3JSBA

Crystal structure of the n-terminal domain of the lymphocytic choriomeningitis virus l protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
173
structure length
173
Chain Sequence
HHDEIISELRELCLNYIEQDERLSRQKLNFLGQREPRMVLIEGLKLLSRCIEIDSADKSGCTHNHDDKSVETILVESGIVCPGLPLIIPDGYKLIDNSLILLECFVRSTPASFEKKFIEDTNKLACIREDLAVAGVTLVPIVDGRCDYDNSFMPEWANFKFRDLLFKLLEYSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase
publication title The N-terminal domain of the arenavirus L protein is an RNA endonuclease essential in mRNA transcription
pubmed doi rcsb
source organism Lymphocytic choriomeningitis virus
molecule tags Rna binding protein
total genus 62
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.300 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3jsbA01
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3jsbA02
5J1NA 4MIWA 5IZHA 5J1PA 4I1TA 3JSBA
chains in the Genus database with same CATH superfamily
3DOMA 3M9NB 1F5CA 3CVKA 1VQ8S 1QSSA 2IY5B 2GMHA 2KT5A 1Q82T 1QAIA 2CDRB 3GIRA 3W62A 1SC3B 1T7PA 4X64J 4U96A 2K1RA 5KFIA 2UXCF 2MQ8A 2XSFA 1YI2S 3BBBA 2FPHX 4K4VA 2W4DA 4EYIB 4RW4B 4ECTA 1VOMA 5FIIA 5B7WA 3AJ1A 4BHQA 4O23A 1WORA 3BGFA 5CABA 1FF2A 1F1BB 4TU9A 2GMLA 3DU6A 2HAIA 2DGSA 5D4OA 5HL7Q 3MF5A 4OJHA 4OQJA 2AZ3A 2FZCB 4Q0BA 4L76A 5C5JA 2L41A 5DGAA 3BBCA 3JSRA 2HGKA 3MMBA 4IFVB 2UUTA 5AE1A 4OYPA 5DDOC 2HNYB 2BE7D 4N56A 3K8WA 2OTLS 4DX8H 2MKYA 1S4EA 5L1JA 3M2VA 3PCOB 2XY5A 1JXLA 4RWXA 5H1SV 2GO8A 2JVOA 4XO0A 5J1PA 2L9NA 2JHEA 1T9TA 4LF7J 4PXBA 1RISA 2I38A 2KFZA 4B3TJ 4DQRA 3BKUA 1J5EF 2ZH6A 1JLAB 1X5TA 2UUWA 3CUNA 1NHKL 1OMSA 3V4IB 4JI2J 1HWIA 3FJ2A 2JNJA 1RCXB 3VZHA 1WC5A 2C2EA 2OPSA 3EGVA 2WB4A 2BACA 3ITHA 1CJTB 4X4UA 4CNZA 2HGLA 3RGIA 4TQSA 2FB0A 5EHHA 2NXJA 1CG2A 3VQSA 3NAIA 6FD1A 1G2EA 2HNZA 2QO3A 5ETLA 3V6DA 1IWAA 1Q8IA 5IQ6A 3WQPA 4PG7A 7FDRA 5KG7A 2QLWA 3BGOP 1UFWA 3D2WA 3I9V9 1VBZA 1VCTA 2R2SA 2FHMA 5J1EB 3KUGA 2F7VA 2YKAA 1YWXA 4I7FA 2YKPA 1TKZB 2HFVA 3C66A 4DV6F 2JVRA 2VDIA 3R7SB 4P75A 1UWBA 4PEOA 1WKJA 2CJQA 2DO4A 1VRQC 2Y1IA 3KKFA 5B0DA 1U45A 1S1XB 2DGXA 3BJYA 2Q6BA 2HQFA 4ECSA 2QE5A 2RD5C 2BXJA 3ZTPA 1UA0A 2MZSA 2PGCA 2B51A 5KG6A 2VL1A 2B5JB 3PRVA 2LXUA 3EZ5A 4F02A 1FNXH 4WFZA 4P2XA 2L9DA 3O44A 5EWGA 4YOEA 1I94J 1E6YA 1SC4B 2W01A 1XMBA 2IM3A 3HJFA 1NK8A 1NB2A 2HNDA 3IG1A 1FHTA 3SQOP 4WFYA 2WVCA 5E3QA 2JBWA 2GMJA 1TL1A 2ZZMA 2NPFA 4MK9A 2MPUA 4IG3B 4UY85 5IT4A 1SPBP 2KHDA 3QT8A 4I6WA 3UN5A 5D3GB 4U7CA 5HP1B 1FTRA 5HMZA 1TKXA 4OL8A 2A2CA 3A8KA 4ECWA 4LRFA 3IGVA 5KFWA 1B7YB 2XS2A 3SEOA 3CXCR 1I6JA 2NUUG 3MD1A 1R89A 4KGKA 4PPZA 4K2JA 5EN1A 4I2QB 5M2PA 2F4FA 3HHLB 3AA9A 1X5SA 2LXFA 3E3XA 3Q8PB 4DN0A 2RJZA 3R8YA 2WRMA 4PYDA 4KE5A 1ZA1B 4NASA 4JI0F 5K9FA 1UZHA 1HI0P 4LRBA 3N4WA 2F8MA 1Q79A 2RRBA 3B54A 1YHQS 4HR2A 2KVQE 1ZTWA 3KLIB 1HWUA 3B4DA 4QBUA 2ZM6F 4O3QA 4O1PA 1X4BA 1U8SA 1K8AT 4Q9VA 3VGTA 3CULA 1JLQA 1S9EA 4TNOA 2V8VA 3DI6A 4ICLA 4MIWA 5K14A 3UITA 2WVFA 4USMA 2EPIA 1OSCA 2ABYA 1CLFA 