3JSBA

Crystal structure of the n-terminal domain of the lymphocytic choriomeningitis virus l protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
173
structure length
173
Chain Sequence
HHDEIISELRELCLNYIEQDERLSRQKLNFLGQREPRMVLIEGLKLLSRCIEIDSADKSGCTHNHDDKSVETILVESGIVCPGLPLIIPDGYKLIDNSLILLECFVRSTPASFEKKFIEDTNKLACIREDLAVAGVTLVPIVDGRCDYDNSFMPEWANFKFRDLLFKLLEYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-terminal domain of the arenavirus L protein is an RNA endonuclease essential in mRNA transcription
pubmed doi rcsb
source organism Lymphocytic choriomeningitis virus
molecule tags Rna binding protein
molecule keywords RNA-directed RNA polymerase
total genus 62
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3jsbA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsbA02
5IZHA 3JSBA 4MIWA 4I1TA 5J1PA 5J1NA
chains in the Genus database with same CATH superfamily
1SL2A 3BV8A 2JB1A 2B8QA 2J9DA 3DOLA 3CCJS 4OMFG 4LF7F 2EVZA 4ALZA 2H51B 4WJBA 1F6TA 2B0GA 2VC0A 1DTTA 2R7SA 1JLQB 1ZAXA 2ZKUA 2DY9A 4MK8A 4ZPBA 5C25B 3FK4A 3QNWB 3A13A 4K8RA 4DPOA 4U8YA 2IC3A 3DA3A 1JKHB 3KDNA 1FD8A 4YY3J 2PN6A 5CAAA 2OPSA 3R1LA 2O01C 1CJUA 5LJ5Y 4LIWA 2VKRA 4OL8A 3MAAB 5DM6Q 1VQYA 3OVSA 2AZ1A 3H98A 2CG8A 2F8EX 2JC1A 1IWGA 2N4DA 2IBOA 1REGX 4KHRA 3ZZOA 2ZEJA 2PA3A 2NSCA 1EB0A 4ED1A 1GMWD 2RRAA 3MMAB 3HPOA 3QT8A 4HFVA 5J2MA 1S6QB 3KK3B 3AHPA 4ZJOA 5KFTA 5LSLA 1IKWB 3MD3A 4CZCA 1HPZA 3M2RA 2BQRA 1H98A 4C0OC 3E01B 2PI5A 2Y8WA 2W9BB 3FNBA 1R8CA 1JLFB 5KFVA 1FRXA 2R2UA 4B3RJ 2NR0A 1ZM2A 3UO0A 2ZITA 3R5GA 1M5KC 4B3MJ 4CH0S 3EXYA 3QLHA 2V4JA 3ZNUA 3MD1A 1UCNA 2E1RA 3HVWA 4JI3J 3GWCA 4EI2A 1UWBB 2GMHA 4WBFA 3EZUA 4CM2A 1IM4A 2AP6A 4RO0A 3F0NA 4Z7YA 1U49A 1WDDA 1D09B 4KV8B 4OV1A 3EGZA 4L76A 4ICLA 2ZVSA 2MLZA 1QTNB 1RB0A 1RTHB 3GMGA 1Y4ZB 3PVXA 5DDRC 1R31A 3DLKA 3W5YA 2LLZA 1HIYA 4CLKA 2F8MA 1HI8A 3S1TA 5DETA 4NXNF 4K4SA 4LF5F 2HQFA 3M6WA 5E3RA 5A8WA 1D0EA 2BKNA 4FF3A 2RADA 2AJ4A 2J8AA 1KTVA 2AT1B 5KG3A 3ULHA 3VGVA 3ZNJ1 2LFVA 3MPUB 4IR1A 1S1VA 2FVCA 1XNRF 2LKZA 2E5GA 3QSIA 4B3TJ 2IA0A 4GRSA 3OR2A 1HWKA 2EFGA 3BGUA 4I64A 4MJKA 3LP1A 2XQCA 2MHNA 4TY9A 2HHXA 3VGUA 2HEKA 3UD5A 3W2WB 2HURA 3SCIE 1U6BA 2FZCB 4YB6A 2RUSA 4X4NA 4ZOSA 2OO4A 1CJVA 2RVJA 2HLUA 3EJMA 1UVKA 4LREA 4WFAQ 2XGQA 1UVLA 2XG8A 4FYYB 1LNQA 1W2IA 2Q66A 3PR4A 4JCVE 4OX8A 4CO1A 1N5QA 1VQ9S 2QLBB 2YNGA 3FBEA 4HTIA 4ED4A 1PILA 4ZJQA 2Z2MA 4CWBA 2E7VA 3GTYX 3OQ2A 3TA1A 4HH1A 4Z2XA 5EDWA 3KHGA 2QL7B 4JI7J 1X31C 4NA3A 3LP0A 5MAOA 2CQGA 1OSDA 2FHMA 2VQFJ 3RBEA 2OLWA 3KHLA 3QGGA 3VVUA 1UETA 3MEDB 3UDLA 3S6EA 3UWTA 4H4KA 5C5JA 1FDDA 2W8KA 3FVVA 2OIHA 1ZH5A 1T8EA 3TARA 4X4OA 2W7OA 3G6VA 2H1YA 1IBMJ 3MM8A 2PMWA 1TUGB 3EVMA 4UQTA 2IYGA 3IA0A 5A8RB 2BKOA 3VAGA 3BH7B 1Y10A 4B9LA 1YBAA 2B4PA 3HHLC 3R5BA 4C98A 4J37A 1XJWB 2QZGA 4K4UA 5M2RA 4CYUA 1YJRA 4WCEQ 3B55A 3OVBA 3KJFB 1KHVA 5KFGA 5HQ8A 2W2QP 3OJSA 3K57A 3OTCA 4TN2A 1K9MT 4I7FA 3EPGA 3T9ZA 1SKWA 1VQ6S 3R27A 1RBAA 2UZAA 3LTOA 4PEOA 3R8YA 1GXUA 4B08A 2AJ2A 4F0MA 2KI2A 1ZTWA 1NK4A 2V9WA 1UEKA 1WC5A 2DKOB 3NGUA 1UP1A 2QFIA 4NLSA 3D0GE 2MYFA 3VTIA 5LMUF 2YNIA 3KXDA 2QYCA 2W01A 1EX8A 2M9KA 1N88A 3MZIA 5HSPA 1KLNA 3CO9A 5L1JA 1XMOF 4P2XA 1RAOA 3I4HX 3GIMA 3MURP 3DXBA 4IDKB 5ETQA 3RUBL 4ED6A 2BUNA 3K5OA 4MKAA 2UUCF 2Q6BA 4OJGA 3C14B 2GSCA 1SBRA 1X5OA 3OTOJ 1RTIA 2V8GA 1RDRA 2XMUA 3OLAA 2A0FB 2XY6A 5B0AA 4LRAA 4WE1A 2MZSA 2VG5B 5DG9A 1IKVB 4UZBA 5F8JA 4AD6A 5I3QA 1FJ7A 3SQOP 4O23A 3BN4A 5DM7Q 3KHRA 1JXLA 2R7XA 2B9WA 2CPXA 1QE1B 3M6UA 3AOAA 5FLXU 4FYDA 1SVDA 1HWLA 5KOXA 2KO1A 1U7LA 1S6OA 3OHAA 3RTVA 2PA8D 2OAUA 2XZWA 3BR8A 4RWWA 3S01A 1W3SA 4LT6A 2W9CA 4DV3F 3KWMA 2FY8A 1V3SA 4MFBB 4CI0B 2RILA 3DI6A 4ZITA 4DG1A 4QJVA 2AGOA 4M1KA 4FXWA 1U1NA 1QAYA 4EFAC 1IKXB 4F2SA 2RH3A 4NXMF 3J7AN 1F0XA 1DTQA 5IM0B 3SMZA 3ZZRA 3CJ0A 5KT3A 2IDEA 4NI2B 1F9FA 2LQ8A 2XMJA 1S0OA 1GMVA 1RT5A 4N8OA 1HBMA 1X4DA 1T9VA 3LAKA 2E7XA 3IGNA 3IRXA 1JLEA 3D66A 2FJWA 4M5IA 2C2EA 1HNZJ 2DNNA 3FQLA 3J7A1 2LEAA 1TUVA 4RX6A 4TNOA 4DV4J 5JJBA 3L4BC 4EBCA 1JXVA 2LP4A 2HAFA 4DS5A 2RS2A 1HBUA 5J2QB 2DXEA 3DRPA 2B5JA 3LWMA 1R0AB 4JI4J 1RKIA 1T9YA 2V67A 3CIMA 5HROB 3CC2S 4KJIA 4GKKJ 2DNMA 2BM0A 1RJJA 2XI3A 3QRRA 4OI1A 3CUNA 1S77D 4ZVQB 4B3MF 3IWLA 2IFXA 4C3LA 2DR7A 1G1XA 2QIFA 2VFSA 4P71A 5KOWA 4DL6A 4DPTA 2DNGA 3W8GA 3M8QB 2IP6A 4X4RA 2AYBA 3DRYA 2J7KA 3AXKA 4RW8B 4J9QA 1Q95G 2JB2A 2ZJPQ 2JOQA 1VRTA 2YWWA 3PM9A 2OD4A 1ROFA 2KXHA 3T19A 1D8ZA 2ZH9A 3CIZA 1S9FA 2FVQA 1UVMA 3R2CJ 2YTCA 5EGYA 1FWKA 3D7SB 2RNEA 1FJGF 4XPEA 5HMZA 4WTYA 4CO3A 2R8KA 3A8KA 1HR0F 3HK2A 3CCVS 2A1BA 3L95X 4EU0A 4ZKAA 2C28A 2ADBA 3H7HB 1Z1ZA 4ZPCA 1N8RT 3AY0A 4O4GA 1GT8A 3PFEA 1AFIA 5KG6A 2CAJA 3VR1A 1NH8A 5C42A 4M5DA 3AA8A 3CGIA 4TKTA 5F8HA 2CQ3A 3CJQA 3TAQA 1F2HA 2R7VA 1ZTTA 1OQ6A 1H3DA 1VR6A 3AB2B 4ILRA 4X4SA 4ECZA 2IRYA 3PR5B 3M2UA 2ZBRA 2WSEC 4LR8A 2CZVC 4OYAA 2WCXA 2G9OA 2JVOA 1MN7A 3ENAA 4K5RA 3LGNA 1R89A 2FJVA 1Y3KA 4U95A 3T5KA 1KOHA 1TQLA 3LJ2A 2J7UA 4WYWA 4G75A 8ATCB 2XCPA 3F73A 1AUDA 3NKYA 1BQNB 2I6WA 3PX6A 1IUJA 2AYGA 4URQU 1ZOTA 2DB1A 2DRDA 3HKWA 2DRAA 