QN6B 2ZH4A 2D1CA 4YZDA 1WHWA 1VQMS 2YNIA 3HI9A 1FI4A 4JI3J 4WFNQ 2DTJA 3KHHA 5J1NA 4P9SA 2C2EA 3W2VA 2XHCA 4TQSA 3DLBA 3GIMA 3GE9A 4DFKA 2ZITA 1IBLF 2XTQA 2VBWA 1GQEA 2AZ3A 4UZBA 2ZDOA 2CQPA 1Q8LA 2WHOA 1NKEA 2J0WA 1X9SA 3EXYA 2VG5B 1QAJA 1E6VB 1PO6A 1RT7A 2MZ1A 1UVLA 1B7FA 1SC3B 3M2RB 4JYAF 4R8UB 2DITA 3GV5B 3VR1A 2XTRA 4TYAA 1XNRF 5C42B 1T9WA 1X4EA 2RT3A 2XYGB 4NXNF 1WEXA 1DY3A 1XTZA 4Q5VA 3I5AA 2QFJA 1RTZA 4PWUA 1NK8A 4NYZA 4J9SA 2D3OR 3KLGA 1FKPB 2KZMA 2UV8A 2W4PA 1U24A 3CCVS 3KLIA 4PG4A 2FJWA 1SC6A 2KDOA 3W66A 1JLFA 4PXCA 3UDLA 3P49B 1GMVA 3TAMA 2B3TB 3CEDA 4ECXA 1VQSA 2OMLA 2FJEB 1S0OA 1WI6A 3OTCA 3IRWP 4K50A 1RWNB 1PKUA 3VZHA 4IO9Q 3UDCA 2QIFA 1P8GA 3PJXA 3POTB 3PO5A 4DR1J 4QYZK 2VPWB 2XYPB 3M1VA 2YNFB 4H4MA 1JWWA 3TARA 5B0FA 4DV5J 2XNRA 1A7GE 4NZ7A 2IC3B 5LNK1 4C3LA 3RBZA 1RHKB 4DX8H 1DRZA 3R97A 3PW7A 1T05A 4JV1A 5J2QB 5DO2A 4YR0A 5L8RC 4E98A 4G76A 2W2NP 4QYRA 3MZIA 1U1LA 4EGLA 1IBMF 2VDIA 1V3RA 4CO1A 2XMJA 4MKYA 3VF0B 3I82A 2Z2LA 2W25A 3C6TA 1QM9A 1FX2A 3H5SA 1J5OB 4I2QA 2IA6A 4HACB 3GIRA 2RSQA 1S4FA 2ZC3A 1RJJA 4GKJJ 1RK8A 2AJ0A 2MKSA 2MKKA 3W63A 2CQGA 3N01A 4N5SA 4YR2A 3NAIA 1PSDA 2IMWP 4ZP7A 1YITS 3OR1B 3HHLC 5D6GA 1TL4A 1YJRA 1HYSB 3CJ0A 3B6BA 5HAOA 4ELVA 3EVWA 3R5DA 3MR5A 1FDNA 2UXBF 1GNKA 2OPPB 1Q7LB 3MCNA 3D6MB 1RHQB 4IO1A 2VB6A 2HVDA 3VZIA 2HG4A 2V4JB 1IKWB 2V9KA 1XK8A 2W24A 2PDAA 2JNJA 3KWMA 1CEZA 3KNGA 4EZ6A 1FRLA 1SJ4P 2HZVA 1FD8A 9ATCB 2DB1A 1SIZA 2M88A 3ZXWA 2XY7A 1TUVA 3PTWA 4RO0A 2XWXA 5CCLA 4EFAC 4Q8FA 2M5YA 2G1HA 3PFOA 4WXOA 5B0DA 2HFOA 5C2CA 3I32A 3GJTB 4QIEA 1NLKL 1F5AA 3BF4A 1T94A 4I67A 5IQQA 4K4XA 1FVSA 2BW2A 1S12A 1DTTB 5BXIA 4ZN1A 2CJYB 5LSRA 3DGPB 1S1VB 3C19A 4QR2A 5EHHA 1FXDA 4XPEA 3HHKA 1GMWA 3M6WA 2B9XA 3I4PA 1RTHB 2F5GA 2BZ2A 4K5RA 4J5OA 4YR3A 1H7XA 4O3NA 2CPJA 4ZOSA 4K5SA 2CJQA 2W01A 1ZPWX 5H9FJ 4WP9A 5J1PA 3T9NA 3PEJA 2OLWA 4OYIA 5IS2A 1U5KA 1KRPA 2FHJA 3DDIA 2IM1A 4DV2J 2L1LB 3CMES 3NGTA 2BANB 2I8EA 5KFQA 4ILMA 5I3UB 5AT1B 3OW2R 1CPZA 5G4DA 3M2RA 3AOAA 1PBAA 2ZZTA 2BYCA 1CQMA 4P2SA 3VA9A 2VC0A 1NDLA 5C42A 3N0VA 5KG5A 2H48B 4ZDNA 2QJ3A 3WIUA 2MJUA 4JI0F 5G0RA 4ZPBA 1YTYA 1RU2A 3QFWA 2ZVSA 4ZIVA 4DV0J 1MLAA 4X62J 1FKPA 2Q66A 1R89A 3OL6A 2GS8A 1R6YA 1WTFA 1VISA 3CE8A 3M05A 2ZM6F 2RS8A 4ZVUB 3W3SA 4DF8A 2M0GB 3H4DA 5JUMA 3I55S 2MY7A 2BL7A 1ITPA 2ZKUA 5FDLB 5AJ3F 4ED7A 2BACA 3C66A 3VGUA 1WC6A 5DQHA 2UVVA 4QQBA 2ILYA 3GG0A 2BDPA 2YNFA 1S0NA 1XEZA 1R8HA 5LMUJ 3QMQA 4B3RJ 3ZTSA 5F3TA 4WYLA 2M8DB 5E3AA 3X3UA 2DJWA 2MLXA 1VQ4S 4RL1A 3LP2B 2EBEA 4DEZA 3JSBA 3BR8A 4OYBA 3IBFB 4A8QA 2HIYA 1NNDA 3EGWB 1TKXB 4B3TF 2RQKA 3DLGB 2C2DA 3HO1A 3OV7A 4ZVRB 4DV3J 2G1DA 4CLZA 1J27A 1J5OA 5LL6d 3E2EA 4HACA 1ZS6A 2BEFA 3FVYA 1HNIA 4DX5A 7AT1B 3C14B 3KG1A 4HI1A 3US5A 4WFZA 2D3O1 4ED8A 2DO4A 1AZSB 4DR2F 2IM3A 2VJUA 3FSYA 1CG2A 4RW7B 4OX9J 4CH7A 5A6PA 4ZVEA 2J8SA 1RWMB 3NGRA 4I56A 3QPIA 3F4MA 4URQU 4G1IA 1HNWJ 3M6VA 2V4JA 1IKWA 3JQKA 4LT6A 4ED3A 3GV7B 1R8AA 4IOAQ 1VRUB 4RUAA 1NO8A 3DU5A 2OMOA 3W5ZA 5HVHA 4P10A 1P1TA 1HNXF 2K06A 2N3LA 4TNOA 3E3XA 2QX0A 5EUHA 1YG0A 4ZN3A 4F8RA 2DHGA 1DARA 3CDBA 2EG2A 2XMMA 2E9ZA 1FF2A 3I6PA 2OO4A 5DRKA 3AT1B 2DGSA 3R2DJ 3MM9B 1PILA 1VIOA 3SMZA 4MKVA 4CP5A 2M70A 5D4OA 3CVKA 3WDOA 2AX1A 4FBTA 5CD4A 3MAHA 5CYQA 1S79A 2ZH6A 4Y28C 2RHSB 1U2FA 3MEKA 3IM8A 5AXNA 1U1MA 1DFDA 5H1SV 1T0TV 4WWSA 3TWZA 1TK8A 2MDAA 2IJFA 5LOQA 4DOZA 3LO3A 2IVFB 1DTQA 4YB7A 3ZTPA 5E0OA 2DD8S 1OS5A 5LJ3Y 4G1QA 2BANA 3W5YA 1RBOB 3M30B 3DRPB 1XERA 4O3QA 2RS2A 4P71A 3AD7C 2V34A 2VD3A 4LF4J 2AYBA 1ELOA 1CJTB 4U7UK 1D09B 2I38A 2C2ZB 2JVOA 4GKKF 4KSEB 2O67A 1FRIA 2XZTB 1CULA 3TNVA 2FHOB 4HR2A 1H72C 4LQ3A 2DGTA 4YQWA 3UNYA 2HFVA 2LXIA 3ADAC 3CJTA 1CVJA 4DQIA 1B0TA 1KD1T 1AYEA 3AOCA 4PKDB 2KXHA 3B78A 3PZPA 2DXDA 3CMAS 4RW8B 3E8OA 2G2YA 2Y3YA 5FDLA 5HJXA 4A48A 2B43A 4DL2A 2B56A 4M63A 3HFZB 4DL5A 2RKIB 1FNOA 4RW6B 3VAKA 1U25A 3AD9C 3R5GA 2VA3A 4U8YA 1C4CA 3ETMA 1TL7B 4DWLA 2ZNZA 2B4VA 4B9UA 5ETVA 3BDEA 3HHNB 3RW7A 3IN5A 5H9FK 3G96A 3V6HA 4L73A 4ZCMA 3CC2S 1TKXA 2ZH7A 3MECB 3DLGA 5F0WA 4NLPA 2V6EA 3RB4A 2Z8QA 3NBPB 1B64A 2M7SA 3JSYA 4J90A 4LMZA 1MG7A 4KGMA 1S49A 1S1XB 2JL9A 5IM0A 4JV0A 2F8MA 1SUQA 3FBVA 2AEJA 3EZUA 1NJWA 3IRXB 1DQAA 1AZSA 1UPPA 4CLLA 1BLUA 2BV3A 3OFGA 5KFDA 1LFWA 3QLHB 1DLOB 4C9DA 2COLA 2Y0BB 3G71S 5I3QA 1VI7A 3NG8A 4KJIA 4I6AA 1YX2A 2FHJD 5HMYA 2OEKA 1ZTWA 2QGFB 4CWBA 2E44A 3QT5A 6AT1B 2KXFA 1NMEB 4WPAA 4JI5J 4DX7A 5C25B 1ZA2B 1MWYA 2WW4A 4USTA 4P2XA 1VQOS 1IKXB 1VRQC 4LFBJ 1NPRA 2NYIA 4RU2A 1FJEB 1PAUB 4I4BA 2DR6A 1TKDA 2R8JA 1F9HA 1FD2A 3HP6A 4DV0F 1UFWA 3AA9A 4X62F 1ZAVA 4TU7A 4TY8B 2HHTA 4DUTA 2VODA 2QLWA 4DSEA 1LKZA 4HEA9 2MJNA 4OYZA 2KO1A 4B9NA 2RRNA 4DR5J 2WAQD 5GMEA 4IQMA 4CIOA 2DNHA 3LP1B 1VC0A 