3IS9A 1GXLA 2C3PA 3GFZA 3OT9A 5HI7A 3TAMB 4N47A 2QSBA 3BM7A 2CPHA 4CLTA 3OJSA 1SC1B 1TUWA 5HVFA 2KKHA 3C19A 5DDQC 2QL7B 2V2QA 4ID8A 1NPPA 4TXSA 3SCLE 2W2MP 4Q45A 1DQ8A 1J2VA 1WC0A 2JEGA 3C14A 3RR8A 1RAFB 2YWFA 2GVZB 1HR0J 5AE3A 3MCOA 4AQYJ 5KFOA 2M3DA 4RBUA 4OI2A 1HLWA 4I4BA 2MLZA 3UE2A 1WEZA 1YO7A 1DTQB 2PT0A 1T05B 2C28A 5HO4A 2VODA 4OYXA 5AT1B 3MM8B 2KJWA 4DLGA 2B8PA 4X65J 1M5KC 4FNHA 2QLJB 1YBUA 3K5PA 4C8MA 3GJQB 5I3UA 1XNRJ 4USUA 1W26A 1NK4A 4DV4J 3ENAA 2CA9A 3EVOA 2B6AB 2YWHA 5GAGI 1QY7A 1FESA 4PZVA 4LRDA 4MMOA 1UVMA 2HQCA 3W9HA 3HZGA 2RLDA 1CJKB 4DUZF 2OEJA 2G1DA 2GQCA 3Q24A 3DDNA 2ZW3A 5D78A 3CCUS 2A10A 3SFGA 2A18A 2FQQB 2ZVIA 2DTJA 5K5MA 1P9YA 2BJ1A 1S97A 1XTZA 3CJ4A 2GFFA 4PUOB 3DYAB 4UOGA 4DV1J 5ETVA 4DUYF 1MN9A 5H9EK 1WHWA 4TU7A 2GIFA 4FXVA 1NJIT 4IOCQ 3OFEA 3FQLA 3WBZA 1NBEB 2ZHOA 1EX8A 2DRDA 1CULB 1JJHA 1REGX 1PYTA 3KLFB 3ENQA 3T5LA 2R8JA 4J9SA 2A1BA 4WK3A 2W7AA 1YGYA 1SJ8A 3KLEA 5GADI 4PWDA 2FJWA 4WFBQ 3KLGB 1V5VA 1R8BA 3IBCB 3V81A 2YKOA 3M1VA 4P2SA 4B02A 5B0BA 4ZPBA 3FCVA 4WFXA 4ED8A 2RILA 5HJYA 4FBUA 2KFYA 4WWSA 4PL4A 3ISNC 1K1QA 5I3QA 1LWEA 4YY3J 3OVSA 4J9UE 2IA0A 2Z4PA 2ZZNA 3T5JA 4DHVA 3Q0AA 1X4CA 4LBIA 2OI2A 2J9CA 1BUXA 3VZIA 2YWEA 4CLZA 2BL7A 4HACA 2DNRA 2ZH2A 3HSJA 5IC6B 1S76D 1WF0A 1AUSL 1R6VA 3HVRA 4JI8F 2ZC4A 2YX1A 2FJEB 5DZ7A 4ES2A 1EKRA 1GX6A 4CLKA 1MSWD 5HSPA 3CJ8A 4XIUA 1DLOB 1VQNS 4UUWA 1FRJA 2E1RA 1ULRA 4NYOA 5E3CA 4FBTA 1NZAA 1IR1A 4B9VA 5KFMA 2RQ4A 2J0XA 1U0HB 5M2RA 2AJ0A 5D4NA 1YSJA 1N5SA 1SL1A 2QL9B 4F3MA 3K58A 3BF4A 1EQMA 4QU7A 1S1UA 4Y28C 1SC6A 3MAHA 4ZCLA 1P9QC 4FF3A 4IYQA 4ELTA 3MAAB 1VQ5S 4F0HA 3OSPA 1RI7A 4QR2A 3A4TA 5GMKa 3PV8A 4OYAA 4NCBA 2L08A 2HMIA 3H0PA 3ILLA 3GR1A 2M88A 3BSCA 3MEGB 3CTRA 2KU7A 4EO8A 3QFHA 5D8HB 3HSZA 3DLEB 5ETOA 1YITS 2MZTA 3M8RA 1OO0B 2MQNA 3DMJA 2I9SA 3M2UB 4NEYA 2W9CB 1B70B 1RAAB 3W65A 2WSFC 2LLZA 3D7SB 2JC0A 2VQEJ 3E51A 5IT0A 5KG0A 2V63A 4DV2J 4WXWA 3GJSB 2XEXA 2E9TA 1OQ6A 1HNZF 4LFBJ 4YDXA 2MXYA 3NGRA 1S0VA 4WU2A 3TNVA 1RAOA 2W9AA 4O4GA 1DAXA 3D67A 3HT0A 1MROA 2AZ1A 4OYOA 5F0UA 5BYRA 2WBRA 4ZVHA 3T9ZA 4KPYA 1VRTB 3F73A 1UWAA 3MPVA 3UN3A 3VQTA 1SIWB 4NLXA 2XY7A 4URGA 4G1QB 4LF6F 4DSJA 1HNWJ 3WIVA 4DR5F 2DH7A 3BGRA 1T9XA 5ITHA 4WTOB 4B9TA 5ETSA 4KBIA 1SBRA 3MPDA 3TR5A 3M6WA 3B6BA 2DXDA 7FD1A 1A6LA 3W5ZA 3TP2A 3PJWA 5EWEA 1F5BA 4YZ9A 5AJ3J 3OHAA 3ILJA 2HLTA 4CIOA 1S48A 1XMOF 4CTAA 4DEZA 1NSPA 3R1LA 4CO4A 2I6WA 1PAEX 3QIPA 2YNHA 2ZH1A 3MGJA 2AP6A 4CLFA 3B55A 4ILLA 3NS7B 4Z37A 1SJRA 1PKUA 3HFKA 2MJNA 1RLDA 4YR2A 2X3GA 4NXMJ 1JNRB 4DL5A 4LR9A 2IMWP 2MGZA 2RT3A 4Q7AA 2M0GB 3C6TA 2P8IA 1IBCB 1WF1A 2FHJD 5KFKA 4RW6B 4IO9Q 2DNQA 1SKRA 3QBCA 2FZKB 4R8UB 2BA9A 1CC8A 4QIEA 5DLGA 1U48A 1N5QA 3G9CA 2UUCF 3FRYA 5J2PB 1UCNA 3T9NA 1QUVA 5E3AA 3JYTA 3THVA 2RDJA 2RRAA 2QIFA 5IWAF 3MM9A 3I0SB 2GCFA 2Q79A 4A8MP 4DG1B 2YTCA 3MHYA 4FF4A 5DRKA 1MWZA 1N4LA 2ZOFA 4B3OB 1AA1B 4A8YA 1CQNA 1MLAA 2XNRA 1VQPS 4HEA9 2FVQA 5JUMA 5CQGA 2QFJA 3QAEA 2VPXB 5AXLA 3RAXA 4DPWA 