3SCKE 2DT9A 3QIPA 3N9UC 1TU0B 4KRWA 1JQGA 2CWKA 3DLJA 4KE5A 5C7PA 4TU9A 2WVFA 4DFKA 5G0RA 1HHTP 4O1PA 1KWMA 2DIVA 2HNDA 4S0MA 3WIVA 1VRQC 5CYQB 1CG2A 1JK9B 1NRKA 4NYZA 3DRRA 3M8PA 1TKXA 5EWFA 1MMDA 2ZC3A 3PX0A 1B3TA 2EC2A 3AXMA 2FHJD 3HSZA 4RU9A 1TK5A 5IXUA 1T0TV 4HI2A 4IFYB 3JQMA 4DV0F 2MJFB 3OFGA 1FCAA 1REVA 2BRKA 2F3JA 2EFOA 1HYSA 3S8SA 3T1HJ 3T1HF 3IO1A 3OTOF 5AE3A 3M8WA 2FY1A 2DXFA 2DO0A 3TJAA 5KFBA 1YITS 3MXHP 3GFXA 1F60B 3JYTB 2EWHA 2YY3A 4M5MA 2YFAA 1ZA1B 4FXVA 4Q45A 2FPHX 1VC6A 2VJVA 2NSBA 2IBKA 1QJHA 1CLFA 3M1VB 2QX0A 2IJNA 3MEGB 2XMXA 2DGUA 2H54B 4A48A 2AHOB 5LMUJ 2F4VJ 1C0TA 1RT1B 2L41A 3KK1B 4JV2A 4R8UA 2BQUA 1UJ6A 3JSYA 1T7PA 3C3LA 5AJ3J 2N7CA 3HJFA 4LSNA 2W25A 2MKSA 1HFEL 1FTRA 3D9BA 3FZ2A 1WNEA 1VRUB 2EFNA 2KYXA 2XMWA 3GSIA 1HNVA 1VHIA 2NS1B 1F9HA 1Q16B 2FHKA 2R4FA 3K7RA 1WF2A 3OSNA 2C2DA 2FLPA 2MTLA 3IAS9 3Q8PB 2JEJA 2FC8A 5I42B 4O3OA 1WF1A 1XTZA 4NRUA 1U1QA 2MB0B 2L08A 5CCLA 4OHVA 3HHLA 2QGFB 4OYOA 4LRFA 2D3OR 1NSKL 2G0IA 1N4LA 5IS2A 2CQ4A 3FC9A 1PJ5A 3IC1A 1HNIB 3SSSA 4DUYF 1X4FA 2I8EA 2FGOA 2FQQB 4ZIVA 2V9KA 1U1LA 2D41A 3NCRA 1N33J 2IJFA 4C3KA 1TAUA 4NZ6A 1KN6A 1PC5A 5F9NA 4DN0A 4WK1A 3KMSA 4RKUC 1BQMB 3NBPB 3N6MA 4FP9A 4QIWD 5B0FA 2ZJQQ 2CQ1A 3CVKA 2FJDB 3CCLS 4A8QA 1TTHB 1MWYA 2KL8A 2HG4A 2MKCA 2VPXB 4JI0J 1U8SA 3HFKA 2NUHA 3IFEA 2J0WA 3ITHA 3NGRA 4RUBA 1ZETA 3IBWA 4H4MB 2JLGA 2HHSA 2VBZA 2EKNA 2BW7A 4GMKA 3C8YA 3WQPA 2M70A 2OELA 4JYAJ 3HXMA 4J9VA 2BL7A 2VBWA 4QYZK 3QZ7A 2BJEA 4V19J 1D9AA 2AJQA 2OFHX 2ZD1A 3BKUA 1HA1A 1JXEA 1X8DA 2RKIA 4IG3B 4MIWA 3IGVA 5KFOA 2BRLA 4QYZJ 5HAOA 1VI7A 1U5KA 3RG6A 1SJ4P 4ZVGA 2QTWA 4OZJA 4ZVFA 3KK2B 4J9PA 3C2PA 4RW6A 1KQFB 2WONB 3EMTA 2DNLA 2I0XA 3B6BA 1S1TB 1SQFA 2PO4A 1A6LA 1DHMA 3DDNA 3NWGA 2E5HA 2JB3A 1HW8A 2OPQA 4KIAA 4P7TA 3V2UC 4DQRA 5U47A 2XS2A 3R2DJ 2QLWA 4DUZJ 3LP2A 3OXGA 1RHKB 1YSJA 5E0OA 3V4MA 1R27B 4Y2IA 1LFPA 4F7VA 2WHOA 2VL1A 3HI9A 3BB5A 1FRLA 1VQ8S 1JMTA 5DGAA 1DY3A 3KLHB 1F1BB 3PW2A 3LPYA 1HBNB 2OPPA 2ZDOA 3IRWP 2CNKB 2EBGA 1JLCB 2K1RA 5GMKa 4HACB 1S5ZA 2VQEJ 1UKUA 2ZWPA 1IR0A 1K73T 2AZ3A 1B64A 3BGFA 5SUHA 4NWBA 4F4AA 4EYIB 2ZHBA 4OZ0A 4DR1F 2ACYA 4K4YA 3I82A 2HFUA 2H5JB 1PJ6A 4F50A 4OX9F 1YJWS 5D77A 4DCPB 4LVNP 1ZA2B 1KRPA 3H25A 4F02A 2ZOFA 3H4BA 3FBVA 5CQGA 1EARA 4CH1A 1FKOA 2J6TA 4B3RF 3MCOA 3SV3A 1NSAA 1WUUA 2WSFC 2YH0A 5HBMA 1FVSA 2MJNA 2OSRA 4KBIA 5T7LA 4KPYA 3OFFA 5E3PA 2OJ3A 5LSRA 5MLCV 1B70B 2HBZB 3H0PA 4K2JA 4YB1P 1YIJS 3BSOA 4OI6A 5KG0A 1QTMA 1IBKF 1HMVA 4WF9Q 2J6UA 4GVBB 1ZAVA 1H74A 4PG6A 1X4GA 3MM5B 3Q8SB 3QPIA 1U47A 1YRTA 1L3TA 2A18A 2JRSA 2F6MB 4IR9A 3K2YA 3UCZP 2R7UA 3TYTA 2FLLA 2CDQA 4PG8A 4O1OA 1MROA 4DBQA 4M95A 2I2YA 4L72B 4IUFA 4C8MA 4F04B 4EBDA 3BPSP 3ZZZA 1UL3A 1UTAA 3OL7A 2PT0A 4OYMA 3TVZA 3FSYA 2DXDA 2QG9B 2MKHA 3GYGA 5F8GA 4DV0J 2XO6A 3TQ1A 2BDPA 3KTQA 2AEJA 3I0SB 1BC6A 1Z2LA 1Y11A 3B4DA 5J1EB 1K44A 2P9GA 3GILA 2BA9A 1AT1B 1HMVB 1WC4A 4PXEA 1IBMF 4Z37A 5KG2A 2JBWA 3NG8A 3NMRA 1GNKA 5D0HA 2YKPA 3CC7S 2E7WA 1FFGB 4N8NA 5HP1B 2K3IA 4UZCA 5H9FK 1RT2B 1PJ7A 5T7LB 1NB2A 3BGOP 4F26A 3BN7A 4CT8A 1AW0A 3P4UB 5HBMB 2CQHA 4LSLB 4L6V3 5ETMA 1TUWA 4JI7F 4DDFA 1MLAA 3Q8DA 3BYRA 1SH0A 3NRBA 3PKYA 3NY0A 2IHR1 2PFFB 2ZBQA 1EJ7L 4FF2A 3CULA 3CMES 2IRUA 2LQJA 2B43A 4RLEA 2HGKA 2AYEA 4IYQA 3W66A 3GIKA 2BJ7A 1GX5A 4L74A 5IV4A 2D3O1 2A2CA 3HT0A 3CMAS 2C3YA 1WF0A 4FN5A 1U0HB 3FRZA 3TZZA 4K4XA 1YBTA 2W4PA 3H2LA 3BEGB 2HRUA 1VYAA 4KHPF 3RRKA 2DR5A 5EWEA 4ID8A 3OD2A 2K1RB 1RAFB 1TL3B 2HQIA 2HRTA 4HT7A 2AYMA 3M6VA 2Y1IA 3ZTPA 2L48A 1KLMB 1CBKA 1R7IA 3CJ8A 3TA2A 4CLSA 3DMJB 2LA6A 5BYSA 4R5PA 4MIBA 5KFQA 1BLUA 2OFGX 2F66B 3ZZ0A 1XNRJ 4ZLJA 3N79A 3BBBA 2XBPA 2XYPB 2L3MA 5J1PA 2DHAA 3MFHA 3LJ0A 2BE2A 4N56A 1R43A 1V5IB 3LGMA 2UXDJ 2DCLA 3VCDA 2NREA 1BUXA 4DV5J 4LF6F 2AW0A 5D4PA 1B7YB 1K47A 3KK2A 1PC4A 1KD1T 1U1RA 1SC3B 1VBXA 2GQQA 1FWPA 2OPRB 2M8HA 3TAPA 1HQEB 2MZRA 4DSEA 4J9NA 3D6FB 2H4WB 3KUEA 2DGXA 1NDPA 4USUA 3ILJA 2Q6CA 1EP4A 2DR6A 4C97A 1WDTA 1CSJA 9ATCB 4UT4A 5KG7A 4DR2J 1TZ0A 2HFVA 5AT1B 4RR5A 2VHGA 2DNKA 1Z4UA 4F67A 2X1AA 1XMQF 1S97A 2QE5A 3ITHB 4OLOA 4LF8F 2JEIA 5HLFA 4LF1A 2CJ9A 2NXUA 3KNGA 1S72S 4Y6IA 1S4EA 1TMJA 3HKZD 3GYXB 3NBPA 1WC0A 3JS9A 2K2PA 3AAWB 4ZJLA 2EK1A 4WP9A 1FKAF 5KT5A 2EEYA 3P23A 2BE9B 3PJ9A 1VIOA 2DD8S 2HBYB 1RAHB 3KLEA 4M94A 4CO5A 4I4BA 2LECA 2VOOA 2HHQA 4ZHRA 4ECYA 2QFJA 3MTKA 2D69A 3HSGA 1PYTA 1VQ4S 1JJHA 1J27A 2DNHA 3X3UA 3IMQJ 3KJVB 1FESA 1GMUA 5IT9Y 2FHOB 1H2VZ 2QA4G 1K1QA 3UD4P 3MOJB 2YWKA 4P10A 2H3EB 4AL7A 3OXLA 2YKMA 4PYDA 1PIEA 2HKEA 5I42A 5B0EA 5HGIA 1KKHA 3I9V9 4NA1A 4BWJA 4WFBQ 3GCXP 4MIAA 1S10A 1QAIA 2Y0BB 3H40A 1MW7A 2GX8A 5I3UA 2UVUA 4LF7J 4O3SA 5IWAF 1YRUA 3VGSA 4G3IA 2GGPA 1LWFA 1LWCA 4I56A 2CWXA 3DOMB 4MT1A 3WX4A 5BR8F 5A2QU 1C0TB 3KK1A 2Y8YA 2NPFA 4PRFA 1CPZA 2C2RA 2AX0A 4M5GA 2IRXA 3MPWA 4I2PB 1T05A 2HVZA 4B3SF 3DRSB 2ZOMA 4ID5A 5M2UA 5DDOC 1ITPA 3THVA 1E6YA 1PYSB 3N5BA 4B17A 4JV0A 2DPJA 4DQIA 3EUNA 2D1CA 5KFJA 4MAKA 2IMOA 1HYSB 3PZPA 1Q8BA 3JB9k 1RT6A 1UJ5A 2P6SA 3LGHA 3LUYA 4RBVA 3THPA 4UQGA 2ZNYA 3DYAB 2A10A 2IYIA 2UU9F 1BGXT 1Q8LA 4IOBA 4IFYA 2MGZB 