5K8MA 1WG5A 1YLXA 4YDDB 3MM9A 2AIRB 3VV2B 2VIHA 2DCUB 3QRPA 1NRKA 2EXUA 1REVB 3UN5A 2YX7A 5DLFA 1HQ2A 4C3MA 2XULA 4ZP9A 1EJ7L 5L9XA 2GZOA 3L3CA 2KM8B 3G87A 2B4PA 1RWVB 2B8PA 3ENWA 5ETLA 2KT2A 3BN7A 2R2UA 3DLJA 2FDNA 4B3RF 2I5JA 1IM4A 1Y3JA 1UVJA 3DA4A 1KNZA 2QLJB 5F8HA 2P9EA 3J7YU 1RISA 2CQ4A 3OVAA 4BBYA 3HHLB 3D68A 3M30A 3DRPA 2ROGA 1G2EA 1WSVA 4WIIA 3CCJS 2RB7A 3JSRA 1VQLS 1R0AB 4LF7J 3TW0A 2H9ZA 1J5EF 1SV5B 1CJTA 3OJSA 2V50A 4C8OA 5T41A 2W9BB 1XJWB 3PACA 2HWTA 2QL5B 2KZZA 3H5YA 5DG7A 4NX9A 1TAQA 1V5IB 4K2JA 1M5OC 3TANA 3T1YF 1WJ9A 2XM3A 1YRUA 2A6MA 3MFHA 2VFVA 1NK7A 2FD2A 3CCTA 3TX0A 4XDDA 2DH8A 1GTEA 4F3OA 4KIAA 2MKYA 4B3SJ 4RW8A 4L6V3 1HNWF 3IGNA 5JVGQ 5LJ5Y 3I4HX 4ELTA 2FZGB 1NSAA 5CA5A 4HDHA 3PRVA 2F40A 4RW6A 4USVA 1ROFA 5KFGA 2BE7D 1MMNA 1ZPVA 5KFLA 3JAMU 3DRYA 1A0OB 2OGUA 1RKJA 1TL7A 2HQ3A 1WDDA 4FXDA 2JAEA 1FNMA 1GH8A 4DPTA 2EFGA 1N32F 2XG8A 2F4FA 3EVMA 3R3TA 2W2OP 4MTPA 4CYUA 3TP2A 2WW8A 4C0HA 2GMJA 5K20B 3S6EA 3NBPA 1WEYA 2B51A 4I6WA 3DO9A 4ED5A 5DQIA 2NPIA 3B4MA 4K59A 4LBHA 1LFPA 1RTDB 4DJBA 1C1BB 5IT9U 2F65A 2DCLA 3IRXA 3Q8QB 1Y3KA 4ZCLA 1D1UA 1FRJA 4LREA 2IP6A 4KB7A 3OL9A 3UCZP 1PG5B 2AYMA 1K73T 3H20A 2F8EX 3IA0A 1FWPA 2RRAA 3O8WA 3AHPA 3SQOP 4CLPA 5J1EB 2EC0A 3MR3A 5F9LA 4RNMA 4YY3J 3TO8A 2EKYA 3NS7B 1QUVA 4TY9A 4EBCA 4HHHA 5BJRA 2LLZA 3VQTA 1HBUB 4PQUB 5HQ8A 5HP1B 3J7AN 4CLFA 2Z30B 4OYXA 4ZVTB 2MJFB 1XN9A 4DN9A 5C2GA 2KJVA 1IKXA 2HNYA 5GAHU 2WONB 1S10A 2UVUA 4DR7J 3NCPA 1RT1B 1X4FA 2VU5A 1AB8A 2I1RA 2J8AA 3LPYA 4P7VA 4ETXA 2DGXA 3OT9A 2NXNA 1UZHA 3OUYB 4FYWB 4WTOB 1IQTA 4J9VA 4R0EA 4EYIB 1N54B 3C3LA 3QATA 2YWEA 2U2FA 1KOOA 2AGPA 2GVZB 4OLOA 4YN3B 2DNPA 3OHAA 1M5KC 3RAQA 4Q44A 3QIPA 4CDIA 5DDQC 2EI5A 2A2DA 1YBTA 3IWLA 4ELUA 2V94A 3CJKB 4CLTA 2HVHA 2QC3A 2ERRA 3SCKE 2XMVA 1NHUA 3R6LB 4P7TA 1T9UA 2R7UA 4AT1B 4OZLA 3BH7B 4AYBD 1HKAA 3CD0A 1HIYA 4YP3A 2YBVA 3OFHA 3ET6B 1XMOJ 1FTRA 3HHDA 3HHLA 3RRGA 4ZMMA 3GP9A 2BRKA 2JC1A 1LW2A 1L3UA 3VAIA 2Z58B 4WP8A 4W90B 1TL3B 4MYUA 3FK4A 4OJ1A 2IDEA 2R8IA 3BPSP 3RBDA 2HS3A 3M8RA 2EVZA 3DDNA 3BKTA 1U26A 3BO4A 2XS5A 5K8NA 3HX9A 1NU4A 5BYQA 1JXVA 1WC3A 3T6JA 4LSNB 1TL1B 1TKZB 2WSEC 3W8PA 4OAVB 1FRXA 3PYEA 2UXCF 3FCHA 4FPRA 3DOKB 2YWGA 1JJHA 5M2RA 3QIDA 3Q0AA 2OJ3A 4U7CA 4CI0B 2QZGA 4LR8A 2OPSB 3HT0A 1BHNA 4KHPJ 3L7UA 3OPKA 4LF8J 3P96A 1S7HA 5ETNA 4LRFA 2D3UA 2GHWA 1JLQA 4AQYJ 3CD6S 5A8RB 3LQVA 2Z2MA 3I5BA 3IXQA 2QL7B 2HGMA 1VK8A 3AOBA 5CQGA 3IWNC 4RW9B 4EBEA 1IBKJ 3N4WA 4J9KA 4DLGA 3TA1A 1NB2A 3OQ2A 1M0SA 3DN9A 3HT3A 4WE1A 3EDRB 4DFJA 3W9IA 1FFWB 1PBUA 1I94J 1HI0P 2P2CB 1NPPA 5B0AA 1JK9B 5LMNF 3NS5A 1S1UB 4KFBA 2DEIA 2GV1A 2BBEA 1R0BG 3QZ7A 2JB3A 2NXCA 5IOLA 4DR4J 3HJVA 3EDQB 3WC2A 3AJDA 1HBMA 4ZPCA 1FRMA 3BGRB 3HFVA 1CC8A 1WC1A 2SXLA 2ILZA 1S48A 4PPDA 2HNZA 5M2UA 3UVJA 4DQQA 3LJ1A 2K1RB 4J9NA 4IG0B 1QLNA 1VGYA 4X66J 5HBMA 2ROEA 4PUOA 2OH2A 5J1EA 1HNZJ 2DNKA 5HQLA 2B5JB 4H4KC 1HBUA 4PQUA 4DR6F 4OV1A 2R7TA 3V5RA 2X1GA 2NXJA 4M5HA 2HGNA 5LM7E 4QBUA 4C48A 3A3NB 3IBWA 4LF5F 2J9CA 4BLGA 2KTQA 2XGQA 1RLCL 2WONA 5CCMA 4MKBA 1H73A 2YWWA 3KHRA 3D9BA 1RT1A 3NAHA 4IKAA 1FWLA 3RYLA 2GVDB 2MHEA 2VBXA 3OUYA 2FGOA 1BUXA 4CLUA 1S9FA 2RADA 2G0CA 4ZK7M 4Q45A 4OI6A 4WYWA 1K1SA 1BGXT 3HULA 2C3MA 1LOUA 3PO4A 5C24B 2PI4A 4KKOB 3MTJA 1S76D 3GFYA 1YZ7A 1LWCA 2B7CB 3GV8B 3UE2A 4Z2XA 4G3IA 2X1FA 1TDPA 4ZITA 2VOOA 2X1AA 1SKRA 1RT2B 3W9HA 4WCEQ 1JNZB 2FGCA 3GPAA 2YPYA 3ET6A 2MKJA 3FMWA 5CABA 1FDAA 1S1TB 4EK2A 1JLBB 3K0JA 3UI3A 3V6DA 1FCAA 3VGSA 1EQ0A 2LP4A 2BQRA 1AROP 1KLMB 2X7IA 2HAFA 5J2PA 1TU0B 1TL3A 1IJFB 1W3SA 5HROB 1C0TB 4X64J 2VHGA 3N9UC 4DR3F 4AUKA 3ZC4A 4LSNA 3GR1A 1ICEB 3EE3A 3IAM1 4LRBA 4F0MA 1S77D 2C2OB 3DOKA 1LW0B 2NUUG 1TK0A 3TZXA 2F7VA 2P22B 4U6PA 3M8SA 2FJXA 1I5OB 3OBIA 3WHIA 2V2VA 1NEEA 2DY9A 1S97A 2BE9B 3J7Z5 4ECQA 1VR6A 2OPSA 1FFGB 2A10A 3BB5A 1VQPS 2X51A 2LFVA 2CQDA 1LXJA 1NH8A 4FF4A 3QGHA 3IS9B 2D69A 2AEMA 2KFZA 4UOHA 3H25A 4E8UA 1N48A 3MGJA 3HVRA 1HBOB 1NB7A 5A8RA 5FD1A 4JI1J 2ZUGA 2CJKA 1RI7A 3I5CA 4RW9A 4WZMA 4CQ1A 3W61A 1UA0A 1RBLA 2YNHB 4KYZA 4U6RA 3PX4A 4K4VA 3IFEA 2ZH5A 1IKVB 3K58A 2J7KA 2LQJA 1KOHA 2HRYA 4EZ9A 2JDJA 2FU2A 3LANA 2XMKA 3T1HF 4OX7A 1BQXA 2U1AA 3D0GE 1VK3A 2R2RA 1WTBA 1RYRA 2D3ZA 4OLPA 1N34J 3MAAA 1GK8A 3M8WA 2OUGA 2AF6A 1NH7A 1GAOA 4KC5A 3UDVA 1HPZA 2V8DA 3R5JB 2BABA 2AT1B 2FVQA 3BH6B 5DJBA 2VZ9A 2CG4A 4UOFA 3P6YC 3VWSA 3MM6B 2DPIA 4K4UA 3HVTA 2V9WA 1XMOF 5ETTA 1Y9OA 4PL4A 2B5JA 3T3FA 1IQZA 1TKTB 3HHLD 3UCGA 3MUTP 2QLBB 4DQRA 3QSYB 1HQUB 4ED1A 3L7PA 2R3VA 3DLEB 2I0XA 4GO7X 5FIIA 2RUSA 1FX4A 3W1YC 3TUJC 2NLWA 4DCOB 3CNQP 3AQOA 1XMQJ 3THVA 4C11B 1RU1A 3DA3A 2HVIA 3QGGA 1VBYA 2GVDA 1MNEA 1VJQA 3R5AA 2KG1A 1S6PB 3Q23A 4EBDA 2L3MA 2DH7A 1K0TA 2EWHA 3MM7B 1V3SA 2FVCA 