5ETQA 3RBDA 1SV5A 4DR1F 3H5YA 1OPZA 3EWGA 4O1OA 3CJKB 1NKBA 2OLWA 2DHHA 4LT6A 2D9OA 1U5KA 4F4ZA 3KMSA 3PW0A 3WX4A 4X62F 2FD2A 4N76A 4DU8A 4X2BA 4DV7J 4OI0A 4ED5A 4AXJA 4YUDA 2GJFA 4J90A 3IAS9 1HHSA 1IN0A 3ISZA 1EETB 4V19J 1FRKA 5KTQA 2XYGB 3CIZA 3P8BB 3UO0A 1NDLA 1RQ0A 3UR3C 4JI4F 3NXZA 2VBYA 4QIGA 2W7PA 2ACYA 2CJAA 3HT3A 1RAHB 2L48A 4LSNB 2ZJQQ 2QZGA 4LF9F 5L1IA 1PBAA 2V8HA 2AJFE 4USIA 3B78A 4DV0J 1IBKJ 4FYWB 2V4RA 1JLGB 3OD2A 1GMWA 3H4BA 2MSTA 4K7QA 1R3NA 1ROFA 1TL4A 3GMGA 2XCAA 2KFNA 3HVTB 3TJ8A 4YS2A 3ZTRA 3KLHA 5DDRC 4YB7A 2K19A 3V4IA 1XBWA 4ED7A 1RA7A 5A76A 2HVZA 4DCOB 3HHKA 4LF5F 2DXFA 1QAYA 1UP1A 3MEDA 3UVJB 1FDAA 3LTOA 2W7OA 5I4MA 4L72B 4K4YA 2KYZA 1VQ9S 2HGNA 1VQYA 3MEKA 1RT7B 4DU7A 3O5TB 2Z2ZA 4UZCA 1D09B 1Q7YT 5BR8F 1BMQB 2BABA 2NYIA 1M0SA 3GG1A 3MMJA 3K5OA 1M5PC 2BJ3A 2BJ8A 3NNHA 5KFNA 1FEEA 2P9EA 3KG1A 2DEIA 4QJVA 4ECUA 2ADBA 2KTQA 1P27B 3NS5A 3A8EA 2CQPA 2YKNB 5J1EA 4B3SF 4Z7CA 4J9RA 1MG7A 4K4UA 2W2NP 1L3UA 4ELVA 1F60B 4FVCA 2X1BA 2C2MB 4PQUB 2GHVC 3HP6A 2VBXA 4FKYA 3MMAB 2DH8A 3CDEA 3J81Y 3NNAA 1IVZA 2ZD1B 3NOCA 1TK0A 4YZCA 5IC4B 1IBMF 4ECYA 5GMDA 1X4HA 3R97A 1HPZB 2VFRA 2LEAA 1YX2A 4MFBB 4F26A 3KTQA 2IFXA 1I51B 1A7GE 4Z2XA 2HWHA 5IV3A 2Q66A 4RBVA 1J5EJ 2B5JA 2HQ3A 3I32A 4FF1A 2XMXA 3HPOA 9RUBA 2BRKA 1U1RA 1NU4A 1FXRA 5JJBA 1IJEB 2ZHAA 2AD9A 5LM7E 3N6LA 1XJWB 5L39A 1JLCB 4A4JA 3H40A 1WOPA 1SJ3P 1QLNA 3QAUA 2R42A 4Y2KA 4R25A 1X9WA 3A8JA 3ZTOA 4ED6A 4NZ0A 1PG5B 3KWMA 1FCAA 1Y9OA 4IG3A 2BMBA 1YK9A 2YFBA 1Y5LB 4DR2F 2V9WA 1F9EB 4ERDA 2ZBPA 4JI5J 2GO9A 3T6BA 1UEKA 1UAWA 2EKYA 3SQGB 4J9NA 5HP1A 2C2KB 1FFGB 1RTHA 3WC2A 4JV5F 1XWLA 2H54B 2OPQA 2HKEA 5E41A 3AODA 4DV6J 4O3PA 3VVUA 2VOOA 2HPUA 4FXWA 2H5IB 2VOPA 1BE4A 2ZBRA 3B82A 3DLJA 4M5DA 3MPYA 4I2QA 3E2EA 3HHLA 2L3MA 1Q7LB 3IRXB 2IJFA 5KFXA 2V8PA 4NLQA 3CDUA 4X4OA 1O0PA 1FRXA 1Z2LA 1NKCA 3G6VA 3RRHA 2RRNA 2V68A 2Y1RI 3DFEA 4OHVA 2JEJA 1FWLA 4W4MA 2N4CA 4OAVB 4KGVB 3KLIA 1U4BA 4K0KJ 3D28A 4Y0FA 3CJRA 2KG0A 1AUDA 4NA2A 5HQMA 1FFSB 1EP4A 2DGQA 1RHRB 2CPEA 3V5RA 4MJKA 2AEMA 4HI1A 2VQFJ 1KBRA 3GPAA 2IYGA 2LDIA 5LJ3Y 1RTJB 3PVXA 2BW2A 1OYDA 2GVDB 4OZ3A 2KXFA 1JLBB 5FLXY 1WTFA 3AT1B 4ZPCA 4JV1A 1JLEA 2Z56B 3DRSA 2VKZG 4JB8B 3OXFA 4FS2A 4R5PB 3HLUA 1WEXA 2DNYA 2XYHB 5D0HA 2EG2A 3CNQP 1FK9A 3QPIA 1U1MA 1XC9A 1FJGF 3PKYA 3GYNA 2HFSA 2OSRA 3IGNA 2DNOA 2G2YA 2I0XA 4AXIA 1VC5A 4DFPA 3CDWA 4ECQA 2WW4A 3SV4A 1KONA 1PC4A 4F7VA 1VS3A 2IAJB 3G71S 2GVZA 8RUCA 2ILYA 3OL6A 2Q3PA 2YKMB 1S1TB 5BYSA 3KUHA 2GW8A 3ILOA 2CFXA 3NY0A 2IC3B 3HF5A 4CDIA 1T3NA 3HHNB 1DTQA 1PYOB 1RWMB 2C3MA 2DR7A 3UNGC 2RSQA 3QGPA 1T05A 2ZZTA 3TZWA 2IM2A 5LMUF 2GHWA 1REVB 4ZVQB 1UEVA 3BDPA 2E5IA 1V9OA 2UXDJ 4ID5A 1C0TB 3N0VA 1NDKA 2C2OB 2J9DE 1RTZA 1RAJA 2AJ1A 2GGPA 2CNLB 1TFWA 2W4PA 2B6AA 4M94A 2ZDPA 1WC1A 2HHSA 4CO2A 1FRLA 3CWJA 4BBYA 2ZWPA 2NLWA 4KC5A 3F0NA 1CJKA 3UCGA 4NA3A 4YB6A 2DGUA 2ZDOA 2LKZA 1N0UA 2DD8S 2C1EB 4WK1A 3FNNA 4OLPA 2HBYB 1FWKA 3UDCA 3I82A 2CNNB 4HYKA 4ZHRB 2R7TA 1JKHB 2NSCA 5B0CA 