4F4ZA 1G4CA 2J0QD 1GXLA 3ISNC 3D2WA 1RI7A 4PUOA 2FIUA 2M52A 5E5NA 1X4EA 3GJTB 2ZUAA 1HWJA 2CADA 3DRRB 1OY6A 3M8PB 1R8HA 5D4LA 1NK7A 1P9QC 2ZWOA 4P75A 4Q43A 4ILLA 4HTJA 5G0RB 1S0VA 1H6KX 3EGNA 4DLGA 4DCJB 2C2MB 2UVRA 4OV6A 4I1TA 1U2RA 2VDIA 3SIPB 1V3RA 2M88A 4YDDB 4LQ9A 4RZRA 4HR2A 2AD9A 2RIOA 1BQNA 4ECVA 3US5A 2XNQA 4K5SA 3I5CA 5CCMA 1IWAA 4P52A 1S6PA 2DGVA 1XR7A 3IR7B 4OYIA 4GO5X 5LXRA 5CD4H 1JX4A 2HGLA 4FXDA 4KH1B 4U7CA 2MY7A 2HGMA 5F8IA 3MI7X 1QY7A 4OLPA 3K5PA 1KVJA 1VGYA 2JDJA 2QSBA 1RE1B 1W26A 1EAYC 2QL9B 2X3DA 3HHLD 2CUYA 3MPYA 5HN0A 3MR2A 3L3CA 5LXYA 4ED2A 5H9EK 1VBZA 3IG1B 2RRBA 5J2NB 1FI4A 1O5JA 2GQCA 2J5AA 2J0XA 4PG5A 4ZLLA 3KG0A 4X64F 3ZZYA 4O4GB 1S6PB 2FTRA 3R5CA 5IC6B 2G1HA 4DCOB 2CPJA 1XK8A 4Y65A 4DJBA 2CXEA 5K8NA 4R0EA 3PXGa 3TEGA 4YB7A 3EXCX 4YUDA 1UFKA 4ZVSB 1NJZA 2XMMA 1S7IA 2GVZA 3MAQA 1N5YA 5A2QY 4A8OA 4DR1J 2JFKA 4UOCA 1DARA 1RHQB 4A8XA 2OEKA 2ZJRQ 3C66A 4ED0A 1FNMA 2R2RA 1VRTB 1RWMB 1WHYA 1PYOB 4KHMA 5ITHA 2VQEF 2U2FA 2E5LJ 4RNFA 1RK8A 3OUYB 1QAJA 2ILYA 3M8QA 3UNYA 4ELUA 4YR2A 4LF2A 5B08A 3PEJA 3MCNA 4H4KC 4O3QA 1WHXA 1UA0A 5KFZA 1EKSA 3FBFA 3R9LA 2XEXA 2IM3A 3CXCR 3EE3A 3FCHA 4QWCA 1GFWB 2QMWA 4GVLA 5HVFA 2I9SA 4DUZF 5HROA 3G6YA 1G2EA 1X60A 4YR3A 3A8IA 5J2QA 4JI8F 3TO8A 4DSIA 4JI2F 1RWOB 5FDLB 4YMEA 3HFZB 4O3RA 4C4WA 1Q1KA 1Y5NB 2EG2A 2KB2A 3C16A 1E6YB 3DHXA 3R6GB 4FNHA 5IT4A 4DL3A 3QO9B 3U7JA 2MSSA 4KFBB 3IRXB 1VQNS 4KH0B 5D0RA 3MR6A 3SI8A 1T05B 1NK9A 2WBRA 1ZZFA 1RACB 2AF6A 3EZOA 4WXWA 5GAHI 4NI2A 3W62A 5RUBA 4IO9Q 4UOFA 2RHQB 4JYAF 3CJ3A 1HARA 4RNHA 1NK0A 1NM2A 1MWQA 1U25A 2Z56B 3W60A 1IKXA 2MHEA 2GGPB 3C6UB 3J80U 2OI2A 1R8PA 2GV1A 2OP5A 2W2NP 3R7NB 3ZZPA 2W9AA 3PW7A 5I3UB 2YPYA 4YS2A 5L1LA 5L8RC 2P8IA 2W9CB 4J9SA 3CJSA 1U26A 5L38A 1P27B 1RAJA 1YO7A 2W24A 1KOOA 4CLYA 4TLQA 1SUQB 2V68A 3R5DA 4YY3F 4QQBA 2F7VA 2I38A 4RNOA 1D1UA 1MMLA 2B4UA 2DH7A 1HWIA 1U2FA 3UFCX 3TNVA 4ZP9A 1S6UA 1IKVA 2DCUB 3KDOA 4IO1A 3J7Z5 1SPBP 3F56A 3UVJB 2KZZA 2COLA 4ZHRB 3IBFB 1SQEA 4DQSA 3C14A 5CH7B 1S1XB 4ERDA 3C6TA 3BQ0A 3UITA 4IDKA 2V2ZA 5KFAA 2LVWA 4DPWA 2ASLA 2G4BA 4OIXA 5L39A 3T5HA 3CCWA 1VHFA 3CJKA 3CTRA 1W2BR 3H5YA 2HNZA 2BE7D 1NDLA 1NO8A 2YNHB 3LF0A 4LR9A 5KFFA 1LEOA 4ELTA 4WFXA 1Q5YA 4P74A 2ROEA 3MR3A 1VOMA 1R8AA 2YVSA 5HL7Q 2DITA 2JL9A 4J91A 3G8TA 4ZMMA 4EBEA 1PSDA 1WORA 3IAM9 3M4XA 3NS5A 2ADCA 2KFZA 4NCGA 4Q9VA 1RT3B 1EP4B 1NKBA 3G82A 1NJWA 2GW8A 2JH3A 1WELA 2VFTA 3CMQA 4ES3A 3PKMA 3UR0A 3HULA 2GNKA 2XO7A 1CJKA 3LPEA 4J90A 2V5HG 1LK5A 3VQTA 1D9DA 2UUBF 2LXUA 4NLVA 1T9XA 4GKJF 2R7WA 2V2QA 4EK2A 2JZ5A 3RRHA 4LQ3A 1WKLA 2YPZA 2UV8G 2UUAF 1ZM9A 3UNGC 4RU2A 1H72C 1B0TA 2EI5A 2R2SA 2CQDA 4K4TA 3DKDA 4ENOA 3HHEA 2FZGB 2ZC4A 4Y00A 3OV7A 1CJKB 4C9DA 2GQ2A 4IH5A 4WZMA 4O0IA 1O8BA 2XLIA 3MEDA 2DISA 3Q8RB 1MNEA 3G82B 1T9UA 3QT7A 4A8SA 3DGVA 1RT3A 3R3TA 3MUVP 4ER8A 1NKEA 3KMQA 1FF2A 2I5JB 2GMJA 2MQ8A 4N77A 5EHHA 5E41A 1Q81T 1TL3A 2JEFA 4UY85 1FVQA 4AS3A 4AYBD 4R5PB 1M5PC 4AT1B 5JUMA 5B0DA 2WOMB 2VH7A 3AOCA 3HZGA 2YNHA 3VZHA 3BR9A 3QJPA 3G6ES 3E3XA 1U0HA 2Q3PA 3CJKB 3AJ1A 2D9OA 1V6HA 4O3NA 3RAXA 1CJVB 4DR5J 3H20A 2QSWA 2M5YA 3UDCA 4DMZA 2ZH1A 5JVHQ 2EKYA 1ZYQA 4TQRA 2MKIA 1TVRB 1RUSA 4LFBJ 2AIRB 4NL5A 5K20B 2KG1A 3D6HB 1XWLA 2XC9A 2DO4A 3LP1B 5KFLA 4CT9A 3K59A 3NWRA 4HHHA 4DPYA 1I6JA 2CPEA 2DNRA 3D6MB 3UVJA 2CQCA 4A46A 4F4XA 3PYFA 3PY8A 4PG4A 1LKZA 3D5MA 2DK2A 2Z8QA 1H2UX 4NZ7A 2LU1A 1M1GA 3NS7B 5A8WB 1QDUB 1TDPA 1RAEB 2G2YA 1RWKB 2KKHA 4OHWA 2HHUA 1KVIA 4PL3A 1RQ0A 3QFHA 3DLKB 3V81A 2HSEB 2ZZTA 5DQGA 1YRXA 3ILIA 3EYZA 1RU2A 2G13A 3C6UA 3R5JB 4K0KF 3QGHA 4ICLB 1NJIT 5D4OA 4KV8A 1U1OA 2XSFA 2YXLA 1FE0A 1RBLA 2HHPA 3BSAA 4USVA 1WEXA 1U45A 1L5UA 1N36J 1FRMA 4F3QA 1RTZA 3NLCA 4OZ3A 3RBDA 3OSPA 4KFBA 2R2TA 1X4CA 4USJC 1PAEX 1URRA 5HJYA 2IY5B 3G86A 3R5AA 4DV6F 3MEEA 1OQ3A 1QVFR 2C2ZB 1RWUA 1TKZA 3CD6S 1JLFA 2NQPA 3MM9B 3MM5A 5JVGQ 4Y0FA 1X9WA 2HHWA 1XBWA 2DEJA 3E01A 4NLDA 4UOHA 1VJQA 5IC4B 3D0IE 1F5CA 1HPZB 1WKJA 3M2RB 5A6WA 5FJ4A 1IKWA 1ZBTA 2APOA 3DLGA 1JJCB 4XAKA 1XEZA 3I0RA 1P9YA 2ZH7A 4LF5J 2HFNA 5AXKA 4CH7A 5A0YB 3I9ZA 3M9MB 2IM2A 1SJ1A 4X66J 5L1KA 2BM1A 5KFIA 4TU8A 1VLYA 4JI0F 3W1YC 2KHDA 3FQKA 3TR5A 4ZLNA 2XULA 5HQMA 1UMJA 3OUYA 4U7UK 3W61A 1I1GA 2CPIA 4LBHA 2NPIA 1VDHA 3N6NA 4PR6A 3J80Y 3T1AA 2GVZB 2J8SA 4KT0C 1N5YB 2WRMA 4HH0A 5F3ZA 5KG4A 2Q43A 1DTTB 3FNNA 4JI3F 1RCOB 3AD9C 4LFCJ 2PC6A 2R7QA 3MUMP 2Q79A 4FPIA 4ETXA 1SH3A 2EC0A 2BL8A 3IS9B 2DNYA 2KN4A 3DLEA 3U02A 4B9MA 4W90B 3VQSA 3N28A 4DR6F 3IG1A 5J2NA 1UVIA 4FYXB 1ACMB 2D74B 1WG5A 3KLHA 3FSIA 1U09A 2GO9A 1MN9A 5EX0A 4RW4A 4NLOA 2XGPA 3FKBA 3G6XA 3MECA 3MGJA 1R0BG 2P6TA 4KGKA 4OHXA 3T6BA 1K0VA 3GZ7A 3LALA 5HVHA 2XMVA 3M30A 5AJ3F 3PO4A 4N7TA 2XB2D 1QUPA 3GJRB 4X4QA 2V94A 1S1TA 2VPYB 3FFIA 2WONA 2V63A 3D68A 3MMBA 4C8OA 1K8AT 1RA7A 2W4CA 3TOQA 3KLFA 2KG0A 3W2VB 4KO0A 2D3UA 2WW4A 5GAHU 1SH2A 2ATCB 3J81Y 1VQMS 4JI2J 3FCVA 4UW2A 1LQ9A 1DLOA 3Q8UA 2OMLA 2XWYA 5JMNA 4DS4A 2K7KA 4QU6A 1G6BA 1ZPVA 5EUHA 4ZK7M 4F4YA 3QAUA 3DYAA 5IQQA 3W65A 2UU9J 5J2PA 3RYLA 2CIMA 1RT6B 1RTDB 2E8GA 4X62J 4XIUA 1HI1A 1NHKL 2IM0A 1SKUB 4UTGA 