1UKUA 4LBPA 4KHPF 2CPEA 4JI8F 3FCWA 4LF8F 1ZA1B 3N6LA 2FJDB 4KKOA 3H98A 1KVJA 2ZHAA 4YFUA 4DBQA 4X4UA 2H4WB 2P9CA 3P3DA 4O3SA 4DWIA 1RT2A 4S0MA 1PJ6A 2GHPA 4DZDA 2JOQA 1C2PA 3AJFA 3VALA 4A8FA 1S1TA 4NL5A 3ULHA 3MPYA 2W7AA 2FJVA 4H4OB 4ZLNA 3GQCA 3NGKA 5DLGA 1KLMA 1NCLA 3CIZA 3G8SA 5HROA 2J6TA 5CD4H 3BSAA 1C0TA 2C2RA 4LF6J 2KH9A 2N7YA 1S9EB 4DX6A 2CQ3A 4LFAF 4WU3A 3DLHA 5EN1A 4CZCA 1Q5YA 2JVRA 3MMBB 1C1CB 3FFIA 3CCSS 1YBAA 3LUYA 1TTHB 4UQTA 1N5YA 3MEGA 5LXRA 4DI6A 4X66F 3A8KA 4GO5X 5EX3A 1HHQA 1UJ4A 1RT5B 3IS9A 3MPWA 1L3TA 4YB5A 2MKHA 4OMFG 4Z7GA 3HXMA 3G6YA 4ED6A 2F66B 2DGWA 3CCMS 5T14A 2WVBA 1RADB 5IWAJ 3BQ1A 2IRYA 1QDUB 1HR0J 4UOGA 1JQOA 3BYRA 4B9TA 2JSXA 1OWXA 4JI4J 4LVNP 3D54A 2PEHA 3D6FB 2OEMA 5L46A 1N36J 4IOCQ 2Y8YA 3RUBL 2VBYA 2F4VJ 3MI7X 1CLFA 2G0IA 3HLUA 1RT4A 2BQ3A 4U7UD 3ITHB 1UTAA 3BM7A 7FDRA 3RRKA 2APOA 1SC1B 4NRUA 4P74A 3UN3A 1JLGB 3LPEA 4NWBA 4WFYA 3K57A 2MKIA 4RW4A 5HI7A 2O5DA 3DKDA 1MMLA 4P6QA 1V9OA 2E5HA 4B17A 2KG0A 3P4UB 3OTBA 4KV8A 4ICLA 3ISZA 2IAJB 3D6HB 2W9CB 2N4DA 4ZHRB 4TKTA 3JAMY 3MM6A 4DL6A 1RAOA 1S9GB 3W8GA 5E33A 2N7CA 2IHR1 4FYXB 1T3NA 1TKTA 3GB0A 4WXWA 2LECA 1HQUA 5I4MA 3DLEA 1VDHA 3DDKA 4GVBA 2B4OA 1SJ1A 4FVMA 5DS7A 2CQIA 3R7NB 4X4VA 2YY3A 4LF9F 2XBPA 4UT4A 4O4RA 3FNBA 1QSYA 1FNXH 1ZM2A 2QLFB 1JMTA 1SQEA 1H3DA 2DKOB 4X64F 2RQCA 2R8HA 2ATLA 3DU6A 5C5JA 4JYAJ 4FS1A 1RBAA 2F8HA 1HA1A 3H59A 3RBEA 2E66A 1KQSR 5T7LB 4PABA 5CHCB 2E7VA 1XNRJ 2PT0A 4OYOA 2W7PA 3A3OB 3L09A 1S6PA 2OP5A 4NYOA 4NXNJ 3CD5A 3W2WB 3RB3A 4F36A 1Q53A 4NMLA 4DF4A 4USIA 1Y10A 5KFZA 3PR5B 4IRDA 5LXYA 2C42A 3IMQJ 4O1PA 1S99A 3PJWA 3A4TA 2KYXA 4DV7F 2DNMA 1MN9A 3TZYA 3F44A 2DHAA 3RR7A 1F2HA 2GIFA 4B3OB 2BQUA 4TU9A 3DM2B 2QLXA 1NJXA 1B70B 1XR6A 2A1BA 4NA3A 3BGFA 2RLDA 2QSWA 4U8VA 2H51B 3G4SS 1EZZB 3OR2B 2DNQA 3ENQA 1LWEB 1JXEA 3IG1B 4RBVA 1T9TA 3EGNA 2B9EA 4WU2A 2AD9A 4H4OA 3M2UA 3R27A 1RXOB 3CIMA 2J9EA 1KHWA 2QMWA 8RUCA 1K1QA 2BE2B 3NMAA 2Z4PA 2QEXS 1IR1A 1FXRA 4AE5A 1B99A 3PKMA 4UUWA 5J2NB 3G86A 1H38A 5DGAA 1IR0A 2C3PA 2DT9A 1JQGA 3MMBA 1JJCB 2X3DA 2NS1B 1SJ8A 2UVRA 1C1CA 2C2MB 4QYZJ 3J7A1 5HL7Q 5HO4A 3CWJA 4UY8T 2R2SA 3BKUA 3HSGA 3OVBA 3WX4A 1G3OA 4X65F 2ZBCA 1SVDA 1HMVA 2FUG1 4J9MA 4OL8A 4NMXA 2IVYA 1WOOA 1RT5A 1X4AA 1UWAA 3H5UA 2RIOA 3WX8A 2LMIA 2UXBJ 2F1FA 1KR4A 1TZ0A 3NXZA 1JLCB 2PN6A 4I69A 2MSTA 1M5HA 4ID8A 2YX4A 2JH3A 2AJ4A 4B9LA 4B02A 3QNWB 1KQFB 2VKZG 1RAAB 1O0PA 3O5TB 3C15B 4DG1A 1FJGJ 3MM8A 2BJ8A 5L9NA 3HK2A 3MCSA 4LUBA 3G82A 2M4MA 5D15A 1NDPA 2A6OA 4K4WA 4DCPB 5KFUA 4R0JA 1F0XA 4DU8A 3KUGA 2PEBA 4F4WA 3ITHA 3MPVA 1K47A 4HI2A 5KFHA 3UWTA 1X5SA 1PIEA 1G4CA 1X4BA 1YSJA 2V2ZA 4DZ6A 3J81U 2XCAA 1X4GA 3CCLS 1KN6A 2XO6A 1RT6B 1OY9A 2QA4S 3S1TA 4BWJA 3HDSA 1RQ0A 3LGNA 2XGPA 1U1PA 1XBWA 1L3VA 1TK5A 4HTIA 2W9CA 4KHMA 4ZHRA 4N8NA 1S9GA 2UZAA 4NLUA 2CQBA 3G8QA 1KTVA 4ED2A 2C3OA 1N52B 1NK5A 3ENAA 2AV5A 2AJ2A 2XWYA 1FXLA 4DS4A 3KFWX 4DL3A 3GJRB 2VASA 2W8LA 1UVMA 1LWXA 4MAKA 1WKKA 1NDKA 2HFUA 3KMSA 4Y00A 2HW3A 3EXCX 5T7LA 2ATCB 3R7SB 3MHYA 4L74A 2LXFA 4NCGB 1ZTTA 2MQNA 2D9PA 5KT4A 5E7OB 3V2UC 3F73A 4XDCA 2UUAF 4F2SA 3W2WA 4JI0J 5HVGA 4FYYB 4DSFA 4Y2MA 1X31C 3M6UA 1LXNA 3KJFB 3D3CJ 4I2PA 3DHWC 4DPWA 3SCLE 3AB2B 4B3OA 2A0FB 4KBIA 5JMNA 3KUEA 3NGSA 1PAEX 2BMBA 2W9AA 1JLAB 1SI9A 1FEHA 4ZPTR 3EJMA 3TEGA 5IV3A 5KFVA 3OR2A 3HSJA 1KTQA 5AJ3J 4BDPA 3ETOA 1S5ZA 2Y1RI 1TL5A 4O3RA 5F41A 4CH1A 3IG1A 4LSLA 3A8EA 2IRXA 5THWA 2BKOA 2Q1LA 2WRMA 3NLCA 1RAJA 3NKYA 3D1OA 3LF0A 2ZH1A 2DNRA 1HQEB 4I7FB 2F4VF 2GHVC 5AXMA 4TN2A 3HMJG 2KB2A 2MQ8A 5DG9A 2PI5A 5BYSA 4OI2A 4FBUA 1H74A 1P9YA 4MK8A 2BE2A 9RUBA 3MCMA 4X4QA 1XQIA 5D3GB 1E6YA 4NCBA 1X4HA 4H4KA 4IFYB 5CYMA 1RWOB 4CT9A 3PW5A 3BQ2A 4B3TJ 3GYXB 1ZOTA 2KRBA 4J9QA 5L38A 1P9QC 2DPJA 4YHHJ 3FUYA 2J9DE 2E5LF 4FP9A 4P73A 5CZXA 2ASJA 1RWXB 3O44A 1VQ6S 4IUFA 1UL3A 2IMOA 5BYRA 3R9LA 3F56A 1OO0B 3ZTRA 1BY9A 2ZBRA 4ENOA 1H7WA 5AXKA 2WBMA 1YO7A 4DR2J 4Z7YA 4YZCA 2HZCA 3GONA 1D0EA 2QV6A 4ECUA 4OHZA 3B8HA 3LAMA 1CBKA 1HNVB 4AD6A 1SXLA 2JLGA 5KFPA 2JRSA 2O01C 5IC4B 1JLCA 1G1XA 3MM5B 3KJQB 4QJVA 4DMZA 2BOAA 3GILA 2K7JA 1H6KX 3BJYA 1FE4A 2HHHF 5GADU 3GYGA 2POKA 2QT7A 4I64A 1RHJB 2VH7A 3R1HA 1X8DA 2V8VA 1S0MA 3V6KA 3BEGB 4LJMA 3TRGA 1HNXJ 2R8KA 1ZM4A 1EKSA 4LIWA 3DGVA 3FEYB 3AXMA 3QAEA 2XMWA 3IAM9 4YUDA 3JXOA 4JOUA 2UU9F 2IM0A 2A3JA 3OTOJ 2CXEA 2YX1A 4U67Q 2HZAA 3OFEA 2HAIA 1SC4B 1Q16B 4EMDA 4ED0A 1U09A 1YZ6A 4ILRA 5U47A 2F3JA 4M1KA 1GXTA 1F2GA 1F3FA 4I0WA 1VQKS 1S72S 2BJ3A 2M2BA 3H5XA 3I0SB 1VFJA 3C46A 1HD0A 3PEHA 2NUHA 1GFWB 2RH3A 1FEEA 3Q83A 1U8SA 4PWDB 2CNNB 1B0PA 4A8MP 4QR0A 4LFCF 1RTIB 3CXCR 3FQKA 2BM1A 3BBCA 3PYGA 2E9RX 1TR0A 3HCXA 2H65B 1JLEB 4RX6A 2KM8C 4NV2A 3L0IA 3IO1A 5HMWA 3DYAB 2IYGA 4XIUA 3MMCA 2LEBA 1HBNB 