2QMUB 3TVZA 1SL2A 3DOLB 3CCQS 4O0NA 3DYAA 4PUOA 2RHSB 1RU1A 3K8VA 2OFGX 4DQPA 1T03B 1F2GA 2C2ZB 2EFNA 3KK1B 2BX6A 4DCJB 1FVSA 1WELA 1RT6B 1QTNB 2W8LA 4JI7F 2E1MC 2AGOA 1CULA 3R27A 3KLFA 5KFSA 3QATA 2ZNZA 1GK8A 1S9GB 1W7WA 2HIYA 5KFCA 3RB4A 1ACMB 3AHPA 3K2YA 2EVZA 3FNBA 2YQ0A 3OVBA 4ZVFA 4DR6F 2CPZA 3MR5A 2E7XA 1ZYQA 1UA1A 2YWKA 3ZZPA 2RS8A 3ET6B 3BGLA 4MKVA 4NYZA 5F0WA 1QJHA 5A8KB 3LGNA 2RNEA 4ZMMA 4AD6A 4YQWA 4MTPA 2VKRA 1V6HA 2UUAF 2YVSA 3W3SA 3PACA 3MMCB 4XPCA 1Y11A 1NSKL 3H59A 1NPKA 1S6UA 2DGWA 1HARA 3HX9A 1XR7A 3VF0B 4CQ1A 3AOAA 2D69A 5C2CA 4NOHA 3GQCA 3IR6B 2DNZA 1KWMA 3HI9A 4HHUA 4IRKA 4ZLPA 3PFEA 1P6TA 2IIHA 3SSSA 1QAJA 2VA2A 1DLOA 5E2QA 1EB0A 1U09A 4MKBA 1JX4A 2KB2A 2CPDA 2FIUA 1LWXA 2OJ3A 4ANEA 4QR0A 1R6YA 3AY0A 4P52A 2F63A 4LFCJ 1SVDA 1X4AA 3IP0A 3G8QA 2XSJB 4V19X 4DV5F 4DPXA 3M9OB 2D3OR 3QZ7A 5L9NA 1YZ7A 1F3VA 4BDPA 2IBKA 3OR1B 2GAHC 4FF2A 2PDAA 2J7WA 3ISND 4NA1A 2CPJA 3KMQA 1HNVB 5GAGU 2ZHBA 2A0FB 2AW0A 3U1LA 4QYZK 3LF0A 2AIRB 4CLLA 1TFYA 2XZTB 1HBUB 4DQSA 3GSIA 2MLYA 2AKWB 2AWZA 5KFHA 1H3DA 4DL7A 2ACMA 2F9JA 3KK3B 3M2UA 2QJ3A 2D3ZA 3IM9A 2ZOMA 3LA0A 4DZDA 2G0CA 1HHQA 2XS5A 2PMZD 5G0RB 1N32J 1JQOA 2M2BA 3LQVA 3NGSA 1T11A 2O01C 4K5RA 4Q44A 1FA0A 2ERRA 2A2DA 1ZOTA 4NWBA 1CC7A 1M5OC 3NP5A 3VAHA 6FDRA 3UN2A 1CJVB 1AW0A 2VIHA 3L95X 1S10A 2AEJA 5HBMB 2F8EX 3PYFA 5C42B 1UVIA 3RBXA 1S6OA 1KVKA 3JQJA 3CJQA 4RJVA 4LBPA 3OL8A 4MKAA 3EZUA 5CYMB 1VRTA 1RWKB 4NXNF 4MAKA 1VQ6S 2OEKA 5ETMA 4NPOA 1R8AA 3J7YU 2KZZA 3M8WA 3GFXA 4G1QA 2PIIA 3ZTSA 4ED4A 4PG4A 1RWOB 5A2QY 4DOZA 2DNPA 4KPCA 1Q5VA 1R0AB 3FSIA 4F36A 1RTDA 1N36F 3C15A 2A6MA 1TL7A 2VPYB 2JFKA 3MDFA 1NHUA 5HLFB 1BQNA 1FD2A 1N34F 3O6QA 3CGIA 1QSYA 1NXIA 4WFAQ 4XDDA 1KRPA 4G75A 1NK9A 2D7SA 3UI3A 2AYBA 1FRIA 3HFVA 2HVIA 4U8VA 3CCVS 2BJDA 2KG1A 1GTEA 2AU0A 3UDEA 2Y9HA 3EGNA 2ZOGA 2BV3A 3CC7S 4RW6A 4HH1A 4CO5A 2GAGC 2YNIA 3W8GA 4OFZA 2QZ8A 4R8UA 3U1NA 1YG0A 1NAQA 3ZXWA 5J2PA 4M5KA 4IRCA 4RWWA 2HZVA 3LPEA 2W24A 5KOWA 3R2CJ 3FMBA 3J7A1 3I0SA 1S6QB 1VC0A 4DQQA 2KT3A 1V3RA 4DG1A 4UTGA 4ZS6A 1I5OB 1ZM4A 2RQKA 3U02A 4ZVSB 1L3VA 2LMIA 3N9UC 4HTIA 3HHEA 4OYIA 5B0AA 2MZQA 2B4VA 4GRSA 1FI4A 4DCPB 4DR5J 2R2UA 3W61A 1MWQA 3THPA 3H5XA 3IC1A 2FLOA 3LWMA 1O6XA 5IM0A 3CD5A 3CJKA 4MK8A 3UDLA 2FTRA 3DLHA 1FFWB 3OL7A 1YRTA 4RU9A 3JTPA 2ATCB 2DJWA 4H4OA 2R7VA 1IUJA 1GT8A 1VDHA 2QN6B 3AD9C 2K3KA 1FD8A 4A8OA 2XTQA 1EETA 1RXOB 4DXLA 4TYAA 3CIMA 4KHRA 2ADCA 3R7NB 4YMEA 1APSA 1HWLA 3BH7B 2FLLA 3FQKA 3MR6A 4ENOA 4KO0B 4PXDA 4LSNA 2OPRB 4NRTA 3EZOA 3VV2B 2Z57B 1OY6A 2M52A 1TTHB 2FVRA 3T1HJ 3OTOF 2ZBQA 2UUCJ 4OV1A 2YQ3A 3QGGA 4I67A 2JC1A 3D1HA 3SDEB 2XWXA 3SYZA 1UEUA 5F9NA 1JLGA 3KK2B 3PEJA 1EQ0A 5LSLA 2OHDA 1LWFB 1SKSA 1S59A 3LP1B 1UL3A 4WE1B 4O3OA 1GMVA 4URQU 2XMUA 2I5JB 3AD8C 1KFSA 4IQMA 3UCZP 3BQ2A 4H4KA 5LSRA 1FTCA 4PXCA 3NS6A 2FHKA 1Z1ZA 4Y2CA 3HO1A 3BSAA 3DRYA 5KG3A 2HLUA 4Y34A 3CW2C 4GVBB 1RT7A 3J7ZT 2FGOA 2J0SD 1UFKA 5IZHA 3Q89A 5DZ6A 2IM1A 1RP5A 2E5JA 2W9BA 1HBOA 4ZP6A 3PHEA 3P5BP 