4AQYJ 1E6VB 1YBUA 4R25A 2NLWA 5KFNA 3M8YA 1TELA 1TL7A 2UUTA 3MAHA 2JVRA 2A3JA 4ID5B 1SL1A 2YKOA 1MG7A 3AH6A 7FD1A 3PYEA 1I3OB 4I2PA 4DUYJ 3NNHA 3PIOQ 4ZCMA 1SXLA 2OD6A 4C48A 4I67A 2VQFF 2AV5A 2MQNA 3DGPA 1HNIA 4WU3A 1YDLA 3DOKA 2ZVIA 4HEA9 2LA4A 3DOMA 1C1CB 3UDVA 2JHEA 1FNXH 5KFKA 2ERRA 5KFMA 2VOPA 2B3TB 3QYYA 4DR5F 3K0JA 2Y9HA 5LT5A 3NMAA 1UEUA 1TL5A 4ES1A 4MKBA 3RW6A 2RDDA 1HHSA 2DPIA 1Q86T 3A1YG 3DRXA 5BYQA 4LF4J 1VRUA 2YKMB 3KG1A 1S9GB 1GEHA 4LSNB 4B9NA 4Q8EA 5D4NA 4NLGA 3TJ9A 2YX1A 1P6TA 4HI1A 1RT1A 5A6PA 4X4TA 2F4VF 3DGPB 3MEGA 4QOTA 4YEAA 4ZLPA 1Q7YT 2N3LA 1RADB 1WI6A 5DS7A 1IBLF 5SZTA 1FJGJ 2G1DA 1LOUA 3QAEA 2DR9A 2KU7A 1KTQA 3D0HE 2HS4A 4KSEB 2HHHJ 2OEJA 5FLXY 1PG5B 4TVAB 2BJ9A 4WYLA 5K8OA 1C0UA 1KVKA 1E6VA 3KFWX 1WI8A 1OY8A 3WBZA 5F8NA 2E29A 4QIVA 5J2PB 1REVB 1QAXA 4DF4A 1YJNS 5CXTA 5ETLA 2V0NA 3IN5A 3BDEA 3BO2A 3CD7A 4OX6A 2FLNA 2HS0A 2UVVA 3MWBA 5E2QA 3UD3P 4E0DA 2GJIA 2XM3A 1VCTA 1TKXB 5D78A 1DLOB 2V8DA 4DV2J 2YFBA 5KFPA 4RPFA 3GV5B 2GJFA 2E9TA 2QT7A 3J7YU 2XNRA 3M05A 4KO0B 2YBVA 3G9CA 2QV6A 3KLFB 5IT9U 3SDEB 2QO3A 1PBAA 2N7YA 3I96A 3GJQB 4P2MA 3CPWR 3PW5A 1WTBA 2ZOGA 1T9WA 2KHCA 2BE2B 2K19A 1FHTA 5D8HB 3QSYB 4PQUB 4JI6J 3GONA 4C0HA 1GTHA 1LXJA 9RUBA 1GQEA 1SJQA 3CCQS 3DMJA 1N32J 1WC1A 4RW4B 4HEA1 4PXCA 1KLMA 2VBXA 4RBTA 5D0EA 4C8YA 3SSQA 4AXIA 1RAIB 3ONQA 3W9IA 4FNIA 5CA5A 4X65J 4LFAJ 5CYJA 4ZVOB 2I1RA 4ECXA 2BOPA 3MEKA 2JEGA 1FT8A 4F25A 5IQ6A 2V4QA 1FA0A 3IS9A 4FPRA 3A8JA 3KLIB 4USHA 1W25A 4YN3B 4NYPA 5HMXA 2L1LB 4IOCQ 4NCAA 5K5MA 2WSCC 2RT3A 4CO2A 2ROPA 1KONA 4Q2LA 5AE1A 1B4SA 1CULB 2VZ9A 3WIUA 4BS2A 4M5HA 2UUCJ 1LXNA 4DWLA 1XR6A 3DDIA 1HL6A 1RCXB 2NCKL 1R6VA 2W2PP 2WAQD 2ZHAA 1BQXA 1NB7A 3SXLA 5HK4A 1HI0P 4FBTA 2F4FA 2UXBJ 4IFVA 2E1MC 1U24A 3OFHA 2HVIA 1WEYA 1YX2A 3I9V1 2EPIA 2F9JA 2LXIA 4PWWA 5A0YA 8RUCA 5IT0A 3I0RB 4LVOP 3VAFA 2OTJS 1HBOB 3HVAA 3BSNA 1S76D 2KM8B 3DLGB 4F4WA 3CO0P 2UVWA 4WP8A 5J1EA 2LMIA 3MM6A 3I0SA 2KKMA 3SEOA 3RB3A 3QWUA 3KJNB 3R6LB 3MM9A 1S9EB 4KPCA 1XNQJ 2JWNA 1TKZB 2E44A 3DU6A 4KQZA 3MEEB 3PRBA 1N34J 4DI6A 2HHVA 3Q22A 4JV5J 3IP0A 5B0CA 3B78A 3QJLA 3MMCB 1UVNA 4CLUA 3RR7A 1A9NB 3JTPA 2HWTA 1DTQB 4G1QB 5KFXA 4WIQA 4ZPTR 2H4YB 2ZH8A 3DI6B 4HHUA 1ULRA 4GVBA 3EX7B 3V81B 3V5RA 3ZZTA 2MKJA 3H5XA 5L1IA 3A3NB 2CJQA 2GIFA 1FRJA 2VICA 1H7WA 3KHHA 3NGSA 3DLLQ 3MCSA 4B9TA 3UW1A 2CFXA 1QE1A 3H90A 2NXJA 1UW4A 1FJEB 1JLBA 1NHUA 1XMBA 2XLJA 1CQMA 5H9FJ 2DGQA 3GR1A 1IR1A 3HFVA 1N0UA 2MKKA 5LL6d 2XHWA 4USTA 3WX8A 4AUKA 4JI5F 2OMOA 4P2FA 1R0AA 1FKOB 1NK5A 1Z2ZA 4JV5F 3TX0A 4WZQA 4BC7A 4EGLA 1NDKA 2XY7A 1TVRA 2Z4PA 1QSLA 4QIGA 3GQCA 1SQGA 2VJUA 4K7QA 5A8KB 4DUTA 2JLEA 3NOGA 3EPIA 2NUUG 1C4CA 2XS7A 4U8VA 3OT9A 1X4HA 1YTYA 2YNIB 1FRKA 2VV5A 2EW9A 1GH8A 2WOMA 2YX7A 5IZHA 3TUZC 3AT1B 4HDGA 3G4SS 1JLCA 4NV5A 1AXQA 1CS4A 1S49A 4ZVPB 3UI3A 4PAAA 2YKAA 4DR3J 3T5JA 1H38A 2I5JA 3CJ2A 2WK4A 4RWXA 3WZ0A 3T1YF 2IA6A 4NXNJ 3PDNA 4N5SA 3EICA 1LV5A 2FD2A 4ANEA 1HNWJ 3VF0B 4OX7A 4Y2CA 4C8ZA 4QWBA 4F36A 3SV4A 5THWA 2CJKA 2HYIB 3M8ZA 1ZAWA 4RW6B 5IFMA 3RJMB 1TKTB 4IQMA 5GAGU 2YWFA 1IJEB 3WC2A 5KAKA 1YKWA 3I32A 2MLXA 4IG3A 2ZBCA 2ZD1B 4B9UA 2UXBF 5KFRA 2NZ4A 1NBEB 1WWHA 2A6MA 3M7VA 4IG0B 2AWZA 4NMXA 2N82B 3SYZA 2MDAA 4A8YA 5DDPC 2HK3A 2DNPA 3LP0B 4NCGB 4OYXA 2OH2A 1KBRA 5E3CA 4LF9F 2LCWA 2YQ0A 1VC5A 2KTQA 1M0SA 3U27A 4H4MA 5IWAJ 1C1BA 1YJ7A 1M5HA 4RJVA 3V6DB 2C2OB 1YZ7A 3ENVA 4EMDA 4EUVA 2WTFA 2CJAA 5ETTA 2HNZB 3PFOA 4KC5A 2BR0A 4MK9A 2YNFA 4LF9J 4IRDA 2KVQE 1BQMA 4ECSA 2HIQA 1R3NA 3G2XA 1QVGR 3A3PB 2ZUGA 1HD0A 3NS6A 1OIAA 1UJ4A 4W98A 5GMEA 4XPCA 2R7OA 3W2WA 3C6TB 3H42A 2DYAA 1HKAA 1S1XA 2HVDA 2J76E 2O67A 2MQMA 4KGVB 3AODA 2LDIA 2V2VA 3V6JA 2BJ1A 2DIUA 5LJ3Y 2CRLA 3OR2B 1X9SA 3Q8QB 2XSJB 4Q2MA 5JXSA 4ECRA 1G7CB 3TUIC 3UPFA 3BGRA 1RT7A 3HHLB 1YJVA 4ELVA 3M8SA 4OYZA 4F8RA 1SUQA 1CC8A 3P5BP 3K5NA 4Q8FA 4RBUA 3UR3C 3NNCA 2HIYA 4MTPA 2QZ8A 3CF5Q 1FWLA 1HNVB 3N5FA 4KB7A 4L73A 4AE5A 2QN6B 3TEHB 2E5LF 1URNA 4DL7A 1PO6A 3VGTA 3CWJA 2QA4S 1RTHA 2BJ8A 1M1HA 1XIQA 3S7RA 3QATA 1J5EF 4DX8H 3H5SA 1PAUB 3QIDA 4R8UB 1Y5LB 1CQNA 2HZVA 4DV2F 3T3FA 2DTJA 3FMWA 3OTDA 3M1VA 2FZKB 2F40A 3HO1A 3CCMS 2V2KA 5B0GA 4KY3A 4PKDB 1UWBA 2DGSA 2QRRA 3ETMA 5HVGA 4U6PA 2Y3YA 3D4JA 3VAKA 3QO9A 4LBIA 1F9EB 4QIFA 2XI2A 1NPKA 1RWXB 1WG4A 4Y3CA 3SCJE 5DQHA 1F5BA 3QGPA 2VDHA 3C16B 4X64J 2HMIB 1F3VA 5FDLA 2GHPA 4Y2MA 1FE4A 4ZPAA 2MLYA 3K17A 3M2VA 1UFLA 3AJ2A 1FRHA 2BQ3A 3J7ZT 3HJVA 1B7FA 1VQSA 4USKA 4DX7A 3LAMA 3D6TB 3MMAA 1LW0A 4V1Ak 1SC6A 2AMCB 3RAMA 1UWAA 2QJ3A 4PWUA 1OSCA 4KGMA 2VD3A 4PZVA 4DFPA 1WEZA 1Y3JA 2HNDB 2FUG1 1YWXA 4C3MA 2CNNB 3ZTQA 2HS3A 2OPSB 2GC8A 5GAEI 5IOLA 4DF8A 2JX2A 2FEFA 3SQGB 5M2PA 3MCMA 4Y28C 2IC3B 1RKJA 5HANA 1NPPA 4ZN1A 4XDDA 3W7BA 4C0BA 3BBFA 2H5EA 2HK2A 4DSFA 1VQLS 4OAUC 2KJVA 3V4IB 4UY8T 2XTJP 5GADU 1Y5IB 4FVCA 1FX2A 4QR1A 2LQBA 1SJ3P 1NSQA 3GIJA 3DOLB 3BO4A 1WHVA 2QA2A 3B82A 4DSLA 1S79A 2QMUB 2V34A 3JTNA 5FIIA 2RD5C 4TU7A 3HF5A 4DOZA 1M5VC 3M2UB 2R8IA 1O51A 4W92B 1UW9A 4CDIA 4WXOA 4TYBA 1DRZA 1N6QB 1FEHA 4LIRA 5DG8A 1VISA 1APSA 1Q79A 3GG0A 2XCAA 2MQLA 2GVDA 1FEEA 4NLYA 1NSPA 