3NS6A 3LH2S 3TUZC 4G75A 5ITHA 4ECWA 4GKKJ 2ZC4A 1NSPA 3FNNA 4RNNA 2MMYA 2LQBA 1AA1B 1SH3A 2DNZA 3MEDB 3NNAA 2GIQA 2VKRA 5KFIA 3BREA 3M8QA 2E1CA 3PX6A 4ZCKA 1JLAA 1WELA 3EX7B 3LAKA 1X5TA 4QW9A 2RQ4A 1M5SA 1R43A 4FZVA 2ABYA 2RE1A 3FDSA 1FJGF 2E5GA 2XI2A 1N0VC 1HQEA 1NK4A 3MR6A 2AEFA 4HH0A 4BWMA 3CJSA 4MK9A 1TQLA 1QVFR 2NQPA 2QFIA 2YH0A 4NASA 1UVKA 2WSFC 3OTEA 3BPDA 2ZH2A 4IFYA 3R2CJ 3AJ1A 1F3VA 5CXTA 3BGOP 3QO9B 1W25A 1QTNB 5A0YB 3NMRA 1TUGB 4OV6A 4KH0B 1ZBTA 2YKNA 4QPXA 1YVFA 5A6WA 4AXIA 4TYBA 1IVZA 1U2CA 1HW8A 4R25A 3HM9A 2MQPA 5EX0A 3CUNA 1U6FA 1FDDA 1NSKL 2GFFA 4HVZA 4DSLA 2RQMA 1GT8A 1BC6A 2DH9A 1K9MT 3I9ZA 8AT1B 2PC6A 5E3RA 4QIFA 4IFVB 5IFMA 2MQOA 3FSXA 4MH8A 2CJXB 2KL8A 4KGZB 3WZ0A 3EUNA 3V81B 1UJ6A 2VG5A 3CGIA 3MM5A 3ZFVA 4CLKA 1E6VA 1RZMA 2YNGB 3RBXA 4R8UA 2B6AB 1OJ4A 1U1KA 1X7VA 2BL8A 1S6UA 2DNNA 1Q5VA 1UW4A 2R7VA 3Q8UA 1YJUA 3X1LB 2PA3A 1RKIA 2ZJRQ 4XO0A 2K3IA 3N5BA 4ETZA 2R4FA 4HYKA 3PDNA 1QSLA 3AD8C 1CS4B 4KE5A 3VQSA 3V4IB 2XCPA 1UEKA 2AHOB 3K7RA 4YMEA 1MU2B 3FRYA 1FJCA 2KU7A 2LEPA 4WFAQ 1T8EA 2EFNA 2P8IA 4J9PA 2YWKA 5F8MA 3FBCA 3CJ8A 4GXTA 4DU7A 2V8HA 1RTJB 2PA8D 2ZEJA 1TFWA 4USKA 3RZAA 2XLKA 2B7BB 4OZ0A 2JLEA 2IJRA 3PRDA 5KT7A 4C8NA 3MFIA 4A8OA 2R7WA 4O0NA 3JQJA 3POTA 2UUBJ 2JX2A 3KG4A 5KG2A 4WF9Q 3O6QA 4WIQA 2ZWPA 4EU0A 1NJYA 3I0SA 4RNFA 4F3QA 4DFPA 3AA8A 3MD3A 2IC3A 4DL7A 3SSQA 2DIUA 2RIJA 5J2QA 3Q8VA 4NXMF 4OHXA 3S7RA 1MN7A 3KJVB 2D9OA 2J7WA 4PXEA 3Q8RB 2Y0SD 2NR0A 4EO6A 4FYVB 2XMUA 4N77A 3THTA 4YHHF 1AUSL 3FMBA 1J5EJ 2FY1A 3LJ0A 4Z7CA 4I1TA 1UEUA 4FN5A 2CQHA 4L3NA 2VFTA 5KFWA 1WF2A 4CLYA 3M7VA 4K7QA 1EETB 1EIYB 3OR1A 2VONA 3FGVA 3T1YJ 4FPIA 5DDRC 1FHTA 1HYSA 2LEAA 2E7WA 2CJ9A 3S8SA 2UUWA 3MEDA 4AXJA 4WP3A 4USUA 2YXLA 2OPPA 4NV5A 2XQCA 3GSDA 3H2LA 2GCFA 3DRSB 4F0KA 2ZD1B 1FERA 5DG8A 3ZZ0A 4F25A 4UQGA 1EQMA 1Q7YT 1TP7A 1FA0A 5ETMA 2DRAA 4RNHA 1VCTA 4RBTA 3KK2B 3MMAB 4CLSA 2OI2A 1T11A 4OAUC 4FF1A 2VUGA 5C7PA 4MFBB 2Q6CA 4DSIA 1QE1B 2W2PP 1L3SA 1NJZA 4ZVHA 1JXLA 1N32J 1I3OB 4ES3A 3KXDA 3Q8SB 1ZETA 1MMDA 4Q8EA 1FWKA 5DGBA 4PWWA 3RJMB 2XO7A 2FIUA 3UW1A 3OTOF 2E1AA 5A0YA 4Q0BB 1BQNB 3R5CA 2MGZB 1DTTA 3ZZZA 2GQQA 3DGPA 1S1VA 1LNQA 1IKYB 2CIMA 4F3MA 2LU2A 1RTHA 1RGVA 2ZZNA 5J2MB 4JI2F 4C8MA 1RT3B 3SCIE 4IFVA 1LK7A 2ASDA 4M94A 4K8RA 3F41A 3ILJA 5D4NA 1KVIA 5KG6A 4DPUA 3AODA 3ILLA 3AY0A 2GQ2A 1LEOA 3QSIA 4FF3A 5CZVA 2YNGA 5I3UA 4OZ1A 2VPXB 4EYHB 4M5DB 1U0HB 4QOTA 3BKFA 2J0QD 3CCES 2VBZA 4O3OA 2MQMA 4Y65A 2GO9A 1CS4A 2GNKA 3V4IA 4DV4J 4RUHA 3KLHB 4G65A 1NK6A 1MU2A 4C4WA 4DCJB 3PNIA 1VLOA 5DM7Q 2CADA 4ZPDA 3GIKA 4C98A 1R0CB 3SBMA 2BX6A 5L1LA 2LXUA 1RTJA 2HK3A 3H42A 2AYEA 4DV1J 5EGYA 2EFVA 2XHWA 3NNHA 1GTHA 2FUG9 4GVLA 3ZZYA 3IAS1 2FJBB 4ER8A 4U95A 3B55A 4Q43A 4HH1A 4ZPAA 1X5PA 4ZIWA 2Z2ZA 1A6LA 4YS2A 1RT7B 2AJQA 2DO0A 1WOSA 3R1LA 2GQCA 3L4BC 1XNQF 5KFXA 3TUIC 2B9WA 2RHQB 1HHSA 4D3GA 4Q7AA 1HWUA 3SDEB 2OD6A 3C16B 5GVQA 2HWHA 2QL9B 1HFEL 4JV2A 2CKWA 3LP2A 3P45B 5GMDA 4ANDA 3CPWR 3J81Y 3UCUP 3KLGB 3BZQA 2G2OA 4K0KF 2OPRB 5FLXU 3KLIB 2CPZA 3SIPB 3EPGA 3M4XA 3M8YA 3TA0A 4LR9A 1Q4RA 4NLOA 2NZCA 3HHEA 2MLZA 3DXSX 1TUWA 2CDRB 4O4GB 2FYXA 3G8TA 2NXUA 1OYEA 5BR8F 3C14A 1GMWD 1RHMB 2UXCJ 2CRLA 2Z2YB 1OQ3A 2XS7A 3RG6A 3LJ2A 2J6SA 3TA2A 2BOPA 2Y1JA 4RW7A 4QPTA 1OSDA 3D0HE 4CTAB 3ILOA 3DRSA 1NM2A 2PSZA 2ZD1A 4K4YA 1L5UA 1D9FA 4M5MA 4JI6F 1REGX 2FLOA 4A8KA 2QO3A 4X4OA 3WIVA 3EZOA 1VRUA 2LQ9A 3KUHA 4ZP6A 2FZKB 1S6QB 3KK2A 2L9NA 3G6VA 3RB0A 3TQ1A 2IFXA 2C2KB 3SZ2A 3CCZA 3C6TB 5EWGA 1VHIA 2HRUA 2Y1LB 3W5XA 5DM6Q 1QE1A 4K4ZA 3U02A 4QW8A 1HI1A 4O1OA 2KVQE 2DNYA 2IIHA 1VQ7S 1PCAA 1TV6B 5LMNJ 1Q8IA 5KFRA 1WHYA 4Q0BA 1Y5NB 1UMJA 3DLKB 3O3LA 1UETA 1KS2A 2FC8A 1XWLA 5I3PA 3I9V1 1IKYA 6FDRA 5GADI 4G6VB 4GMKA 1IUJA 2UUBF 3BO3A 2E8GA 4N8OA 1UP1A 4IR9A 2FTRA 1V6HA 3ICLA 2YKPA 3GWCA 1RT3A 3QRRA 4RU9A 2YPZA 2NPFA 3VGTA 3HJFA 4M5GA 4M8LA 2ZOFA 4ITSA 3VVUA 1HHTP 4Q2LA 1RWKB 2MZTA 3T1AA 5ETKA 4M5DA 3N79A 2V68A 4MJKA 4DR6J 4YOEA 2MKCA 5K8OA 3JB9k 4OI3A 4Q9VA 1W2IA 4NA1A 4LF5J 3CC4S 2ACYA 2DHSA 2Y1IA 2RUGA 3GYNA 2HBRB 2N82B 3TYTA 4LIRA 1OQ6A 1YI2S 3DLLQ 3B54A 3D1QA 2V2QA 1UW9A 4J9OA 1LQ9A 1H2TZ 1QY7A 2J5AA 1T9YA 5LSLA 3QJPA 4P2MA 2IY5B 5KT6A 2FC9A 3ENVA 2Q79A 1U1NA 4GC6A 4RJVA 1HWJA 2N3OA 4M95A 1KLNA 2GA7A 2C1EB 4DHVA 1IR2A 2C3UA 3BSOA 2FHKA 1S57A 2RKIA 3SI8A 2A2CA 3Q8YA 1R31A 4URSA 1YK9A 3SDEA 1PC5A 3C16A 3UITA 3PW0A 1XMBA 3K5LA 2UUCF 5G0RB 1QAYA 3W60A 3T5HA 4NLRA 2JLFA 2EKNA 4RLEA 2ZH8A 3LOUA 5JJBA 2AQ4A 2MSSA 1DAXA 1CJKB 1VQ5S 2OPRA 1SCJB 3MECA 3OHBA 1RACB 5CH7B 4DUZF 1RYSA 3ZNUA 4CO4A 1VBKA 4O0IA 2AJFE 3KLVA 2EW9A 5L1IA 4CO2A 5L39A 1M90T 1S1XA 4UTGA 2C22A 4O4GA 4DR3J 1FFSB 2C2NA 3GG1A 1QTMA 1KFSA 1QAXA 4QWDA 4NRTA 4YDXA 5GAEI 4OHWA 3SFUA 4U9RA 4IH7A 