5JMNA 4W90B 1LWCA 4N77A 3SCJE 1FVQA 3R6GB 2BJ7A 4PQUA 1VIOA 1R8CA 1B0PA 1LFWA 2ZD1A 1UZDA 1T94A 3G87A 4XDCA 3CCRS 4NV5A 1TVRB 3QJPA 1U6BA 3G6ES 3TAQA 1M1HA 1C4CA 1SUQB 4MFBA 2COLA 1DTTB 4OJ1A 1FJ7A 3CJ0A 4C97A 2QGFB 4ETZA 2VB6A 1IKYB 2XO6A 2OPPA 1RACB 4ZLJA 2E5LJ 4GO7X 3NGTA 4C4WA 3D5MA 3BGUA 3QIDA 4USWA 4X4QA 4LF5J 4J9KA 3I5BA 4P72A 2N7YA 4DZ6A 4RUCA 3M6UA 3AAWB 2G4BA 3N5BA 1NLKL 3C6UB 4C8OA 2HS4A 4J9MA 1RHQB 3F44A 4B9LA 2F8HA 2UV8G 3L7PA 3MURP 5BR8J 5U47A 1P8GA 3MECB 2DGTA 1SKWA 4H4MA 1R0CB 2R7OA 1R31A 3D4JA 1YZ6A 4YR0A 3ELHA 3D3CJ 3PG9A 2EW9A 1M5HA 1TKTB 4B3SJ 4BC7A 3DLBA 2RE1A 4RU2A 2RVJA 3W8PA 2CQ4A 2HFNA 4FZVA 1O5JA 1CQMA 1TZ0A 1T9WA 4WP8A 2DNNA 1VLOA 4C3MA 3IRXA 3F4MA 1IBMJ 3RYLA 2K8GA 2GJ2A 4LF8F 3O2IA 4GKJJ 2FYXA 2ZITA 1YJWS 3KDNA 2V2KA 4DSLA 4OHWA 2G13A 2BE2B 1TU0B 2I1RA 1HWKA 2LP4A 2CZ9A 3CCSS 4NLPA 2UUBF 3R2DJ 1JMTA 2X7IA 4CO0A 5HROB 4RR5A 4DQIA 2IYIA 5KFFA 4TYBA 1N5YB 3NCRA 3N28A 4UW2A 4X4NA 1FE4A 2MZRA 4X66F 3NG8A 4LVNP 4F3OA 3MEEB 2CKWA 2MY7A 1RTJA 4IDKB 2CVIA 3HCXA 4X4RA 3KJVA 1C2PA 3DHWC 5HANA 1NH7A 1RGVA 4R5PA 3FZ2A 1M5VC 4Q43A 2VV5A 5KT7A 1PIEA 3BZQA 2PMWA 3EE3A 1ZTTA 2R7UA 1LEOA 5DG8A 4CI0B 2JLEA 3U27A 1TMMA 3DN9A 1B99A 2CNKB 2JDJA 3MM6B 5J2MB 1OY9A 1KLMA 4DPUA 3MR7A 2HVEA 4IG0B 2IAJA 5A6PA 2ZH5A 2ZRRA 3WZ0A 3GONA 1S1TA 3D6HB 2NPIA 3M30B 3R9LA 3BR8A 3DGPB 4I0WA 4HH0A 2WZ1A 4JI6J 3J80Y 2IC3A 1C0UA 1Q4RA 3BQ1A 4LF2A 3QO9B 3W9JA 3I0RB 3H4DA 3ZZYA 3BSOA 1KSPA 3DLGB 3LP0B 2LA6A 1S0NA 4IH5A 3X3UA 3W9IA 3BR9A 3SXLA 1C1CB 2B4UA 3GZ7A 2JL9A 4KSEB 3GILA 1YQHA 4OYMA 1SXLA 1C0TA 2AQ4A 1NCLA 4EYHB 2B7CB 2N3OA 2W2PP 4ZVEA 3W7BA 1VGYA 1W2BR 3US5A 3R5BA 2VFVA 4NE9C 4C8YA 3L09A 1ZAXA 5A0YB 1GQEA 3CJ2A 2RF2B 1LW2B 3RBZA 2IRYA 2HURA 5ETRA 1YBTA 3NBPB 1EARA 2UU9F 3CCES 4F4AA 2LCWA 1X9MA 4I68A 4CLWA 2EKNA 4NLUA 3DO9A 1BQMA 2MZ1A 3I4HX 4DPTA 2B3TB 1PJ7A 3G82B 5L9XA 1JKHA 1DQ9A 3N79A 4Q2MA 2HWIA 2CQ0A 3ZNJ1 2KRRA 3G2XA 3QJJA 2EBGA 1WSVA 3EMTA 4RUHA 1T03A 3KK1A 1D1UA 4FPRA 3OSNA 1RT6A 4DV3F 2E1AA 1YJNS 2AYMA 3MPUB 3AQPA 1W3SA 4AT1B 3IBWA 2JOQA 4X64F 1ZH5A 1U25A 2JRSA 1RWWB 5LMUJ 3HSDA 4O44B 1BXNA 2VD3A 3M32B 3TJ9A 4TLQA 4EMDA 4ZLLA 2DISA 2LECA 1RHKB 2Y1JA 1RHMB 3JAMY 2XCPA 3PHTA 4ZJOA 4J9QA 2RAQA 3ET6A 2CWXA 2ZKTA 3MD3A 2KM8C 3TUPA 8ATCB 2GSCA 1IWGA 3FCHA 1FKPA 1KVJA 5ETPA 4NLRA 1F9FA 3MMCA 1R0BG 1SJ4P 2BE9B 4RUAA 1S1VB 4NYPA 4K4WA 2HQDA 1NO8A 2UVRA 1HBMB 4ZITA 1MU2A 3RRKA 1N52B 1QVFR 1TL3A 3CJ5A 3PTWA 3FEZA 4CO3A 2DR8A 1EJ7L 3KLVA 2PA3A 1WJ9A 2JH3A 3FK4A 1RADB 1SH3A 3P23A 2C3OA 1WWHA 1S1WA 1RE1B 4LF7F 5DDPC 1GTHA 2MKCA 4K2XA 2WOMB 1XNQJ 1LXJA 1HNXJ 2N4DA 3NL0A 4OZLA 3DOMB 1N5VA 4JI2F 2RIOA 5F41A 3NOGA 4ZA1A 4DWLA 2XSJA 3MCSA 4DX5A 4B17A 2AHOB 3OHBA 2K1RB 3OW2R 2NXUA 2NZCA 4KKOA 3KJNB 2DKOB 3M4XA 1RT5A 3OR1A 4IRDA 2HSEB 1SQGA 3TZXA 3PDNA 4DR6J 4ED1A 2N3LA 4ZN1A 2CUYA 4LF4J 2B9WA 3TOQA 2QMWA 2CPFA 4CH0S 2VA3A 2X1FA 3M8QB 1A0OB 3POTA 1HYSB 1LW0B 3PFOA 1L3KA 3K7RA 3QNWB 2O67A 5L8RC 3BH6B 4LSZB 4EBDA 1OYEA 4F2RA 4C11A 