5KT7A 3BQ2A 3DM2A 2GJ2A 2CNLB 2ROGA 4TXSA 4ZVUB 2B7CB 4PXDA 5C42B 2EFVA 3SZ2A 4ED3A 5EN1A 1YJUA 1OPIA 2MZTA 2ILZA 2MY8A 3KG4A 3SBMA 2PE8A 2PFDA 4CO4A 4GC7A 1D8YA 2OTLS 5KFSA 4D3GA 1FDNA 1FK9A 5KG5A 4FF1A 1NJXA 1S1UB 3K8WA 5AE2A 1V5VA 4JUZA 4DFJA 4C8LA 1RYSA 1TV6B 3TJ8A 3GB0A 2NXCA 2P22B 4I6AA 3TUPA 1Q78A 2QL5B 4K2XA 3Q83A 5KFWA 3W64A 2CQPA 1X9MA 5AXNA 3PW4A 3VAMA 2PEHA 3V6HA 1NK6A 1S12A 2VBYA 4P72A 4PUOB 3PACA 5B7WA 2VPZB 3QT5A 4NRTA 1TK0A 3BKFA 3CT9A 3O3LA 2MGZA 2RUGA 3TI0A 3O44A 2LYVA 2J0SD 2X51A 2RS8A 3TA0A 3FCWA 4EZ9A 2B5JB 4JI1F 2DH8A 2W2OP 4LSZB 4TQSA 4JI4F 4F0HA 1RISA 1KFDA 1QSYA 2RDIA 1S48A 2R8JA 5GMDA 4WKYA 1CC7A 4U96A 2B4OA 4DX6A 1N32F 1J2VA 1IKYB 3P49B 3NAIA 1JLEB 5E3AA 3W9JA 1VQKS 1HQUA 3DRSA 1HBMB 3OW2R 1ICEB 2DGOA 1N54B 1YJTA 3OL9A 1OMSA 2G0CA 4ZDNA 1U0SA 4FKYA 2GHVC 2DY1A 3SCLE 3TUJC 2BJ3A 3H4DA 4QR0A 4WFYA 2NZCA 1F2GA 5BXIA 5A76A 1LWCB 1LWFB 1WJ9A 4OJHA 3KYLA 4DG1B 4LF8J 1U6FA 4N76A 1UA1A 3DC2A 2QEXS 1RAAB 5ETVA 2WW8A 5D6GA 2WVDA 3R1HA 3X1LB 4K59A 4PG7A 5CD4A 3HZEA 3A4TA 3FUYA 1J5OB 3PIPQ 4JI1J 5DZ7A 1RP5A 1R0CB 1NZAA 3CEDA 5F0UA 3LW5C 3LANA 4ILMA 1SJ8A 2V6AA 2AGQA 4OJ1A 2HGNA 3KJVA 2VG5A 4K4VA 2QMXA 4U9RA 3BBCA 4J5OA 5DLFA 2F65A 4LF6J 4M8LA 2IVFB 1RTIB 3HD1A 4PYAA 1NMEB 5F9LA 1N36F 1RWWB 4CLFA 3KLEB 4IQXA 4ECQA 5T14A 2HLTA 4USIA 2RMLA 3Q2SC 4KGXB 2HHHF 2RQKA 2IIHA 2VFVA 2ZBPA 1MU2B 2MQOA 4AS2A 4DU8A 3QMQA 2CZ4A 2NYIA 5ETNA 4E8UA 3SSRA 1VBKA 4ZVTB 4C11B 5HLFB 3W63A 3AQOA 4GKKF 4N41A 2LEBA 2ZH6A 1W7WA 3HVTB 3GV8B 1YI2S 3RAQA 3I6PA 2VA3A 3UCGA 3G87A 4RW7B 2L9NA 4IH7A 2X1GA 1VK8A 3L7PA 1KQKA 1CVJA 1Y00A 4NZ0A 2MZ1A 3PW0A 1I94F 5GAEU 1FFSB 1HQEA 3CJ4A 1IJFB 4PPZA 3RBZA 4F2RA 1TP7A 2OEMA 2OPRA 3CCTA 2V4RA 3EM1A 3BQ1A 1WTFA 2DHGA 3DXSX 1VJWA 3IM9A 1UFWA 3A8EA 3MM8B 4DR7J 3L09A 3PRDA 3BZQA 4YHHJ 3CDEA 1XR5A 4OZNA 4F4KA 4AXJA 3U1NA 5KTQA 3GR0A 1IQZA 3LQVA 4J9RA 3CDWA 4OZ5A 1HR0J 2M0GB 1JLAA 4RW9A 3RW7A 2OGUA 1NXIA 1U8WA 3B4MA 2ZM6F 5KFYA 2KM8C 3CCRS 1KDNA 2FDNA 2XYGB 3F41A 2XMKA 4Y34A 4A47A 1AB8A 4AQYF 2ASDA 1VBYA 4NLPA 2X3GA 3FEZA 4Y2AA 3R7SB 3FJ2A 3B54A 2DRBA 2CQIA 1NU4A 2ZW3A 2YNGB 2XYHB 3KUGA 3N01A 3OTEA 4Q44A 3GP9A 3PJXA 5DO2A 4BDPA 2RQCA 3BPDA 1PGZA 2HBRB 5D3GA 1RBOB 3FEXB 3MR7A 1DQ8A 1S4FA 2C2NA 2VPWB 3EVOA 1A0OB 3FZBA 3GCWP 3P45B 5EX3A 2WB1D 3RZAA 4B02A 4C2MA 1RT4A 2NXNA 3CCSS 1RYRA 2IPOB 4O0NA 2FJAB 1L3VA 1T03B 3HMJG 5H9EJ 3KKFA 2FJEB 3P5TL 4OI2A 5DJBA 3T9NA 3GFHA 1YJ9S 1U1PA 3PV8A 3BDPA 3J81j 1KHWA 2HQDA 5T41A 2VG7B 3W5XA 4LSLA 2CVIA 1AZSA 2KYZA 2R8GA 1FTCA 4GXTA 3UCUP 5L9XA 1X5TA 5CZXA 1S1VB 4NLWA 4B3TF 1RT2A 5L9NA 2BANA 4B3OB 5HP1A 4BCAA 3HDSA 3OPKA 2V8HA 5F41A 1TK8A 4OI4A 2LXFA 1NUEA 2GA7A 3KJQB 2ZFHA 5ETKA 4ECUA 3MUTP 3ET6B 4OI0A 4JP8A 3QT6A 3VWSA 2ZZNA 3RBXA 5HO4A 3G71S 4OZLA 1JB0C 2F1FA 4ZN3A 1VLOA 2BEFA 3PTWA 4CNZA 2GIRA 2HVHA 5KFUA 4EYHB 4NYOA 2XLKA 4HLBA 3M8RA 2UP1A 4LBPA 7FDRA 2JSXA 3VVTA 2E1PA 4OX9J 1MROB 3CJ5A 2V4JB 2RAQA 3VZIA 2FHJA 3QBCA 1J5EJ 4JV1A 4I69A 2G0JA 1IQTA 1IXKA 5DZ6A 2QLXA 2HVEA 4FS2A 6FD1A 2CJBA 4M63A 4DX5A 4NX9A 1VMBA 1F5AA 4CNYA 1IM6A 4I0WA 3LWLA 2DNQA 2HNYA 4CTAB 4URGA 2W9BA 4ED8A 2VFUA 5J1NA 5AXMA 1T95A 3GE9A 4B9SA 3C46A 3DU5A 2Q1LA 2Z57B 2C3OA 1S6QA 3KK3A 1Q53A 1T11A 2YQ3A 1RWVB 2CPYA 3OL6A 1Q4RA 3KLVA 2BX6A 3CD0A 3LA0A 1WOOA 2ALYB 1ZS6A 2CPDA 3MAAA 4BC9A 1N0VC 3TANA 1CJTB 2C3MA 1YZ6A 3D28A 2VUGA 1IR2A 3W3SA 1JKHA 4DR4F 3OTBA 3T6JA 1T3NA 1RHUB 2SXLA 2QLJB 3GU0A 1L3SA 5C25A 3DLBA 4LFAF 1SJFA 4URSA 3TW0A 3AJFA 2DJWA 3AQPA 1YGYA 4O4RA 1U4BA 3NCQA 2MJUA 3E8OA 2BZ2A 2L9WA 4CM0A 1FD2A 2ZH3A 3VALA 3KOAA 2HZAA 2BANB 1X0FA 1H0HB 2LQ9A 2RDJA 1HNWF 5B09A 4HACA 4I68A 1HBNA 1AZSB 1MMNA 1OJ4A 1OWXA 2FYXA 2OPPB 3HX9A 2VG7A 3HHNB 3IWNC 3KNAA 2C3PA 1NKCA 3M32A 2C3UA 2IAJA 4LRDA 4DV1J 2EG1A 4PL4A 2VONA 3AD8C 2ABYA 1OPZA 5KT2A 3V6KA 5LOQA 1XMQJ 1T03A 3HM9A 1TFYA 3C15B 3LP2B 5CYMA 4CLZA 4DR2F 2VB6A 3DA4A 2XHCA 1UZDA 4OQJA 1AA1B 5LSOA 2OPQB 2OUGA 4CIOA 5CHCB 3I55S 3MMJA 3DFEA 1GXTA 2C1EB 1LW2A 4J9UE 4ZCLA 3QRPA 3GLJA 2GCFA 5D3GB 3LOUA 2QYGA 3OHBA 4L75A 1T94A 3EDQB 3PRVA 3I5AA 3OR1B 4LFBF 3RB4A 1GAOA 1Y7PA 2P5VA 1WHWA 2RF2B 2RKIB 2D9PA 3G8QA 3IR5B 4QIEA 4DQPA 1C2PA 1Q5VA 5ETPA 2UXDF 2XS5A 3CJTA 1DJ0A 1YLXA 3O1LA 2UXCJ 4ANCA 2H48B 4ZPVR 4ZPDA 1GTEA 2WVCA 3NGTA 5AXLA 4CLWA 3L0IA 2M2BA 2B6AA 2IMWP 1HNXF 1SJRA 3TX8A 5C24A 3WC0A 4YZ9A 2CPHA 1OS5A 1U1MA 2HBQB 3LJ1A 4LJMA 4QW9A 3MR5A 2FVRA 4DSKA 2KH9A 1DFDA 2F8HA 1GK8A 4QW8A 2GZOA 4J9MA 2UV8A 4NEYA 4EO6A 2BVZA 4TY8A 4KGZB 4DL2A 1EETB 3OBIA 1Q8KA 2KXFA 3BREA 4QPXA 2LU2A 1VFJA 5KT4A 1AFJA 4OJ3A 1SIZA 1WACA 4X4PA 4IOAQ 2DH9A 3ADAC 3ENWA 1VQPS 4ZCIA 4L3KA 1BWVA 2PDAA 3HVTA 3QWPA 2V69A 2HQCA 2X7IA 2UUBJ 1TAQA 4M5NA 1QSSA 1EZZB 3NOCA 1WOSA 4FYVB 1XNQF 4KKOA 3NGDA 3W8PA 3JXOA 4Q5VA 2IVMA 5ETOA 3VAHA 4G76A 2A6OA 3M9NB 4M5LA 4DPUA 2BJDA 2XY5A 3P8BB 3PEHA 3N4WA 1H2TZ 3FRYA 2FC9A 2BMBA 4G6VB 3JAMY 4H4OB 2FLOA 3UN3A 5HQLA 4YR0A 1UZHA 2RU9A 4HKQA 3VA9A 4ED7A 3EDRB 2HZCA 2ETDA 4P7VA 1VIXA 2KDOA 3H59A 3EGWB 3UN2A 3ISZA 4DR7F 2MKYA 2F5GA 3H5UA 3Q0AA 1SC1B 3IBCB 1Y0HA 5KFEA 3OVAA 4WTOB 3FBCA 3BSCA 3PX4A 3NL0A 