4N56A 2HHWA 4MIWA 3QLHA 1DLOA 2EK6A 4GC7A 5KFMA 3TQEA 4CTAA 5HN0A 5H9EJ 1WOPA 2VA2A 4CCHA 2FVPA 3GIIA 2VQEF 4LRDA 3O1LA 2OEJA 1HW9A 3NP5A 4OYWA 3UO0A 4B3MF 2QRRA 4WK3A 2JEJA 3TX8A 3GR0A 1FDBA 5C25A 3G6XA 1S6QA 1U48A 4X4SA 2Y8WA 1N0UA 1SL1A 3CDAA 3OL7A 1P6TA 2EC2A 4Z7HA 4DV4F 4DQPA 2VOPA 1B4SA 3BBFA 4TY8A 1HNIB 3MAQA 2RAQA 2L9WA 1NKCA 1TV6A 3NCQA 3PVXA 3T1HJ 1CC7A 1WC5A 3CTRA 2H5EA 4FKXA 2VJVA 2VQFJ 3DLKA 4DV1F 1Q81T 3LP1A 1DHMA 1M5PC 4ECSA 1VLYA 3KJNB 2UP1A 3GLJA 1REVA 4KH1B 2HVEA 4ZVQB 4JI7F 4AL6A 3LGHA 2YFBA 5A76A 3QYYA 5KFNA 2J7UA 4USHA 2B0GA 4AL7A 2M9KA 4C7QA 3PIOQ 1HWLA 4DUYF 4TQRA 2RDJA 2B4UA 3PR4A 2HMIB 3KK3B 4V19J 2VF3A 4ID5B 2XZWA 2HGKA 4WBFA 1ZM3A 3HVWA 2XLJA 2AU0A 2OD4A 4O3PA 4I68A 2AW0A 2IM2A 5DETA 3OFFA 2XTJP 1AW0A 4OYMA 4ZA1A 5K8PA 2AKWB 4M5LA 3T6BA 3A13A 3MOJB 1R0AA 1MSWD 4JP8A 4PXDA 1Y7PA 1SV5A 3N5FA 3DOMB 1D9DA 3QRQA 2HWIA 3EICA 2W9BA 2NSCA 3OLAA 1SH0A 3I56S 2IBOA 1URNA 4QWBA 2ACMA 2RD5C 5CYQB 2LYVA 3UDEA 3QWPA 3L95X 5RUBA 2WK4A 2QA4G 1BE4A 3U1LA 3HF5A 4PYAA 4JI8J 1PC4A 2HKEA 1U7LA 1DTQB 3QFHA 4PEOA 2JFDA 4DL0C 4G1QB 4USJC 2CPHA 4RZRA 4QIGA 4PQAA 4EI2A 4Y3CA 1EX8A 4KQZA 1VBZA 2FZCB 1AT1B 5IT4A 1T95A 4IYQA 2BM0A 1FVQA 3S01A 2DGVA 4RBUA 3VGVA 3MWBA 4W98A 2E1PA 4ECRA 2GAHC 2LA4A 3KTQA 2ZW3A 3CDWA 2CZ9A 1RSCA 2GMLA 2QA2A 1CJKA 1CULB 5F0UA 4ZCIA 2FLLA 3BSNA 4KTQA 2EFPA 2OSQA 2ZH3A 2ADCA 4DFMA 2CZ4A 1UVNA 4LFAJ 5CAAA 1RTDA 1C1BA 4ECZA 1B0VA 4DV6F 1O6XA 4RWXA 2Q43A 1OY8A 4NLSA 2I9SA 3F0NA 2XS2A 1EB0A 4E2FB 3MDFA 2P9GA 1F5CA 5K14B 3VHQA 2W1BA 4AFFA 1XR7A 4ZJQA 1PJ7A 3H90A 1SJ3P 2DR7A 4C8ZA 2YQ0A 4NLDA 1NAQA 2DGOA 5HP1A 3U7JA 3I87A 2MEWA 1X4DA 4NYPA 1NBEB 2M3DA 2Z56B 4JBCA 1JNRB 3EZ5A 2VFUA 2DEJA 5B09A 3MMJA 3P5BP 5E3CA 5KT2A 3V4MA 4BC9A 2ALYB 2ZBQA 1WWHA 2WB4A 2J0XA 3BBBA 3M9MB 4K4SA 4PL5A 1RCXB 3A8IA 2PMWA 4DXLA 5IM0B 1UA1A 1KQGB 1NSQA 2XMXA 3W64A 1SUQB 4ZP8A 5AE1A 3OXGA 4JI3F 2V69A 4DQSA 3HD2A 2LQ8A 4CNYA 2GVZA 1EHWA 3RGIA 3EMTA 4OZ2A 4C3KA 2RVJA 2OIHA 2H5IB 2XLIA 4NI2B 2CDQA 1WUUA 3CJKA 3JQMA 3N6NA 2F9DA 4L72B 2YQ1A 2ZHOA 2DBBA 2Z57B 3G2XA 1YJNS 2KFNA 4OIXA 2CQ0A 2H5JB 2K8GA 2JJ4D 2HMIA 3TJ8A 3KK3A 3SCJE 3BGLA 4ID5A 5K9FA 3A8JA 4PG5A 2DVIA 4FYDA 1IBCB 4DPYA 2QYCA 5EWEA 3CJRA 2OSRA 2J6UA 3CF5Q 1ZH5A 5GAGI 5H9EK 2BRLA 4LF9J 3KLEB 2VG6B 2KHCA 2ZHBA 3PHTA 1IJEB 3FQLA 1PYTA 3TZWA 3DOMA 2FVRA 2KT3A 2N4CA 3VAMA 2BKPA 3K2YA 1QUPA 1VIXA 3JTPA 1WKJA 1TL1A 1TKZA 5E3QA 1WG1A 2IDLA 1NZ8A 3PV8A 3TR5A 1Q79A 4F0HA 3CT9A 4O44B 2QGMA 1R8BA 2V8GA 3CD7A 3R8YA 4DR1F 3SQGB 4C0OC 4A8XA 3HPOA 1KSPA 1Z4UA 4DV5F 2I5JB 4ZVOB 2XSJB 4PAAA 2ZUAA 1JKHB 2XY5A 4EWTA 1RE1B 4DV7J 1IWGA 3SFGA 1CSJA 4OZNA 1S0VA 2C28A 5B0GA 3RW6A 2QMUB 4IH5A 3BV8A 2O66A 1ZZFA 4X4RA 5DQGA 2CNOB 4CRJA 1R27B 5IQ6A 1XIQA 4MK7A 3WC0A 2CPXA 4WZQA 2GGPB 4YZ9A 5IXUA 2F6MB 3D7SB 3OXFA 4ZS6A 3SYZA 1T3OA 1W7WA 4GKJF 1QJHA 1T7PA 5AE2A 5ETQA 5ETPA 2ZKTA 1SKUB 4NLWA 5F3ZA 2RU3A 3LP0B 4OZ5A 3ZO7A 1RWUA 1N33J 2GX8A 1KWMA 2VQFF 2BJEA 5CYJA 4ZJOA 3MXHP 1U02A 1S1UA 3D2WA 3T5JA 3C8YA 3FEXB 4KPYA 1VC5A 4A8WA 3BGUA 3IGVA 1R8CA 1ZM9A 4OI4A 1R8PA 4A8SA 4ALZA 3OVSA 3BGRA 5E2QA 1RA6A 1XR5A 3OD2A 4V19X 2JFKA 4M5NA 2WCXA 3IAS9 5D0GA 2K1RA 3UPFA 3MD1A 4IG0A 4QCLA 4X65J 2B9YA 5K14A 2D7SA 3KDNA 1HI8A 4PYDA 3NWRA 4WKYA 3T5LA 1NK0A 3CMQA 5HLFB 2HYIB 3HZGA 1Y5LB 4EUVA 2X1BA 1MWQA 1CJVB 2OFGX 4ECYA 2F63A 4NCAA 3KNAA 3IP0A 4C0BA 2V8PA 4CYUB 2KJWA 5FLXY 2R9LA 3LWMA 1O8BA 3R5BA 4OX6A 5F8IA 3PHEA 1TMJA 1R7IA 5KG4A 4Y2AA 2CQCA 4ANEA 1YBUA 2CVIA 1X4CA 3ZNJ1 3VCDA 3ISNC 4YB6A 1WC4A 2CG8A 1RAHB 1FRHA 4F04B 3PYDA 1S59A 3NOGA 2HHPA 2QSBA 2KN4A 2GJIA 4KHRA 1GXLA 5C24A 5HATA 2CPFA 2MB0B 2YH1A 3D4JA 4ZPWR 4NI2A 5KFSA 2CFXA 2MYFA 3MTKA 2QYGA 4DV2F 3EGZA 3ZTQA 2YKQA 1BMQB 3K5MA 1FKAF 1N88A 2W8KA 3BDPA 4IH6A 5ADZA 2MLYA 2M8HA 1NKBA 2JEFA 3B4DA 2OAUA 2HNYB 2HQDA 3UD3P 3W7BA 1U1QA 3MUMP 4K2XA 3EYZA 2R7SA 1FK9B 4ECTA 1JLBA 1Y11A 5B0BA 2HPUA 5F8LA 1PYOB 3H8YA 1EP4B 2PD1A 3KLEA 2VG6A 2DXEA 2KRRA 2WZ1A 2IPOB 4QU6A 1YRXA 1X0PA 1ZZNA 1U0SA 5D4LA 2MPUA 1QVGR 1A9NB 1DQ8A 1WDTA 2OHDA 2YWHA 1F60B 2UVWA 3QIPB 1O51A 3RB6A 1LW0A 3PW4A 2MZQA 3A1YG 4O44A 2UUAJ 1AFJA 4OYAA 3SQGA 2PE8A 3RAMA 2JEGA 2KXNB 4F50A 1KFDA 5LMUF 3P5TL 4AS2A 3I9V9 2KKMA 2XSJA 2CNKB 2MZSA 4P2FA 2CQ2A 1JKHA 2IVMA 4FNIA 3M6XA 4A46A 5JXSA 3CJ5A 3TZZA 1HBOA 4RUBA 1U47A 3RAXA 4D3HA 2GC8A 5KFOA 1NPKA 2CAZB 4OFZA 4CO0A 1LW2B 3A3PB 1B3TA 2G2ZA 1ZAWA 4DV3F 4TLQA 2GGPA 2YNHA 2HIQA 4KT0C 1Q95G 2XZDB 1YJ7A 1IKVA 5KG3A 1BQMB 1I1GA 1KDNA 4HFVA 3NOCA 4Z37A 2ZVIA 3LP0A 5DZ6A 3G9CA 1VQ8S 2CJAA 4MMOA 3H7HB 5A2QU 4NLYA 1WSRA 3NEKA 1OSCA 3TJAA 3E51A 2HRTA 2DY1A 2NZ4A 1RCOB 5IV4A 1WI8A 4OX9F 3MPUB 3PIPQ 4LF1A 4OJ3A 3A12A 3L9ZA 2O1PA 5B0EA 1VQ9S 1H98A 2OPQB 2KYZA 3Q2SC 2ZE2B 3TAPA 