3D54A 1WDTA 3PO4A 1S49A 3HULA 5G0RA 3Q83A 1TK5A 2DBBA 1LXNA 3I87A 3DU5A 1CJUA 2BEFA 1T0TV 2BANB 3WX8A 2W8KA 4EUVA 4ATNA 1U1KA 1L3SA 2AJ2A 1S77D 3TAPA 1YLXA 5HBMA 3KNGA 5C42A 1CS4B 1E6VA 3VR1A 3Q2SC 3GV5B 4ECXA 1I94F 1I3OB 1X8DA 4RO0A 4OLOA 3GIJA 2DY9A 1HBNA 3ITHB 2VZ9A 5CYMA 4DV5J 2ZH3A 4KJIA 4PWUA 2F1FA 3LWLA 1PJ5A 2E9RX 1B3TA 1NH8A 3CMQA 3G4SS 3GYXB 1QE1B 1WKLA 3EDRB 2CZVC 2OIHA 3FBFA 3ZFVA 3QWPA 1YJVA 1NJXA 5FD1A 2LQ8A 4LF1A 4WKYA 2D3O1 2Z8QA 1PCAA 3V6DB 3CT9A 1WNEA 1S99A 1R0AA 2RKIB 3DDIA 4WKRA 1RWXB 1X4GA 3KHHA 2DXEA 2EI5A 2PN6A 3D0HE 1AB8A 1JXEA 2IVYA 3VAFA 5HLFA 5BXIA 2ZJRQ 3BREA 2B56A 1KKHA 3BO4A 3P49B 5G4DA 3Q2TC 2CZ4A 3M6XA 2AT1B 4ZPVR 3N5FA 4DR7F 1D9FA 3CMAS 2HRUA 2HHQA 4NI2A 2H4YB 4OJGA 4PWWA 2R8KA 1RA6A 5I42A 4QCLA 2OD6A 3VCDA 1HD0A 1HD1A 2KYXA 3HD1A 1I1GA 4XTTA 2XZDB 1RT3B 4DL0C 1DHMA 2V8DA 5KT5A 4ITSA 1WI8A 2EBEA 3CJSA 4NXNJ 1N54B 2HNDB 3IG1B 3NRBA 3LJ1A 5CZXA 2FHJA 1WEYA 4R0JA 4F3QA 1TL1B 3QWUA 2VBWA 3HVAA 1H38A 4DS5A 4DR3J 2HHXA 1FX4A 4FYVB 1M5SA 3ENVA 4TY8A 3G6YA 4PL3A 3SBMA 1CEZA 1TKXB 4FYYB 5A8WA 3TYTA 1VJWA 1Z4UA 5JVGQ 1XMQF 1WC3A 5DGBA 1NPRA 2W2QP 3Q23A 3T1YF 2AJ4A 3PW2A 2KRBA 1L5UA 5HMXA 1UMJA 2O5DA 4M5HA 2X3DA 1K0VA 2BZ2A 3ICLA 2AV5A 1BQXA 4OI3A 3JSYA 2E7WA 1VK8A 4OZ2A 3QLHB 1HR0F 2OPRA 2AX0A 4AQYF 3PR5B 2HZAA 1X0PA 3TZYA 4FYXB 5ETKA 4LBHA 2VONA 2ZBCA 1GMUA 4C0OC 2XULA 1RK8A 3JQMA 3GB0A 3KG0A 2HVHA 2ASJA 1S0MA 3GFYA 5B0EA 1UJ6A 3DI6B 2B9XA 1LWFA 4L3NA 4ICLB 2DY1A 1H2UX 4R0EA 4OX9J 3M7VA 3LP1A 2FJAB 5K14B 2HAFA 1SJFA 2I5JA 3D3BJ 4DJBA 2MKJA 5HMWA 4BCAA 4X4SA 2VG5A 4DV4F 2IPOB 3CMES 3I56S 2K7KA 2HGMA 1RT4B 4QWAA 2K7JA 4F2SA 1RCOB 3WIUA 3PO5A 4LMZA 2GV1A 2QT7A 4ZK7M 3UCUP 4RBTA 3OTDA 5HQ8A 2CQIA 2RUSA 1WC4A 1IBLF 4CO1A 2EXUA 2G2ZA 3OV7A 3GFHA 2MHNA 2RB7A 3HXMA 1EZZB 2YXLA 3LALA 1B7FA 4QIVA 4IKAA 2I8EA 3C14B 2PFDA 3VTIA 2QTWA 2NXNA 5E0OA 3CCTA 4U8YA 3PX0A 4IH6A 5KFVA 5HVHA 4NCGB 3DRXA 1U26A 2AGPA 1SUQA 1DTTA 4I1TA 4P7TA 4ZJLA 3DA3A 3JS9A 4B9NA 2D9PA 2CJYB 3EUNA 2J5AA 4NLYA 1D9AA 1KDNA 4G1PA 2ASYA 2CYYA 3K5LA 3M8YA 4JV2A 4MK7A 1NHVA 3ZZRA 3EGZA 5CZVA 1RBAA 4ANDA 1QM9A 4Y65A 2MHEA 3OJUA 2EFPA 2KXHA 3EVWA 3C16B 3Q8QB 3AOCA 4YY3F 3C6UA 3MZIA 1RAIB 1U2FA 3DC2A 5KFAA 4UY8T 4F0MA 2ZH7A 2V5HG 1UVNA 3MECA 1ZS6A 2GHPA 1U6ZA 5H9FJ 4NLDA 2AMCB 2ILZA 2CJBA 4MYUA 3SMZA 1WI6A 2LU2A 2UVWA 5D15A 1GXUA 3MUVP 5E33A 4WYLA 3PJXA 2FJXA 3W1YC 3J7YI 2ZH4A 1D8ZA 2B9EA 1JB0C 2OEMA 3Q8YA 2HIQA 3AJ2A 2F4VJ 5SUHA 3IO1A 3BN7A 3PYGA 2B0GA 2XHWA 1Q81T 4MT1A 4QZVB 3HK2A 1S9FA 3M05A 1YKWA 2BE2A 2BW7A 3D68A 2V4JB 3LW5C 2J6UA 2J7UA 2QYCA 4ZCMA 1ZAWA 3KLEB 3CCZA 3H42A 1KTVA 1HW9A 4ED2A 5HROA 2WVDA 2QFIA 2P9CA 2R8HA 3TUJC 4TN2A 5GAEI 1QTMA 1WHVA 5K20B 4D3HA 5C25B 3IWNC 5KFEA 2LQJA 3MEEA 1N0VC 2AX1A 4PG6A 4GC7A 1Q1KA 4AS2A 3VA9A 5I3PA 2J76E 4UOHA 3LUYA 4A46A 5RUBA 4DPOA 3W2VA 2D1CA 2JSXA 1AXQA 1VJQA 4O4RA 4L75A 3TZZA 2KXNB 4L73A 2QSFA 2XLJA 4FKXA 1VR6A 4DR4J 2XBPA 3HD2A 4NL5A 4U7UD 4KQZA 3W63A 1YTYA 4DV2F 1N6QA 1U0SA 4RX6A 4C8KA 