4U67Q 3OJUA 1VC0A 3JYTA 4RNNA 5BR8J 4WWSA 1T9TA 2HPUA 3CB4A 3L9ZA 2E5JA 2KT3A 1Q82T 4IRKA 1P1LA 2R42A 1SC4B 2CDRB 2CPZA 3BYPA 2CJXB 3ZTSA 3PYGA 5ETSA 3BM7A 3IAM1 1HQ2A 4OHZA 4USMA 4EEYA 3NEKA 1R8BA 4NV2A 4OYBA 1RTJB 4DPXA 2DNZA 2ZDPA 3DNCA 3ZTOA 2PMZD 2R7RA 1NK8A 4DR4J 4MKYA 4GO7X 1EKRA 2E1CA 1SV5A 5KG1A 1B0VA 3HHDA 3N0VA 4JBCA 4X65F 5CYQA 4C8NA 4HT5A 3Q89A 2EK6A 4MMOA 3WHIA 3CCZA 3JSBA 1IKYA 2O1PA 3D67A 3HD2A 1P1TA 4OYPA 3T41A 4Z7CA 5HMWA 2M3DA 3MF5A 3QIPB 4K50A 3EWGA 2BABA 2AJ1A 1JNZB 1QUVA 3J81U 1U6ZA 3QZ8A 4DL4A 4WIIA 1A7GE 4PXBA 5L46A 1RSCA 2V50A 4ZVHA 4QBUA 4DR6J 3D54A 3DLHA 4PWDB 3F44A 2PI4A 1WC3A 3TZXA 3PO5A 1JIHA 4FF4A 1NHVA 5F3TA 1I51B 2AJFE 3U1MA 2HW3A 1BWEA 4OFZA 2DHXA 1I5OB 2QLFB 2FUG9 3PG9A 4EWTA 4Q0BB 2JAEA 1ZPWX 4GC6A 4MYTA 1QD1A 4YZCA 2C2KB 3JSMB 4O44A 3RR8A 4JI8J 1NLKL 3KUHA 3QQCD 1ZM3A 2EFPA 2ACMA 3BF4A 4NLXA 4C6AA 3VAIA 1HWUA 1NDCA 1UPPA 2V8PA 2YKNB 4M5DB 1S1UA 3IAS1 4PQAA 2ZH4A 4V19X 2YWEA 1JNRB 1HLWA 1LWXA 1FK9B 2IDLA 3BH6B 3EVWA 1HD1A 1OO0B 4Q7AA 3T1YJ 4U7UD 5DRKA 2MZQA 2QGMA 2YWHA 2FJXA 4ZPWR 2ASYA 2EXUA 3I4PA 3SDJA 2M4MA 3DM2B 3LH2S 4X4UA 2YKNA 3DDKA 2GVDB 8AT1B 2MXYA 1VQ7S 2P9CA 2KRBA 3Q86A 1C4AA 2PSZA 1IBLJ 4OZ1A 1P8GA 4DU7A 3IM8A 2K3KA 4RW8A 3OLBA 2E1AA 1KS2A 3JSMA 3RB0A 4IRCA 3JSRA 1KQGB 4NCBA 4RUCA 2P2CB 1FDAA 2RQMA 1TL1A 3ZFVA 3GIRA 5E7OB 2B9EA 3SFGA 3Q2TC 1FO1A 4C7QA 4HDHA 1KC8T 2W7AA 4NE9C 4LF4F 4PWDA 3O2IA 3DRPB 4D3HA 1N56A 1HBUB 1RABB 2OSQA 3V4IA 2OHDA 1X4BA 2GS8A 4OZ2A 2MSTA 3ZZUA 4ZP6A 3MHYA 3SQGA 3AFGA 1DQ9A 3KP9A 3I31A 1EQMA 5CABA 3JAMU 1UPMB 5IV3A 2KJWA 2ZNZA 2UXCF 2R8HA 1RLCL 2KFYA 2VA2A 4M5JA 3GFYA 2V6EA 1RT5B 1SV5B 1FJCA 2CNOB 3FEYB 1LW0B 5GVQA 1FRIA 3HSDA 2J6SA 3SFUA 4ZA1A 1DQAA 2CVEA 5HI7A 2DHSA 4NA2A 5IM0A 2U1AA 3I56S 4KHPJ 1BD6A 4CLLA 1FX4A 2HQGA 1T02A 4BLGA 5F8MA 1PKUA 2FGCA 3M2VB 4J7CA 4MFBA 5EWGA 1PCAA 5K14B 4IH6A 2YKQA 5D15A 5DDQC 1FXLA 4RUAA 4X62F 4J9LA 4LUBA 2AU0A 1VQ5S 5I4MA 4YOEA 1N34F 3MPVA 3DN9A 2RJZA 2VG6B 2D3ZA 3H8YA 4U6RA 2HFZA 1IVZA 3T5LA 4QWDA 3H2VE 1BXNA 4ETZA 5K8MA 1WD6A 1V9OA 3GJSB 4WE1B 3THTA 2BBEA 4UOGA 1M90T 3NNAA 2WBMA 2W2MP 3HSJA 1FKPB 2IVYA 3CE8A 2IJRA 2RQ4A 3MM7B 4FVMA 4H4OA 1ZM4A 2RB7A 2V1CC 3HCXA 2H5IB 2CQ2A 4I6WA 3L7OA 2CJYB 1RZMA 2R3VA 3ELHA 3IXQA 4LR7A 3VV2B 1SL0A 4FKXA 2B51A 2B56A 2PEBA 2GHWA 3TAMB 2R7TA 4RNMA 5LNK1 1U2CA 4PPDA 1U1KA 1R6YA 4DL0C 4J9KA 4YZDA 3DHWC 2DVIA 4FS1A 5CZVA 1IBKJ 1RT7B 3BGRB 1RA6A 3OFEA 4ZVEA 1Q7LB 1GX6A 2XSJA 3PNIA 2MQQA 2WZ1A 1LWEA 3K8VA 2F63A 5C2CA 4I7FB 1O6XA 3CNQP 3Q24A 3POTB 2CA9A 2CQ0A 1N52B 3D3BJ 4CYUB 4X84A 1RHJB 3W5ZA 3PYDA 4DHVA 3WDOA 5ETRA 1RWNB 2GFFA 3R97A 3ZTRA 3H2UB 2BV3A 5BJRA 1NH7A 3VHQA 2CQBA 2G2OA 3D1QA 2IM1A 1X0PA 2YNFB 3PCOB 5A8RA 1TKDA 4LFCF 3BS9A 5G4DA 2KFNA 5D0GA 4KAIA 5F8LA 1VS3A 1ZZNA 3N6LA 2ASJA 1HNXJ 1SIWB 4ECWA 3V6DA 3NAHA 1RXOB 3IWXA 3PHEA 1C1BB 2HFOA 3ETOA 3O6QA 4XTTA 4HHJA 3IR6B 1M5SA 1WSVA 1B0PA 1M1KT 5C2GA 1JJ2R 2Z58B 4C8KA 3ENQA 3TVYA 4WFNQ 2GAGC 2N3OA 2L9DA 2J7WA 3Q8VA 2H9ZA 2OKQA 3GPAA 2XTRA 4G1PA 4H54A 4IG0A 4LRCA 2W7PA 3HVRA 1BMQB 2GMLA 1GMWA 4BHQA 4DN9A 4X66F 1DURA 2J9DE 2JC0A 1O0PA 2MZJA 2V8VA 3OR1A 4E98A 1K1SA 2GO8A 4QR2A 1S99A 2QA1A 1TKTA 1SCJB 1WSRA 5GAGI 3CSKA 2PGCA 1OYDA 3JTOA 1DBDA 4AFFA 2K06A 5K8PA 5DGBA 4QPTA 1YHQS 2HMIA 1X5PA 2LEPA 2Z2YB 4X4VA 4MYUA 2FVSA 2D7SA 1PBUA 2HRYA 4DV1F 3ISND 3CW2C 2MEWA 1QM9A 4NEZA 2PIIA 4NLTA 4UUWA 4YQWA 4AL6A 2ZRRA 3POTA 3M32B 4WFZA 3TRGA 3JQKA 1MSWD 1LWEB 2K7JA 1FERA 3P6YC 1CS4B 3TP2A 7AT1B 2EFQA 4USWA 2KXNB 3G8SA 4K4WA 3K58A 3FBBA 2RE1A 3ILLA 4K0KJ 1Q8IA 3GG1A 3MOZA 3FDSA 2JNJA 3TAMA 4DZ6A 4Y2KA 1WG1A 5A8KA 5BYRA 3TZYA 5KFCA 1K0TA 3C19A 4CRJA 4XO0A 2YQ1A 4DV6J 3MM7A 1FKPA 2CG4A 2LDYA 3ICLA 4PCQA 2W1BA 2B7BB 3P96A 3ZO7A 5KFDA 3P3DA 3NXZA 1EIYB 3MFIA 1N33F 2HWHA 4NLUA 1CJTA 2RRNA 5DQIA 2ZZMA 2M7SA 1X4AA 3RU0A 3ZC4A 4DV4F 1RHMB 4FYWB 1JLBB 1S7HA 2Y0SD 3AD7C 1T3OA 4LRBA 4MKVA 5KT6A 2VG6A 3GIIA 3QLHB 3CCES 1RHRB 2BXJA 2JJ4D 2Z30B 1XQIA 3OXFA 3DO9A 3B8HA 1FNOA 2O66A 4PL5A 5K14A 2R9LA 2B8PA 1AROP 4DR3F 4IKAA 2XZTB 2MMYA 4KTQA 4M5KA 2HNYB 1NEEA 4CTAA 4CCHA 4G1QA 4F0KA 2DGWA 3M6XA 5J2MB 3GFZA 5K9FA 5LMNF 5LM7E 2BW2A 1H73A 1LK7A 3MMCA 1KP6A 4WPAA 2RSQA 3EZ5A 4DZDA 1WOPA 2E66A 1TL4A 2YX4A 4P9SA 2AQ4A 4B9VA 4YHHF 5DLGA 5GADI 3UDEA 4NXMJ 1CJUB 4NLQA 4I6YA 1AUSL 4NMLA 3UE2A 4ED5A 4ANDA 1S9EA 6FDRA 4WU2A 3FMBA 2P9EA 2B9YA 4XDCA 2X1BA 3AA9A 3NP5A 2POKA 3MM6B 2ZBIA 3AB4B 5HJXA 3G96A 1DAXA 1JLQA 1HW9A 2CZ9A 4G1IA 3ET6A 2VASA 2Y1JA 1G3OA 1H7XA 2WVEA 5DG7A 1HBOA 1DZ5A 2VC1A 1TL1B 2G2ZA 2FB0A 2WVBA 4WP3A 2E9ZA 4MH8A 3CDBA 4IFVB 2M8DB 4B3OA 3F4MA 3W9HA 1RAGB 2B4VA 2DBBA 4OHYA 1CEZA 1FFWB 4JB8B 5F0WA 4A8WA 4X2BA 2H65B 2J9CA 2CAZB 1N5TA 1BHNA 4YFUA 3BJYA 1CULA 2BYCA 3I5BA 2XTQA 4JOUA 4J9OA 1RT4B 4QYRA 4QCLA 4FZVA 2KZMA 2HQ3A 4GKJJ 1X7VA 4BWMA 5HMYA 1FXDA 3QRQA 3KLIA 2QSFA 2VFRA 1M5OC 3CC4S 4LMZA 4WKRA 4DL5A 4I2QA 1UVJA 3I87A 2C22A 3RRGA 2Z2LA 2CPFA 1B99A 1AYEA 4O44B 2ZE2B 3M9OB 1KEKA 3K5LA 1RGVA 1MWZA 3FGVA 3R7BB 1QLNA 3HLUA 2ZM6J 3TQEA 1U48A 1X5SA 1RWPB 2O3DA 1RU1A 4Q0BA 5LMNJ 2E5IA 2WB4A 2Z2ZA 1NCLA 1JLAB 1IBCB 