4IOBA 2RF2B 4ZVSB 4KGVB 2I6WA 1JLQB 4J7CA 2E5LJ 3FRZA 3DRXA 3T41A 2WVFA 2GW8A 3D5MA 1NXIA 4KR0B 2RJZA 3AAWB 1K0VA 4JCVE 5KFJA 1NK9A 3I96A 5HLFA 2HQFA 1RWWB 2J76E 1CJVA 2WTFA 4WE1B 3UQSA 2V6AA 1RB0A 2GJFA 3VAHA 4HDGA 2WVCA 2CJBA 3MPDA 3R6GB 5E41A 4BC7A 3K8VA 3U27A 4DSKA 3HKZD 3HD1A 4Y2KA 3J80U 1D8ZA 1RAEB 2J9DA 5HK4A 4C11A 2IJNA 2RDDA 4KFBB 2HHHJ 4TLRA 5F8NA 4IG3B 4NA2A 4LRCA 2CA9A 1OPIA 5IT9Y 3D3BJ 3I0RB 4Y2IA 1FTCA 1WORA 4I6YA 1KQKA 2BJ1A 1HBMB 4FVCA 4B08A 2LKZA 4MIAA 1NHVA 2HNZB 2OTLS 3MM7A 1Q78A 1J2VA 3UVJB 3KLFB 1U49A 4FDFA 2G0JA 4IQXA 4A4JA 5HBMB 4PUOB 4B9MA 2KI2A 2UU9J 2UUTA 1FO1A 3BYPA 1RUSA 3QQCD 1LK5A 2W4DA 4V1Ak 5ETRA 8ATCB 3HFKA 3NRBA 1AXQA 1Q1KA 4OYPA 2NREA 3Q89A 4PR6A 2Z0GA 4RPFA 3QZ8A 3CJ3A 1WNEA 4LF4F 2FB0A 1P27B 3PY8A 1KHVA 1U1OA 3VAFA 3KOAA 2K2PA 1S1WB 3GTYX 2K19A 1FK9A 2OKQA 3RU0A 2WOMB 1EP4A 1JX4A 1N33F 2XSFA 3TEHB 1YJWS 4CM0A 4F26A 4JV5J 1UEVA 4W92B 3P23A 4LQ9A 4RUCA 5SZTA 2EFOA 4LFCJ 3MR7A 1S9EA 3NWGA 1Q86T 5SUHA 2R7XA 3FZ2A 1VRTB 2R7OA 2I2YA 4ANCA 4ILLA 2VDHA 3DI6B 3B82A 4BS2A 1LWCB 3GFZA 2ZWOA 4AL5A 5EWFA 2CWXA 3GJSB 3LGMA 2E5IA 3KDOA 1L3KA 2NXEA 1IWAA 4PG6A 1N4LA 1I6JA 3QBCA 1C4AA 1Y5IB 5KG1A 5KTQA 3MEEB 2K7KA 2FPHX 1C0UB 4FF2A 1SQFA 1Z2LA 3CO0P 4UW2A 3HSDA 2DGQA 3BSCA 5KFFA 1RAFB 3V6DB 1B7YB 4CH0S 1UVIA 3L7OA 4OX8A 2LU1A 2HFSA 3C6UB 1U8WA 5J2PB 4P52A 5KFBA 3LA0A 2BUNA 2FJAB 2XMTA 1YKWA 3J7ZT 3ELHA 4KRWA 5D4PA 4DN0A 1BQMA 4LR7A 2DISA 3SV4A 4NLQA 2PIIA 1VMBA 4MKAA 5E5NA 4OZ3A 4NOHA 3OLBA 4QIWD 1R6VA 2GSCA 1Y4ZB 5HANA 1JLGA 2ETDA 1Y0HA 3LWLA 3D28A 5HGIA 2V63A 2XNQA 5KFTA 3AJ2A 2OPQA 2KT5A 5LSOA 2ZE2A 1H0HB 2RF2A 1BWEA 3SXLA 2V0NA 3K17A 1MROB 5DDPC 4JI5F 2QMXA 1EAYC 1YJ9S 2IAJA 4XPCA 2VPYB 2WB1D 4WFBQ 1RHRB 1K8AT 4LFBF 2HEKA 3TJ9A 1I51B 3DXBA 2CPYA 4F02A 3TI0A 3Q22A 3JS9A 4C97A 1G7CB 1U1RA 2HS4A 2KKHA 5D78A 3D67A 4IRKA 1UWBB 3FSIA 4CO5A 2PFFB 4PZVA 2RDIA 3H40A 1F5BA 5B0CA 3THPA 1NJIT 5KFEA 2G13A 4P75A 5EDWA 4DLEA 4DR5F 2LCWA 2LVWA 4YEAA 4F4YA 2H3EB 5DDOC 2KHDA 4IG3A 4WFXA 3BO2A 3MAAB 1EKRA 2RILA 1RWPB 2VFRA 2PFDA 4E0DA 2CWKA 3I0RA 2WVEA 3CJ2A 3NY0A 3ZZOA 5IT0A 4C8YA 1HPZB 2HURA 5LT5A 4FKYA 1UFKA 2QSFA 3KK1B 3KLFA 3O2IA 2AZ1A 3GFHA 5HMXA 1JJ4A 1IM6A 3HVTB 4PPZA 3CDUA 2EEYA 1N8RT 3DM2A 3U1NA 3TUPA 4DPOA 1OMSA 3GFXA 3VAGA 1WACA 2ZBPA 3OTDA 2BA9A 1G6BA 1V5VA 3R7BB 4LF2A 2D41A 2KFYA 2UV8G 4URGA 4X4NA 4J9RA 1KC8T 3TVZA 2HHQA 4LF7F 1LWEA 3ZTOA 4KPCA 4R5PB 4PL3A 2E1RA 4N41A 1KONA 1UJ5A 2E1MC 4QIVA 1S1WA 2P6SA 3GJQB 4ES1A 5KOWA 3K8WA 2FHMA 2WOMA 3RR8A 4X84A 4TU8A 1VYAA 1MW7A 3QJJA 4NXMJ 3OSPA 3KP9A 4OJHA 4X4PA 4ERDA 1NUEA 1Z2ZA 4F4XA 5J2NA 1SIWB 3WQPA 4ZLJA 3D1HA 2L08A 4B3SF 1VRTA 1SBRA 1SL2A 2EFQA 3DI6A 4ZVPB 2ZNYA 2VV5A 1M1KT 4FXWA 3JYTB 2JB1A 2DIVA 3DOLB 4B9VA 5MLCV 2BW7A 2W2MP 3GIJA 3MEEA 2OTJS 3KYLA 2ADBA 1WC0A 2BJ9A 3JSMB 3CCRS 1SKSA 1C0UA 1SJFA 3EGVA 2V4QA 4IRCA 4FNHA 4UY85 4QWCA 5E3PA 4TVAB 4DS5A 4WKRA 1N5SA 4PG8A 3M9OB 3T19A 1VJWA 2MTLA 2AGOA 5KFAA 2DXFA 3C6UA 5KAKA 2AGQA 1QSSA 4N47A 1HL6A 5KT3A 2V4RA 3C15A 5F9NA 2IRUA 4L3KA 4XAKA 2GIRA 2XEXA 4WK1A 2GO8A 3QJLA 1KEKA 1TVRB 3FFIB 2OELA 3FBBA 4K4TA 1N5YB 1LV5A 3PYFA 5L1KA 3MEGB 3LALA 1M5VC 2E29A 3PRBA 3MF5A 3SV3A 4XTTA 3PCOB 2NSBA 2VICA 4YY3F 1X60A 1RT6A 1PJ5A 1Q8KA 3Q8PB 2ASYA 3NL0A 2X3GA 2DR9A 1N6QB 2LDIA 1MROA 4NZ6A 5DZ7A 4JB8B 3C2PA 1RDRA 3FC9A 2LA6A 5B08A 2G9OA 4DR7F 1SB6A 4JI2J 3DRRB 5A8WB 1SJRA 4M5KA 2P5VA 5HMZA 3KG0A 1SH2A 1UWBA 4M5IA 3QWUA 3DNCA 4JV5F 3J81j 3W9JA 3K59A 2CYYA 4NE9C 2IA0A 2CNLB 1RT4B 1UZDA 4M5JA 2MY8A 3PJ9A 1YDLA 4HL9A 1HLWA 2K3KA 2ASLA 1BD6A 3UNGC 3ZZPA 5HSPA 1RP5A 3UR0A 4NCGA 2HHXA 4RW4B 1V3ZA 1D3WA 4NLTA 4ZVFA 3KK1A 2R8GA 3Q2TC 2Y9HA 3QT7A 4KV8B 4ICLB 3BN4A 1VC6A 2W7OA 4OI0A 2CQ1A 1SQGA 3IR5B 1T03B 2XB2D 4IR1A 2R2TA 2HQIA 2KVIA 3MUVP 1RAGB 4ZKAA 4YB1P 2ROPA 4AS3A 3SSSA 2UXDJ 2DNOA 4GVBB 2PMZD 2BKNA 4CNZA 4WJBA 2ZZMA 3CSKA 3QGPA 4CM2A 4Y2CA 4ZVGA 1PGZA 4R5PA 2R7QA 1XC9A 1DJ0A 2PO4A 5KT5A 1XNQJ 1ZAXA 2CPIA 3UD5A 1U6BA 5GAEU 2XMAA 4I7FA 2BJDA 3KMQA 2YKMB 4HHJA 2P6TA 1P1LA 3ZZRA 3CCUS 1GX5A 3Q24A 2QG9B 2JC0A 1WD6A 4WTYA 5D3GA 1Q82T 1VQYA 4X4TA 1QAIA 4NLVA 3J7YI 2IBKA 1JJ2R 4KAIA 2GJ2A 3AQPA 1T02A 1DBDA 4K0KJ 3M8ZA 3JTOA 4QU7A 2ZJQQ 3E01B 3M32B 1VBXA 4AQYF 4ED4A 5A8KB 1KBRA 5I42B 2HNDB 1UPMB 4OI1A 1OY6A 3W62A 3JYTA 5BR8J 5F8GA 3DOLA 4HTJA 3IM9A 4OHYA 2L48A 1IBKF 3KKFA 3JSMA 4HT5A 2H54B 4QWEA 4ZLPA 1APSA 4N76A 1VS3A 4PG7A 1I94F 1NDCA 1HNVA 2VC1A 3IWXA 1SPBP 3IBCB 3M2UB 4ZPVR 4EEYA 1ZYQA 1AUDA 4JI6J 1DQ9A 3VAJA 3GSIA 2Q3PA 3CCWA 1FESA 3T5KA 2XI3A 1YQHA 3UN2A 2CPDA 5HJYA 2ZRRA 4G1PA 3OXLA 1HARA 3TAQA 4DR4F 3P8BB 1W26A 3LW5C 1TVRA 3PM9A 4DL4A 3D6TB 3I31A 2JB2A 3NCRA 2RU9A 4UZCA 5D0HA 4EO8A 3GMGA 3GZ7A 1S6OA 1JB0C 1HMVB 1RAIB 2PMHA 2ZH9A 1UAWA 