4LFBF 1NB7A 4WU3A 2APOA 2J7KA 3D1QA 1S6PA 2J6SA 4J9VA 2EEYA 5D4LA 5J2MA 5EDWA 2YH0A 1T95A 4N5SA 4ZPAA 4ZKAA 3I96A 3NGKA 2MEWA 3TVKA 1IKVB 2BOAA 4JCVE 2DHGA 1ZPVA 3ONQA 4KGZB 1RT1B 1TP7A 2L1LB 2XY6A 3EXCX 1BD6A 1S1UB 3I0RA 4KFBB 1KLNA 2FUG9 4RNFA 3VAMA 3LP0A 3V6JA 4Z7GA 4IFYA 2DPIA 1C1CA 4DI6A 5AJ3F 3TEHB 3BO3A 5ETTA 4G3IA 1IKWB 4ZPTR 1WG5A 1TR0A 5L46A 5T14A 3OR2B 2IRXA 1G6BA 3SCIE 2XMWA 4HKQA 2YX7A 1ZAVA 1FWPA 2WTFA 3CSKA 4JYAF 2OTJS 2WONB 1BY9A 5T41A 1WOOA 2QLFB 4KH1B 1BLUA 4YB5A 1LW2A 2U2FA 2NSBA 4BLGA 4MIAA 3NBPA 2XLIA 1FDNA 2NYHA 2E29A 1IKXB 4W92B 4LFAF 2QA1A 4KHPJ 3GE9A 2VBZA 3SV3A 2YNFB 3A3PB 3QT5A 2FLPA 4WZMA 1IXKA 2EFGA 1Y7PA 2MMYA 1FJCA 1NDCA 2PFFB 2LA4A 4G1IA 2H65B 3P4UB 1ZETA 4X4PA 1Q78A 2RADA 3BGRB 3ZO7A 3K89A 1S0OA 4RW7A 2VG6A 3I5AA 1N8RT 4JV0A 4C48A 2JZ5A 1HQEA 3M32A 2VPWB 1N56A 4DV7F 2YNGA 2VH7A 2YNHB 4WCEQ 2CIMA 2JFDA 3G6XA 1FKOA 2Q6CA 4A8KA 4EU0A 4IH7A 4TU8A 1U24A 2K06A 3AQOA 2MGZB 3IRWP 1AYEA 3ZZTA 3TA1A 3BYPA 4Y2MA 1FERA 1X4FA 4AL6A 4WF9Q 3DM2B 2FC8A 1XK8A 1RYSA 1S1VA 2QYGA 4KY3A 3CCJS 2DH9A 5HN0A 4HL9A 2UU9J 2VPZB 4GKKJ 3I6PA 2WBMA 5HK4A 5HJXA 1YJTA 4P2FA 1VQSA 2WAQD 3UR0A 1IBKF 4RW4A 1S7IA 3QQCD 2XGPA 3KUEA 1VMBA 3S01A 5KT6A 4DV3J 1MN7A 2KHCA 2PO4A 1OS5A 3PKMA 3F41A 4RW9B 5KG1A 1H2TZ 1RKIA 1SV5B 3V2UC 1Q0NA 4OAUC 4A8QA 3JTNA 4KAIA 4IFVA 3A13A 2HNYA 2XMAA 1Y5NB 1D9DA 4AUKA 1K9MT 3CC4S 1RTIB 4DFKA 1R27B 2FY1A 3BV8A 5C2GA 3QSYB 4DS4A 4WZQA 2WSCC 3BKFA 5HQLA 3ZZZA 4NLVA 4QPXA 3M8QA 2OD4A 2XGQA 3KYLA 1HYSA 1LW0A 1JLAA 3H2VE 4ZPDA 1Q53A 3GCWP 3KOAA 2M9KA 3FFIB 3ENWA 3P3DA 4JI3F 4K4XA 3QT6A 2VDHA 3CEDA 1CJTA 3T5HA 4OYWA 2OFHX 2P22B 4QPTA 2UXCJ 4UQTA 2KN4A 1UW4A 1QSLA 2J9DA 4U6PA 1KNZA 2ZBIA 3RUBL 2VF3A 4RPFA 2BANA 5DO2A 5CYQB 1B0TA 1U49A 3T6JA 1FNMA 1PYSB 4ZP9A 4P7VA 3J7AN 3L0IA 3KLHB 1CS4A 5HATA 2OKQA 4M95A 3DLKB 1P1TA 2BKNA 2ROGA 4USTA 4PAAA 1FX2A 3MAQA 3MEDB 4USJC 1TKZA 3G8TA 1KQSR 1O8BA 4HDHA 2CRLA 1UVJA 4YHHF 1ZPWX 2CG4A 1YRXA 3H98A 3QSIA 1QE1A 3BQ0A 1S1XA 2XB2D 1AROP 3R5DA 2HBRB 4HVZA 1NKEA 5MAOA 2V34A 2GA7A 2QSWA 3E01B 2MJUA 2R7XA 2RKIA 3NWRA 3PNIA 2MQLA 4JI5F 2Y3YA 1KOOA 5IT9Y 3OTEA 2IJNA 4DN9A 1O51A 1WUUA 4I2PB 4ZP8A 2LYVA 3M6VA 4K4ZA 4LVOP 2DHSA 3VVTA 3NCPA 5L1KA 2CQ2A 3TI0A 3RB0A 3K0JA 4CYUB 1UVKA 1KHWA 3ADAC 2AYGA 2UVVA 2X1GA 3TJAA 3V6KA 3MCMA 1PILA 3BPDA 4OHYA 4CLSA 3NCQA 2GIRA 1V3ZA 1KVIA 2XMKA 4QIWD 2YY3A 4D3GA 5KAKA 3FGVA 4ALZA 4K0KF 2AYEA 4NLSA 1BHNA 5D3GA 2W25A 4YN3B 2ZH9A 1BC6A 3KXDA 1RT3A 2Y0BB 2PC6A 4P2MA 4J9OA 2MDAA 3QJLA 4NX9A 1RT2B 2Z2YB 3KJQB 2R7RA 1BWVA 2VQFF 2D3UA 4TLRA 4GC6A 1KC8T 1HNIB 4YP3A 3GJRB 2KVIA 4PKDB 1AZSB 2HFUA 5LJ5Y 2XTJP 1TELA 2H48B 4N41A 1T02A 1NM2A 4E0DA 2AGQA 2VJUA 3FCWA 1G3OA 1GXTA 1RTHB 1MW7A 1B4SA 1Q86T 2OPQB 4HFVA 2QV6A 2HZCA 4DBQA 1LV5A 2Z2MA 1U1LA 3GTYX 2HHHF 4M5DB 3N01A 1KFDA 4NCAA 5KT2A 5KFLA 3IR7B 4LUBA 2E1PA 5GAHI 4IR9A 4OZ5A 3T1AA 3S8SA 4MKYA 4DR7J 1WTBA 1S7HA 4NRUA 4XK8C 3QLHA 2HWTA 3MM5B 3LP2B 2K2PA 1ELOA 1Q8LA 3E8OA 3TAMA 2CJKA 4I64A 4FS1A 