4RW9B 6AT1B 3J7YI 2GAHC 1NPRA 5KFHA 2DGTA 3L7UA 3O8WA 2VU5A 4QZVB 4O3PA 3CCUS 2AKWB 2FU2A 4B3SJ 4PQUA 1JLGB 1FXRA 4G65A 1NNDA 1YVFA 2NXEA 4A8FA 3K5MA 1S1WA 3KLGB 3D3CJ 4FBUA 1ELOA 2YWGA 2ZH2A 4CLTA 4DFMA 3SDEA 4DV7J 2A2DA 3CD5A 1S59A 2W8LA 1XC9A 1N5VA 3MPDA 1I94J 2ZHOA 4ZP8A 4P73A 3Q23A 1F3FA 4Z7GA 1WKKA 2MPUA 2RU3A 3CDUA 2Y1LB 2FJBB 1S0NA 1SKRA 4K4ZA 3MTJA 4RW7A 2KVIA 5B0BA 1TFWA 2BKPA 1RTJA 3BGLA 5I3PA 4CO0A 1SKSA 1FDBA 2UUWA 4ITSA 4UUXA 1NZ8A 1YK9A 3ZXWA 3RB6A 1TR0A 4C11A 4ES2A 4CLPA 1S57A 1IN0A 1L3UA 1RLDA 1JWWA 2W4DA 1D9FA 2AJ0A 2HFSA 1C0UB 5ADZA 1OYEA 3LO3A 4XK8C 4ATNA 3K89A 4QU7A 1KQSR 1MU2A 3O5TB 3CJRA 4F3OA 2F9DA 2RIJA 2CYYA 1HHQA 3QFWA 3BKTA 4JI6F 2XWXA 2C42A 4ZS6A 4DQQA 2DHHA 3UQSA 2KT2A 2PD1A 3JQJA 3MDFA 3TVKA 2B9XA 4NLRA 5H1SV 4YDXA 3PJWA 3RGIA 4RL1A 2N4CA 4DV7F 2RHSB 2NYHA 2ATLA 3FVYA 4ZVRB 4QWAA 1VK3A 4P6QA 3CDAA 4DLEA 2PMHA 1S9GA 3A12A 3QJJA 1SB6A 4QWEA 2BACA 3FSXA 3HHKA 2ZH5A 3BO3A 1J5OA 2AEMA 1S0MA 3EGVA 2HAIA 3AOBA 2FVPA 4KKOB 4KYZA 2GIQA 4W4MA 3GYNA 1N48A 1V3ZA 1XERA 1BE4A 4Z7HA 1U02A 1UEVA 2RLDA 2VKZG 2MQPA 1KSPA 2X1FA 1EHWA 2JLFA 4HYKA 3E51A 1OY9A 1C1CA 1UAWA 4NOHA 1HNZF 1NJYA 3DOKB 3HT3A 4DV5F 4TLRA 1SI9A 4JI5J 2QC3A 2XZDB 4HL9A 1BY9A 4YB5A 3TZWA 1HQUB 1EETA 3QGIA 4A8MP 4P2SA 4TY8B 5HATA 3DCAA 1TL7B 2VF3A 3PHTA 1JQOA 2AX1A 1L3KA 2HWIA 2VODA 4AL5A 2DEIA 3U1LA 3TWZA 2ALZA 4RUHA 4DV3J 4ZCKA 2XMAA 1JJ4A 3KLGA 1S1WB 3AJDA 1XMOJ 2ZKTA 1RTDA 4DWIA 1Y9OA 2DNOA 2KRRA 3GSDA 4TYAA 4DEZA 5C24B 1JLGA 3OL8A 3HP6A 2VIHA 2B6AB 1N5SA 4HVZA 5E3QA 4N47A 4DSJA 3Q8YA 4MK7A 4ECTA 4YP3A 4BBYA 3GV7B 3VAJA 1KNZA 4NASA 4UF4A 4L3NA 4CP5A 4FDFA 1EQ0A 2UUAJ 1XN9A 2ZE2A 1VQOS 2RF2A 1YQHA 3E2EA 1KR4A 2K8GA 4KR0B 4I2QB 3W2VA 3D1HA 4CQ1A 1TV6A 1Q0NA 4OAVB 4NPOA 4A8KA 2AEFA 3MMBB 5E33A 2AGPA 2DR8A 1D3WA 3FFIB 1LW2B 1LFWA 1WC6A 4A4JA 4ZIWA 2J9EA 2LQ5A 4R0JA 3D1OA 2XMTA 2E9RX 2CKWA 1YG0A 3ILOA 3M30B 4F3MA 3C15A 5CYMB 1TMMA 2O5DA 2KT5A 2Z0GA 3UN5A 2YH1A 2HHTA 3MECB 1NAQA 4PABA 4OYWA 4OI3A 4WK3A 2IAJB 3NCPA 3NGKA 2BOAA 2JFDA 4ZP7A 4DXLA 5FD1A 1N6QA 1KFSA 4EZ6A 2EBEA 3A3OB 4EO8A 4E2FB 2Y1RI 3DLEB
chains in the Genus database with same CATH topology
1SL2A 2JB1A 2J9DA 3DOLA 3CCJS 4OMFG 4LF7F 2EVZA 4ALZA 2R7SA 4WJBA 2B0GA 2VC0A 1DTTA 1JLQB 1ZAXA 2ZKUA 4MK8A 4ZPBA 5C25B 4DPOA 2IC3A 3DA3A 1JKHB 1FD8A 2PN6A 2OPSA 3R1LA 2O01C 5LJ5Y 4LIWA 2VKRA 4OL8A 5DM6Q 1VQYA 3OVSA 3H98A 2F8EX 2JC1A 2N4DA 1S0MA 2IBOA 4KHRA 3ZZOA 2RRAA 4IQXA 2PA3A 2NSCA 4ED1A 3MMAB 3HPOA 5J2MA 4HFVA 1S6QB 3KK3B 3AHPA 5KFTA 5LSLA 1IKWB 3MD3A 4CZCA 1HPZA 3M2RA 2BQRA 1H98A 4C0OC 3E01B 2PI5A 2W9BB 1R8CA 1JLFB 5KFVA 1FRXA 2R2UA 2NR0A 1ZM2A 2ZITA 1M5KC 4CH0S 3EXYA 3QLHA 2V4JA 3MD1A 2E1RA 3HVWA 3GWCA 1UWBB 2GMHA 3EZUA 1IM4A 2AP6A 1U49A 3EGZA 4KV8B 4OV1A 4ICLA 2ZVSA 1RTHB 3GMGA 1Y4ZB 3PVXA 5DDRC 1R31A 3DLKA 2LLZA 2F8MA 1HI8A 3S1TA 5DETA 4NXNF 4K4SA 4LF5F 3M6WA 5E3RA 5A8WA 1D0EA 4FF3A 2AJ4A 2J8AA 1KTVA 5KG3A 3ULHA 4IR1A 1S1VA 2FVCA 1XNRF 2LKZA 2E5GA 2IA0A 3OR2A 1HWKA 2EFGA 3BGUA 4I64A 4MJKA 3LP1A 2MHNA 4TY9A 2HHXA 3W2WB 3SCIE 1U6BA 4YB6A 4X4NA 4ZOSA 2OO4A 2RVJA 4WFAQ 2HLUA 2XGQA 1UVKA 1UVLA 2XG8A 2Q66A 1W2IA 4JCVE 4OX8A 4CO1A 1N5QA 1VQ9S 2YNGA 4HTIA 4R5PA 1PILA 2Z2MA 4Z2XA 3TA1A 3OQ2A 5EDWA 4HH1A 3KHGA 4K4VA 2NQPA 1BC6A 4NA3A 3LP0A 5MAOA 2CQGA 1OSDA 2FHMA 3RBEA 2OLWA 3KHLA 3QGGA 1UETA 3MEDB 3UDLA 3S6EA 3UWTA 4H4KA 5C5JA 1FDDA 2W8KA 2OIHA 1T8EA 3TARA 4X4OA 2W7OA 3G6VA 3MM8A 4UQTA 2IYGA 3IA0A 5A8RB 3VAGA 4B9LA 1YBAA 2B4PA 3HHLC 3R5BA 4C98A 4J37A 4K4UA 5M2RA 1YJRA 4WCEQ 3OVBA 1KHVA 5KFGA 5HQ8A 3OJSA 3K57A 3OTCA 4TN2A 1K9MT 4I7FA 3EPGA 3T9ZA 1SKWA 1VQ6S 3R27A 2UZAA 4B08A 1GXUA 1ZTWA 2V9WA 1NK4A 2KI2A 1UP1A 3VTIA 4NLSA 3D0GE 2MYFA 5LMUF 2YNIA 2QYCA 2M9KA 1N88A 3MZIA 1KLNA 3CO9A 5L1JA 1XMOF 3I4HX 3GIMA 3MURP 3DXBA 4IDKB 4ED6A 2BUNA 3K5OA 4MKAA 2UUCF 2Q6BA 4OJGA 1SBRA 1X5OA 1R0AB 1RTIA 2V8GA 1RDRA 2XMUA 3OLAA 2XY6A 5B0AA 4WE1A 5DG9A 2MZSA 2VG5B 5F8JA 1IKVB 5I3QA 1FJ7A 4O23A 3BN4A 5DM7Q 3KHRA 1JXLA 2R7XA 2B9WA 2CPXA 1QE1B 3M6UA 4FYDA 1HWLA 5KOXA 2KO1A 1U7LA 1S6OA 3OHAA 3RTVA 2PA8D 2OAUA 2XZWA 3BR8A 4RWWA 3S01A 1W3SA 4LT6A 2W9CA 4DV3F 3KWMA 4MFBB 1V3SA 4CI0B 2RILA 3DI6A 4DG1A 4QJVA 2AGOA 4M1KA 4FXWA 1U1NA 1QAYA 4EFAC 1IKXB 4F2SA 2RH3A 4NXMF 1F0XA 1DTQA 5IM0B 3SMZA 3ZZRA 3CJ0A 5KT3A 1F9FA 2XMJA 1S0OA 4N8OA 1RT5A 1HBMA 1X4DA 3LAKA 2E7XA 3IGNA 3IRXA 1JLEA 2FJWA 2C2EA 2DNNA 3FQLA 3J7A1 2LEAA 1TUVA 4RX6A 4TNOA 5JJBA 4EBCA 4DS5A 2RS2A 5J2QB 1HBUA 3LWMA 3DRPA 2B5JA 1RKIA 5HROB 3CIMA 4KJIA 3CC2S 2DNMA 2BM0A 1RJJA 2XI3A 5F8NA 4OI1A 3CUNA 1S77D 4B3MF 3IWLA 2IFXA 4C3LA 2DR7A 1G1XA 2QIFA 2VFSA 5KOWA 4DL6A 2AYBA 2DNGA 3M8QB 2IP6A 4X4RA 3DRYA 2J7KA 4J9QA 4RW8B 2JB2A 2ZJPQ 2JOQA 1VRTA 3PM9A 2OD4A 1ROFA 2KXHA 3T19A 1D8ZA 2ZH9A 3CIZA 1S9FA 2FVQA 1UVMA 2YTCA 5EGYA 2RNEA 1FJGF 4XPEA 5HMZA 4WTYA 4CO3A 2R8KA 3HK2A 3CCVS 2A1BA 3L95X 4EU0A 4ZKAA 2C28A 2ADBA 1Z1ZA 4ZPCA 1N8RT 3AY0A 4O4GA 1GT8A 3PFEA 1AFIA 5KG6A 5C42A 3VR1A 1NH8A 4M5DA 3AA8A 3CGIA 4TKTA 5F8HA 2CQ3A 3TAQA 2R7VA 1ZTTA 1OQ6A 1H3DA 3AB2B 4ILRA 4X4SA 4ECZA 2IRYA 3PR5B 3M2UA 2WSEC 2CZVC 2WCXA 2G9OA 