2FQQB 3WBZA 1HNZF 5KFKA 1CJUB 2BJ7A 1RLDA 1NZAA 3M9NB 2BVZA 3GCXP 1N6QA 4IDKB 5JVHQ 4ECVA 3KHLA 1X0FA 3FJ2A 2VG7B 1U6ZA 1PYSB 4HKQA 5D8HB 2QZ8A 3CULA 1UFLA 3EVOA 1YJVA 3DRRA 5A8WA 1TAUA 2MZRA 4DG1B 1X5OA 2GAGC 3FBFA 3MM8B 3IC1A 1Q8BA 2V2KA 4J37A 1FJ7A 3G82B 3VVTA 5A2QY 4PWDA 3M2VB 3BR9A 4JUZA 1OPZA 2AMCB 3HVAA 3PFEA 5D0EA 1RTIA 1FE0A 2HVZA 4NEYA 1QD1A 3M8PB 1JLEA 1YIJS 1O5JA 1TMMA 5ETSA 3CB4A 1WEZA 2DK2A 3OJUA 3DYAA 3OL8A 5K5MA 2EK1A 3ONQA 3DMJB 1Q0NA 1HBNA 5GAHI 2AX0A 3FVVA 2QA1A 2DR8A 1T9XA 3ZZTA 7FD1A 3PW2A 5HVFA 1LWFB 3TOQA 3BQ0A 1SJQA 5FJ4A 4NPOA 5L1JA 2H1YA 3AFGA 3W65A 2BR0A 2W2QP 2C3YA 2CVEA 1T03A 4W4MA 2E5JA 3AXKA 3PKYA 4F67A 3QT8A 3T9ZA 3DHXA 1IBLJ 2ALZA 3N28A 4F7VA 4F4AA 4BHQA 3H2VE 4Y6IA 2V67A 1RHUB 1TFYA 3J80Y 1S4EA 2HSEB 4BCAA 3DC2A 2ZOGA 3CC7S 4B9SA 4F2RA 3PX0A 2E7XA 2YKMA 3Q86A 4CO3A 2DNGA 2DRBA 3PXGa 1GXUA 4C6AA 1FKOB 3HSZA 3EPIA 4OHVA 5HQMA 3V6JA 2YKAA 5MAOA 2UUCJ 2OFHX 4OQJA 2FY8A 1SL0A 4OZJA 4ES2A 1JIHA 4XK8C 3DFEA 4MIBA 2HHVA 3QO9A 2HS0A 4I2PB 2DNLA 2WBRA 3K89A 4KO0B 3NGDA 2NYHA 3E01A 3M32A 4DUZJ 3D0IE 5A8KA 2XY6A 5M2PA 5I42A 3SEOA 1IXKA 2R7RA 2HNDA 4HLBA 4JI1F 1U2RA 4MT1A 3DCAA 3ILIA 2LDYA 2VL1A 4GRSA 2JZ5A 4LRAA 1GMUA 1VHFA 4X2BA 2AJ1A 4Y0FA 2HGLA 2AP6A 3PG9A 4LSLB 3IR7B 3AH6A 3IR6B 2D74B 5KOXA 3H0PA 4USWA 2G4BA 2YTCA 4CLWA 3V81A 2H4YB 1N5VA 2O3DA 2VFSA 1R3NA 2QTWA 2VQEJ 1N56A
chains in the Genus database with same CATH topology
4HT7A 4YZ9A 1FT8A 5IXUA 2UVUA 1B0PA 3CO9A 2WSCC 3FZBA 3NCPA 2F6MB 4A8MP 4QR0A 3OXFA 4ZS6A 3SYZA 1RT1B 1X4FA 3K5PA 2B6AA 1RTIB 3CXCR 1E6YB 1T3OA 2BM1A 3FQKA 2I1RA 2J8AA 4GKJF 1QJHA 1N34F 3OSNA 4C2MA 1T7PA 5AE2A 3LPYA 2E9RX 4P7VA 4ETXA 1TR0A 2DGXA 3HZEA 2MZJA 5CYMB 2ZKTA 1JLEB 4NLWA 3AB4B 4RX6A 5F3ZA 2V1CC 3OUYB 2RU3A 2KM8C 3LP0B 4OZ5A 4NV2A 1D9AA 1RWUA 2YKOA 3L0IA 5KFYA 2GX8A 4QWAA 1IQTA 2VQFF 2BJEA 4R0EA 4EYIB 5CYJA 3IO1A 2F9JA 5HMWA 3DYAB 1N54B 2IYGA 4QZVB 3C3LA 3MXHP 4XIUA 1S1UA 3D2WA 3MMCA 3T5JA 2YWEA 2HFZA 2U2FA 1KOOA 2LEBA 2FLNA 1HBNB 3C8YA 3FEXB 2AGPA 2W4CA 3NS6A 4OLOA 3LH2S 3TUZC 4KPYA 2EG1A 1VC5A 4J9LA 4G75A 4A8WA 2DNPA 5ITHA 3OHAA 2AYGA 3RAQA 2DR5A 3BGUA 3IGVA 2YNIB 3CJ4A 4Q44A 1M5KC 3QIPA 4ECWA 1R8CA 5DDQC 2ZC4A 1ZM9A 2EI5A 2A2DA 4OI4A 1R8PA 3IWLA 4ELUA 5AXLA 2V94A 5B7WA 2MQLA 3FNNA 4ALZA 4A8SA 3OVSA 3CJKB 3BGRA 5E2QA 2HHSA 4RNNA 2MMYA 5KFCA 2LQBA 1SH3A 3G6ES 2DNZA 1RA6A 1CQNA 1XR5A 3MEDB 4ATNA 2L41A 3RRHA 3NNAA 2HVHA 3W2VB 2ERRA 1W2BR 2GIQA 3SCKE 2XMVA 5GAGU 4A8YA 1NHUA 2VKRA 4V19X 4O23A 4P7TA 2JFKA 6FD1A 2UXDF 2IYIA 5KFIA 3BREA 2WCXA 3IAS9 3M8QA 2R7UA 2E1CA 4LVOP 3PX6A 2K1RA 4ZCKA 1URRA 3MD1A 4IG0A 3UPFA 1JLAA 3RTVA 4QCLA 4OZLA 2B9YA 1WELA 5K14A 4AYBD 3EX7B 3LAKA 4KGKA 2D7SA 1HI8A 2Q6BA 4IDKA 1X5TA 1YRTA 2RQ4A 4TXSA 4WKYA 4QW9A 3T5LA 1NK0A 5HLFB 1M5SA 3CD0A 3HKWA 2HYIB 1N5TA 1F9FA 4YP3A 2VG7A 2RMLA 3HZGA 3OFHA 1Y5LB 4EUVA 2X1BA 1FTRA 1AFIA 1WF1A 1R43A 3HHDA 2ABYA 2OFGX 4FZVA 4RKUC 1XMQF 2FLPA 3HHLA 2RE1A 4ECYA 1HD1A 3FDSA 1FJGF 3RRGA 4ZMMA 4NCAA 3KNAA 4C0BA 3SDJA 1U4BA 2RRBA 2BRKA 2E5GA 2XI2A 1Z1ZA 1N0VC 1HQEA 2JC1A 2KJWA 1LW2A 3MR6A 1NK4A 4NLXA 4QR1A 4HH0A 2GMHA 5FLXY 4BWMA 3KHGA 4MK9A 2R9LA 1TQLA 1QVFR 2NQPA 1N5QA 3LWMA 1L3UA 3M2VA 2XC9A 3VAIA 1O8BA 4W90B 1TL3B 3R5BA 4OX6A 5F8IA 4MYUA 4OJ1A 2R8IA 1FRKA 3PHEA 2YH0A 1IN0A 3RBDA 2HS3A 3M8RA 3KJVA 1SKWA 1R7IA 1UVKA 2EVZA 3NNCA 3DDNA 4MYTA 5KG4A 2WSFC 1U26A 4Y2AA 3BO4A 3MR2A 3OTEA 2XS5A 2JWNA 1VOMA 5K8NA 3HX9A 1NU4A 2CQCA 5BYQA 2ZH2A 4IFYA 3AJ1A 3T6JA 4LSNB 2CVIA 5CXTA 3M8PA 4C8LA 1TL1B 1X4CA 1TKZB 2DGUA 4Y34A 2WSEC 1YWXA 5KG7A 3K5NA 4OAVB 3QO9B 1FRXA 3VCDA 2UXCF 2A18A 3ISNC 3FCHA 4YB6A 1W25A 4FPRA 5A0YB 4RNOA 3NMRA 2DHXA 3DOKB 1HWKA 1FRHA 2YWGA 1ZBTA 2YKNA 1JJHA 2E9TA 3Q8DA 2HHPA 2L9DA 1JLFB 2KN4A 4QPXA 1YVFA 2GJIA 5A6WA 4PXBA 4AXIA 3TAMB 3H4BA 3QGIA 4KHRA 1WF0A 4TYBA 3DMJA 5M2RA 4CT8A 1GXLA 3QIDA 3VTIA 3Q0AA 1HW8A 2OJ3A 5GMKa 4U7CA 4CI0B 5F8JA 5C24A 2MXYA 4R25A 2OPSB 3HM9A 2CPFA 2MB0B 4FXVA 2YH1A 2MQPA 2PGCA 1LWFA 3OPKA 4ZPWR 1EETA 3P96A 5EX0A 5KFSA 2CFXA 2MYFA 1S7HA 4FS2A 3MTKA 3CUNA 1U6FA 4DV2F 2CZVC 3EGZA 3ISND 2YWFA 1FDDA 1OIAA 2GFFA 2D3UA 2GHWA 2YKQA 4HVZA 4DSLA 2RQMA 1Y00A 3BS9A 2YQ3A 1JLQA 3K5MA 3M1VB 2MHNA 3K5OA 1GT8A 1BC6A 1FKAF 2ZJPQ 2DH9A 1K9MT 1H2UX 1N88A 3I9ZA 4H4MB 2W8KA 2PC6A 5E3RA 3CD6S 4QIFA 5A8RB 4IFVB 5IFMA 3BDPA 3SSRA 5KG0A 4IH6A 5ADZA 2MQOA 3LQVA 4OJGA 2JHEA 2Z2MA 2M8HA 3FSXA 1NKBA 2JEFA 4DSJA 4MH8A 2J0SD 3I5BA 3IXQA 3WZ0A 3EUNA 3B4DA 2OAUA 2HGMA 3V81B 1UJ6A 1VK8A 2VG5A 3CGIA 1T05B 5CQGA 3IWNC 3MM5A 4RW9B 2HNYB 4EBEA 3ZFVA 3UD3P 3N4WA 1E6VA 1U45A 4J9KA 2ZBIA 3TA1A 4DLGA 3W7BA 1YGYA 5IZHA 1U1QA 2LQ5A 3OQ2A 1M0SA 3DN9A 2YNGB 3HT3A 4WE1A 3MUMP 4K2XA 4LF6F 3EYZA 4DFJA 2ZOMA 2R7SA 1FK9B 4R8UA 3MOZA 1WG4A 4ECTA 1JLBA 2B6AB 2VPZB 1MWZA 5B0BA 1HI0P 4F4ZA 2HPUA 3MMAA 5F8LA 1U1KA 1X7VA 1S6UA 2DNNA 3H8YA 1EP4B 1DURA 1UW4A 2PD1A 4UOCA 2HHUA 5B0AA 1JK9B 1ULRA 5LMNF 2R7VA 1YJUA 3KLEA 2PA3A 3X1LB 1RKIA 2VG6A 4Q2MA 4MFBA 2ZJRQ 3FEZA 4XO0A 4DDFA 2K3IA 3N5BA 4ETZA 2EBGA 2RNEA 2KRRA 4HEA1 2R4FA 4HYKA 3PDNA 1DZ5A 1FKOA 3NS5A 4I2QB 1QSLA 4KE5A 4QU6A 1YRXA 1X0PA 3VQSA 3U1MA 2XCPA 3V4IB 1ZZNA 1S1UB 1HWIA 3MMCB 3K7RA 4YMEA 5D4LA 1MU2B 3FRYA 1FJCA 4KFBA 2KU7A 2LEPA 1YJTA 4WFAQ 4RWWA 2MPUA 2GV1A 2BBEA 1QVGR 1T8EA 1A9NB 1RA7A 2YFAA 3QZ7A 1DQ8A 2ZFHA 2JB3A 2QE5A 2YWHA 2EFNA 1F60B 2UVWA 3QIPB 3WC2A 3CCQS 1HBMA 4J9PA 1VQNS 1O51A 3RB6A 1LW0A 4ZPCA 3TVKA 2YWKA 5F8MA 3PW4A 2MZQA 3A1YG 1BQNA 1FRMA 2MGZA 1WHVA 3BGRB 4GXTA 1CC8A 4O44A 4KO0A 1AFJA 2V8HA 3SQGA 2PE8A 2SXLA 2ILZA 1RTJB 2PA8D 1S48A 3RAMA 2JEGA 4A47A 4PPDA 2KXNB 1TFWA 2HNZA 5M2UA 3RZAA 2HFNA 2XLKA 2M52A 4F50A 4DQQA 3LJ1A 1KFDA 5LMUF 4UUXA 3M8QB 2B7BB 2K1RB 4OZ0A 3P5TL 4J9NA 4AS2A 3I9V9 4IG0B 1YHQS 1QLNA 2JLEA 1VGYA 2KKMA 5HBMA 2ROEA 2XSJA 2OH2A 4PUOA 3PRDA 1GX6A 2MZSA 5KT7A 5J1EA 5IWAF 3MURP 3JTNA 2CQ2A 4C8NA 1JKHA 3MFIA 2IVMA 4FNIA 2DNKA 4A8OA 2R7WA 1X9MA 1HR0F 3M6XA 3POTA 2B5JB 5AE3A 5J2MA 4A46A 2JX2A 3KG4A 4H4KC 5JXSA 5KG2A 3CJ5A 3H2UB 4WF9Q 3O6QA 1D8YA 1HBUA 4JI4F 4NZ0A 1HBOA 4PQUA 4EU0A 1U47A 4DR6F 3RAXA 4D3HA 3CDEA 1NJYA 3I0SA 2GC8A 3UFCX 4RNFA 4F3QA 5KFOA 4OV1A 2CAZB 2EPIA 4OFZA 4DFPA 3AA8A 1N36F 2R7TA 2AWZA 3V5RA 2X1GA 3MD3A 4CO0A 4C8KA 2IC3A 4F4KA 4DL7A 1LW2B 3SSQA 2HGNA 1H2VZ 4QBUA 3IBWA 4LF5F 2HLTA 2J9CA 2KTQA 1ZAWA 4DV3F 2XGQA 2DIUA 2RIJA 2FVSA 5J2QA 4TLQA 2WONA 2V5HG 2GGPA 4NXMF 5CCMA 4MKBA 4OHXA 2YNHA 3S7RA 2HIQA 4KT0C 3KHRA 3KJVB 3ZZUA 1WHXA 1RT1A 2D9OA 2J7WA 3NAHA 4PXEA 4IKAA 1IKVA 4PCQA 5KG3A 3Q8RB 3RYLA 2ZDPA 2Y0SD 2NR0A 1BQMB 2MHEA 4H54A 4EO6A 2VBXA 3UR3C 1I1GA 2BXJA 4HFVA 2HLUA 4NLGA 3OUYA 4Z37A 3TVYA 2FGOA 3LP0A 2MQQA 3G9CA 2XMUA 2G0CA 2YVSA 2CJAA 4ZK7M 4MMOA 4N77A 3THTA 4Q45A 4YHHF 1X9WA 2YKNB 3FMBA 4OI6A 3UD4P 2FY1A 4NLYA 3LJ0A 4I1TA 4WYWA 1K1SA 1OSCA 1BGXT 3E51A 4PRFA 1UEUA 4FN5A 5D77A 2JEIA 2CQHA 2C3MA 3N6MA 3QAUA 3KLHA 2NZ4A 1LOUA 1WI8A 4OX9F 3PO4A 4L3NA 3PIPQ 4OJ3A 2ZH4A 2D1CA 5C24B 4YZDA 2VFTA 1WHWA 5KFWA 2O1PA 1VQMS 1WF2A 2PI4A 2YNIA 5B0EA 3HI9A 1VQ9S 1EETB 1H98A 2OPQB 4KKOB 3MTJA 3OR1A 2KYZA 1S76D 3Q2SC 3GFYA 2VONA 3FGVA 5DDRC 1FHTA 2ZE2B 3TAPA 1HYSA 2LEAA 2RF2B 4IOBA 4WFNQ 1LWCA 2E7WA 2DTJA 2B7CB 2CJ9A 3GV8B 5J1NA 2UUWA 3MEDA 3S8SA 3KHHA 1JLQB 2C2EA 3W2VA 3FRZA 3DRXA 3UE2A 4Z2XA 4AXJA 4TQSA 3DLBA 3GIMA 4G3IA 3GE9A 4DFKA 2ZITA 1IBLF 2XTQA 2GW8A 2VBWA 2X1FA 2OPPA 1GQEA 3D5MA 4NV5A 4KR0B 2VOOA 2X1AA 1SKRA 2RJZA 1RT2B 3GSDA 2ZDOA 3AAWB 1S9FA 2CQPA 1K0VA 4JCVE 3H2LA 1Q8LA 2GCFA 2WHOA 3DRSB 2J0WA 4WCEQ 1JNZB 5KFJA 1X9SA 1NK9A 1NKEA 2ZD1B 3I96A 3EXYA 2VG5B 5HLFA 1FERA 2FGCA 1QAJA 5DG8A 1E6VB 2MKJA 3ZZ0A 3FMWA 2J76E 4F25A 4UQGA 1PO6A 1RT7A 2WTFA 4WE1B 2MZ1A 1UVLA 1B7FA 1Q7YT 1FDAA 1S1TB 1TP7A 1FA0A 3M2RB 2DRAA 4JYAF 3UQSA 4RNHA 4R8UB 1JLBB 3K0JA 2DITA 3UI3A 3V6DA 3GV5B 1FCAA 3VAHA 4RBTA 3KK2B 3VR1A 3MMAB 2XTRA 4TYAA 1XNRF 4HDGA 5C42B 2BQRA 2CJBA 4OAUC 1X4EA 4FF1A 1AROP 2RT3A 5E41A 1KLMB 2VUGA 4NXNF 1WEXA 4BC7A 1XTZA 4MFBB 5J2PA 3K8VA 2Q6CA 3U27A 4DSIA 1TL3A 1IJFB 3I5AA 4Q5VA 4DSKA 1QE1B 1W3SA 3HKZD 5HROB 2QFJA 4Y2KA 1L3SA 1C0TB 1D8ZA 1NJZA 2J9DA 4C11A 4PWUA 1NK8A 4ZVHA 1JXLA 4NYZA 2IJNA 4KFBB 4ES3A 3Q8SB 4TLRA 5F8NA 4IG3B 4J9SA 2D3OR 4NA2A 1ZETA 1MMDA 4Q8EA 3N9UC 4DR3F 4AUKA 3KLGA 3ZC4A 1FKPB 5DGBA 2KZMA 1OPIA 5IT9Y 4LSNA 2UV8A 2W4PA 3GR1A 3I0RB 1S77D 3IAM1 4Y2IA 2FIUA 1FTCA 3UW1A 2XO7A 4I6YA 2E1AA 3OTOF 1KQKA 1U24A 5A0YA 1HBMB 3DOKA 4FVCA 3CCVS 1LW0B 3KLIA 2NUUG 1TK0A 4B08A 2LKZA 2F7VA 4Q0BB 1BQNB 2P22B 3R5CA 4PG4A 2MGZB 4U6PA 2FJWA 3M8SA 1SC6A 2FJXA 2KDOA 3OBIA 4MIAA 1JLFA 1DTTA 1NHVA 4PXCA 3UDLA 3ZZZA 2HNZB 3P49B 3TAMA 3MM7A 2OTLS 1NEEA 1Q78A 1J2VA 1S97A 2B3TB 3CEDA 2GQQA 4ECXA 1VQSA 2OMLA 3DGPA 1S1VA 3KLFB 3J7Z5 4ECQA 2FJEB 1S0OA 2OPSA 1U49A 1WI6A 3OTCA 3IRWP 4IQXA 2A10A 4A4JA 1IKYB 3BB5A 5HBMB 4K50A 4PUOB 4B9MA 2KI2A 2CIMA 2UUTA 1VQPS 1FO1A 2X51A 2CQDA 4F3MA 1LXJA 1NH8A 3VZHA 4FF4A 3QGHA 3IS9B 2LU2A 4IO9Q 3UDCA 1RTHA 1LK5A 2QIFA 1P8GA 1RGVA 2ZZNA 2KFZA 3PJXA 3POTB 3PO5A 1VQ8S 5J2MB 2W4DA 4JI2F 3H25A 2VPWB 4E8UA 1N48A 3HFKA 3NRBA 4C8MA 1RT3B 3M1VA 3MGJA 1AXQA 2YNFB 3HVRA 1HBOB 4H4MA 3SCIE 1NB7A 1Q1KA 5A8RA 4IFVA 5FD1A 1JWWA 1LK7A 3TARA 2ASDA 4M94A 2NREA 5B0FA 2XNRA 1A7GE 4PR6A 2Z0GA 2ZUGA 3F41A 4NZ7A 2IC3B 5LNK1 5D4NA 3QZ8A 3CJ3A 4C3LA 2CJKA 1WNEA 4LF4F 1RI7A 1KVIA 2FB0A 1P27B 3PY8A 5KG6A 4DX8H 1DRZA 3I5CA 3PW7A 1T05A 4JV1A 3AY0A 2GQ2A 4RW9A 5J2QB 5DO2A 4WZMA 1KHVA 4YR0A 4FF3A 4CQ1A 5L8RC 3VAFA 4E98A 1U1OA 1UA0A 5CZVA 2YNHB 4G76A 3KOAA 2YNGA 5I3UA 4OZ1A 4U6RA