2JVOA 4K5RA 3LGNA 1R89A 2FJVA 1Y3KA 3T5KA 1KOHA 1TQLA 3LJ2A 2J7UA 4WYWA 4G75A 2XCPA 3F73A 1AUDA 3NKYA 1BQNB 3PX6A 1IUJA 2AYGA 4URQU 1ZOTA 2DB1A 3HKWA 2DRAA 2DT9A 3QIPA 3N9UC 4KRWA 3DLJA 4TU9A 4DFKA 4KE5A 5G0RA 1HHTP 4O1PA 2HNDA 2DIVA 5CYQB 1CG2A 1JK9B 1NRKA 4NYZA 3DRRA 3M8PA 1TKXA 5EWFA 1MMDA 2ZC3A 3PX0A 2FHJD 1TK5A 4RU9A 5IXUA 4HI2A 4IFYB 4DV0F 2MJFB 3OFGA 1FCAA 1REVA 2BRKA 2F3JA 2EFOA 1HYSA 3S8SA 3T1HF 3IO1A 3OTOF 5AE3A 2FY1A 2DO0A 5KFBA 1YITS 3MXHP 3GFXA 1F60B 3JYTB 2EWHA 2YY3A 1VC6A 2YFAA 4FXVA 4Q45A 2FPHX 2NSBA 2IBKA 1QJHA 1CLFA 3M1VB 3MEGB 2IJNA 2XMXA 2DGUA 4A48A 1G2EA 1C0TA 1RT1B 2L41A 3KK1B 4JV2A 4R8UA 2BQUA 1UJ6A 3JSYA 1T7PA 3C3LA 3HJFA 2N7CA 4LSNA 2W25A 2MKSA 1HFEL 1FTRA 3FZ2A 1WNEA 1VRUB 2EFNA 2KYXA 2XMWA 1HNVA 2NS1B 2R4FA 1Q16B 3K7RA 2FHKA 3OSNA 1WF2A 2FLPA 3IAS9 3Q8PB 2JEJA 2FC8A 5I42B 4O3OA 1WF1A 1XTZA 4NRUA 2MB0B 2L08A 5CCLA 4OHVA 3HHLA 2D3OR 1N4LA 5IS2A 2CQ4A 3IC1A 1HNIB 3SSSA 4DUYF 1X4FA 2I8EA 2FGOA 1U1LA 2V9KA 2D41A 3NCRA 2IJFA 4C3KA 4NZ6A 1KN6A 1PC5A 5F9NA 4DN0A 4WK1A 3KMSA 4RKUC 1BQMB 3NBPB 3N6MA 4FP9A 4QIWD 5B0FA 2ZJQQ 2CQ1A 3CVKA 2FJDB 3CCLS 4A8QA 1MWYA 2HG4A 2MKCA 2VPXB 1U8SA 3HFKA 2NUHA 3IFEA 2J0WA 3ITHA 1ZETA 3IBWA 4H4MB 2JLGA 2HHSA 2VBZA 4GMKA 3C8YA 2M70A 3HXMA 2VBWA 3QZ7A 2BJEA 4V19J 1D9AA 2OFHX 2ZD1A 1HA1A 1JXEA 1X8DA 2RKIA 4IG3B 4MIWA 3IGVA 5KFOA 2BRLA 4QYZJ 1VI7A 1U5KA 1SJ4P 4ZVGA 3KK2B 4OZJA 4ZVFA 4J9PA 3C2PA 4RW6A 1KQFB 2WONB 2DNLA 2I0XA 1S1TB 3NWGA 2PO4A 1A6LA 1DHMA 3DDNA 3RR8A 2E5HA 2JB3A 1HW8A 2OPQA 4KIAA 4P7TA 3V2UC 4DQRA 5U47A 2XS2A 2QLWA 3LP2A 3OXGA 5E0OA 1YSJA 3V4MA 3TANA 1R27B 4Y2IA 1LFPA 2WHOA 2VL1A 3HI9A 3BB5A 1FRLA 1VQ8S 1JMTA 5DGAA 3KLHB 3PW2A 3LPYA 1HBNB 2OPPA 2ZDOA 3IRWP 2EBGA 1JLCB 2K1RA 5GMKa 1K73T 1UKUA 1IR0A 1B64A 3BGFA 5SUHA 4NWBA 4EYIB 2ZHBA 4OZ0A 4DR1F 2ACYA 4K4YA 3I82A 4F50A 4OX9F 1YJWS 5D77A 1KRPA 4LVNP 3H25A 4F02A 2ZOFA 3H4BA 3FBVA 5CQGA 4CH1A 1FKOA 2J6TA 4B3RF 3SV3A 2WSFC 2YH0A 5HBMA 1FVSA 2MJNA 2OSRA 4KBIA 5T7LA 4KPYA 3OFFA 5E3PA 2OJ3A 5LSRA 5MLCV 4YB1P 1YIJS 3BSOA 4OI6A 5KG0A 1QTMA 1IBKF 1HMVA 4WF9Q 2J6UA 1ZAVA 4PG6A 1X4GA 3MM5B 3Q8SB 3QPIA 1U47A 1YRTA 1L3TA 2A18A 2JRSA 2F6MB 4IR9A 3K2YA 3UCZP 2R7UA 3TYTA 2FLLA 2CDQA 4PG8A 4O1OA 1MROA 4DBQA 4M95A 2I2YA 4L72B 4IUFA 4C8MA 4EBDA 3ZZZA 1UL3A 3OL7A 2PT0A 3TVZA 3FSYA 2MKHA 5F8GA 3TQ1A 2BDPA 3KTQA 3I0SB 1Z2LA 3B4DA 5J1EB 2P9GA 3GILA 2BA9A 1HMVB 4PXEA 1IBMF 4Z37A 5KG2A 3NG8A 3NMRA 1GNKA 2YKPA 2E7WA 4N8NA 5HP1B 2K3IA 1RT2B 5T7LB 4F26A 3BN7A 4CT8A 1AW0A 5HBMB 2CQHA 4LSLB 4L6V3 4JI7F 4DDFA 3Q8DA 3PKYA 1SH0A 3NRBA 2PFFB 2IHR1 4FF2A 3CULA 3CMES 2IRUA 2LQJA 2B43A 4RLEA 2AYEA 4IYQA 3GIKA 1GX5A 2A2CA 3CMAS 1ZYQA 2C3YA 1WF0A 4FN5A 3FRZA 4K4XA 2W4PA 3H2LA 3BEGB 2HRUA 4KHPF 3RRKA 2DR5A 5EWEA 4ID8A 2K1RB 1TL3B 2HQIA 4HT7A 2AYMA 3M6VA 2Y1IA 2L48A 1KLMB 1R7IA 3TA2A 3DMJB 2LA6A 5BYSA 4MIBA 5KFQA 1BLUA 2OFGX 2F66B 3ZZ0A 3N79A 2XBPA 5J1PA 2L3MA 2DHAA 3MFHA 3LJ0A 2BE2A 4N56A 1R43A 3LGMA 2DCLA 3VCDA 2NREA 4LF6F 2AW0A 5D4PA 3KK2A 1PC4A 1KD1T 1U1RA 1VBXA 2GQQA 3TAPA 2OPRB 2M8HA 1HQEB 2MZRA 4DSEA 4J9NA 2DGXA 2Q6CA 1EP4A 4C97A 1CSJA 5KG7A 1TZ0A 1XMQF 2DNKA 1Z4UA 4F67A 2X1AA 1S97A 2JEIA 2QE5A 3ITHB 4OLOA 4LF8F 5HLFA 2CJ9A 2NXUA 3KNGA 1S72S 4Y6IA 3HKZD 3GYXB 3NBPA 2K2PA 3AAWB 2EK1A 1FKAF 5KT5A 3P23A 1VIOA 2DD8S 3KLEA 4M94A 4CO5A 4I4BA 2LECA 2VOOA 2HHQA 4ZHRA 4ECYA 2QFJA 3MTKA 1VQ4S 1JJHA 2DNHA 3X3UA 3KJVB 1FESA 5IT9Y 2FHOB 1H2VZ 2QA4G 1K1QA 3UD4P 3MOJB 2YWKA 4AL7A 3OXLA 2YKMA 5I42A 5B0EA 5HGIA 4NA1A 3I9V9 4WFBQ 4BWJA 1S10A 1QAIA 4MIAA 3H40A 1MW7A 2GX8A 5I3UA 2UVUA 4O3SA 5IWAF 1YRUA 4G3IA 2GGPA 1LWFA 1LWCA 4I56A 5BR8F 4PRFA 3WX4A 1C0TB 3KK1A 1CPZA 2NPFA 2C2RA 2AX0A 2IRXA 3MPWA 4I2PB 1T05A 2HVZA 4B3SF 3DRSB 2ZOMA 4ID5A 5M2UA 5DDOC 3THVA 1E6YA 3N5BA 4B17A 4JV0A 2DPJA 4DQIA 3EUNA 2D1CA 5KFJA 4MAKA 2IMOA 1HYSB 3PZPA 1Q8BA 3JB9k 1RT6A 1UJ5A 2P6SA 3LUYA 4RBVA 3THPA 4UQGA 3M9OB 2ZNYA 3DYAB 2A10A 2IYIA 2UU9F 1BGXT 1Q8LA 4IOBA 4IFYA 2MGZB 4F4ZA 2J0QD 1GXLA 3ISNC 3D2WA 1RI7A 4PUOA 2FIUA 2M52A 5E5NA 1X4EA 1HWJA 3DRRB 3M8PB 1R8HA 5D4LA 1NK7A 1P9QC 4ILLA 4Q43A 4HTJA 5G0RB 1S0VA 1H6KX 3EGNA 4DLGA 2UVRA 4I1TA 1U2RA 4RZRA 1V3RA 2M88A 4YDDB 4LQ9A 2AD9A 2RIOA 1BQNA 4ECVA 3US5A 2XNQA 4K5SA 3I5CA 5CCMA 1S6PA 1XR7A 2DGVA 3IR7B 5CD4H 4GO5X 5LXRA 1JX4A 2HGLA 4FXDA 4U7CA 2MY7A 2HGMA 5F8IA 3MI7X 1QY7A 4OLPA 3K5PA 1KVJA 1VGYA 2JDJA 1ZH5A 3HHLD 3L3CA 3MPYA 5HN0A 3MR2A 1VBZA 5LXYA 4ED2A 3IG1B 2RRBA 5J2NB 1O5JA 2GQCA 2J5AA 2J0XA 4PG5A 4X64F 3KG0A 3ZZYA 4O4GB 1S6PB 2FTRA 3R5CA 2CPJA 1XK8A 4Y65A 4DJBA 5K8NA 4R0EA 3PXGa 4YB7A 3EXCX 4YUDA 1NJZA 2XMMA 3MAQA 1N5YA 5A2QY 4A8OA 2JFKA 4UOCA 1DARA 4A8XA 2ZJRQ 3C66A 4ED0A 1FNMA 2R2RA 1VRTB 1WHYA 4KHMA 5ITHA 2VQEF 2U2FA 4RNFA 1RK8A 3OUYB 1QAJA 2ILYA 3M8QA 4ELUA 4YR2A 5B08A 3PEJA 4H4KC 4O3QA 1WHXA 1UA0A 5KFZA 2XEXA 2IM3A 3CXCR 3FCHA 4QWCA 2QMWA 5HROA 4DUZF 2I9SA 3G6YA 4YR3A 5J2QA 4JI8F 3TO8A 4DSIA 4JI2F 5FDLB 4YMEA 4O3RA 4C4WA 1Q1KA 1Y5NB 2EG2A 2KB2A 3DHXA 1E6YB 5IT4A 4DL3A 4FNHA 4QCLA 3QO9B 3U7JA 2MSSA 4KFBB 3IRXB 1VQNS 3SI8A 3MR6A 1T05B 1NK9A 2WBRA 1ZZFA 2AF6A 4WXWA 5GAHI 4IO9Q