4QW8A 4OI6A 3QGIA 2DEJA 1F2HA 2WSEC 1Q5YA 2XYPB 1EP4B 3FSXA 3HM9A 4HI2A 1YVFA 3HMJG 3UNYA 4OYZA 3LPYA 3OTBA 3GU0A 2MQMA 4QOTA 2JLFA 2CAZB 4CLYA 2UXDF 2XMVA 2Z30B 2BOPA 1VYAA 3MFHA 1S57A 2E9ZA 3I9ZA 3BDEA 1R8PA 1KTQA 1W25A 3UQSA 4JI0J 1RT4A 2Z58B 1JLEB 3DRSB 1VHIA 2ZJPQ 4C2MA 3EYZA 2JB2A 1S4FA 5L38A 2XO7A 5T7LB 3J81U 1X7VA 1VQ4S 1Q8BA 2ZM6J 4DFMA 1FK9B 1XMQJ 2CXEA 3P45B 4KH0B 2IJRA 3T1YJ 1CPZA 2V6EA 3VGSA 3OLBA 3I31A 4OI4A 2B9YA 1RAGB 4URSA 1PBUA 3MM8A 2XS7A 1AFIA 2ZEJA 3QT7A 5IT9U 3M2RB 3BS9A 2JJ4D 3MFIA 5KG5A 4EZ9A 2LQ5A 3O3LA 3VAIA 3FKBA 2OELA 1KQFB 4F4KA 3CD7A 4NCGA 3FVVA 3EM1A 2UXBF 3OXGA 4M5NA 7AT1B 4RNMA 2KO1A 3VAKA 5CXTA 2JB3A 1D3WA 2B8QA 2NCKL 2ZVSA 1X4DA 2ZE2B 2PI5A 4ES1A 3MM7B 2MZJA 1MMNA 1CBKA 1ZZFA 4LR8A 4ID5B 1K44A 2V8GA 5CD4H 3Q86A 4YZDA 2GGPB 1F0XA 3W66A 2L9WA 5HVGA 5DM7Q 3L7OA 4IO1A 4GXTA 3C16A 1X4EA 4AS3A 3MTJA 4UOCA 4HHJA 1IBLJ 2KI2A 1R43A 3IWXA 4X4TA 3UD3P 1NSAA 2RQMA 4DSFA 3ILIA 1VC6A 3L3CA 1QVGR 1U8WA 2NREA 3VGVA 2IA6A 4RNHA 2MQOA 3WHIA 5KFTA 4RW8B 1HIYA 3O1LA 2JLGA 3JXOA 1N33F 4FPIA 3KLGA 2WB1D 1WHYA 4LRCA 1PSDA 3UPFA 3DNCA 3HDSA 3ULHA 4B3RF 1VQKS 4B9UA 2U1AA 1WDDA 1NSQA 1U7LA 3PXGa 2XHCA 2E1CA 4LFCF 1RHUB 3QGHA 2UP1A 4B9SA 4U67Q 2V4JA 2IBOA 2RDDA 3OPKA 2RIJA 3SDJA 4DUZJ 4C8ZA 2DITA 5KT4A 4LREA 5FLXU 1UPPA 5F8MA 4OZNA 2HW3A 3MPWA 4OV6A 1ZBTA 4KB7A 4ILRA 3S7RA 4ZN3A 3LH2S 3N6MA 3OFFA 4QIFA 2VFSA 1JJ2R 5C25A 3MTKA 1X9SA 4ILMA 1DY3A 2FU2A 2DPJA 4CH1A 2Y8YA 3EICA 4DUYJ 2P6TA 3FBEA 4OX7A 3ZZOA 4USVA 5MLCV 2R7QA 1NMEB 4Q8FA 4DWIA 5K8PA 1U0HA 1RWNB 4M5JA 3K59A 5KFPA 3FEXB 1N32F 5DJBA 4PQAA 2YPZA 4M5GA 3IWLA 2RS2A 2G2OA 1NUEA 2ZWOA 3RG6A 3MAAA 2OH2A 2DRBA 1FDBA 4YFUA 3AD7C 1ITPA 5ADZA 5CYJA 4EWTA 4JOUA 3GV8B 4WIIA 4DF4A 2HEKA 1XIQA 3Q22A 1URNA 1YBAA 4KR0B 5F8GA 1U1OA 4ED0A 3MEGA 1H7WA 2EFQA 1IKVA 3SSQA 2E5HA 3DLEA 4Q5VA 2O1PA 1YDLA 1U02A 1RT1A 4RLEA 2O3DA 5KFRA 4JBCA 2CQGA 1T3OA 1RAEB 3GIIA 2W9CA 2ZUGA 4ZVRB 4KFBA 3QRRA 5SZTA 4JI8J 3CD6S 2IMOA 3X1LB 3FBVA 1IKWA 1XN9A 3TQEA 2AJQA 1IR2A 2MSSA 5LSOA 3OR2A 1SIZA 3CCWA 3ETMA 3DRPB 3KDOA 1VLYA 1UW9A 2FY8A 4TVAB 4Y2IA 3RRGA 3R7BB 5CHCB 4E2FB 2FJDB 4ECRA 2JWNA 1RBOB 2DNMA 2WONA 2OMOA 1UVLA 3ZZ0A 3PIPQ 2CVEA 5KFYA 2FEFA 5KG4A 2J8SA 3BN4A 3GCXP 4DUTA 1IKXA 5THWA 3H20A 4ZVUB 3IXQA 2LXIA 3HHLC 4HLBA 3PZPA 5F8HA 2ASLA 3H2UB 3BO2A 3A1YG 3ETOA 5J2NB 2QA2A 5DQIA 3EPGA 2YNFA 5J2QB 4J37A 2MY8A 4JUZA 4PRFA 5F8NA 3AJFA 3AXKA 4ZCIA 4O3NA 4NLWA 2LFVA 3RZAA 4QWDA 5C7PA 4C3KA 2XMTA 1IQZA 5GAEU 1HW8A 1LK5A 2HFZA 3PIOQ 3W5XA 3RB6A 4DL6A 1HWJA 1FDDA 4HDGA 1CVJA 4Z7HA 1WC6A 2A3JA 4ECZA 4A8FA 4CLUA 2UV8A 1H98A 1HNZJ 1RTDB 1FO1A 3C15B 1TL7B 1XEZA 5F3TA 1GFWB 3GP9A 1BQNB 3VGUA 9ATCB 2OGUA 1ZM2A 4JYAJ 3OFGA 2DHXA 3AOBA 4KRWA 2BR0A 2DVIA 2H5EA 2R9LA 3CCLS 5E7OB 3T5KA 3QFWA 1DARA 4B3OA 2DHAA 3IR5B 4Z7YA 2BQ3A 2IDLA 2YBVA 3DM2A 4LF6J 4NLGA 2YH1A 4K50A 2D74B 2PEHA 2F6MB 2YNIB 1DJ0A 4NZ7A 3T1HF 2LEBA 2VFTA 3NAHA 3UD5A 3EXYA 4LFAJ 4PG8A 3GIMA 4KIAA 2DNHA 4A48A 4RL1A 1XMOJ 3TUIC 1Q8KA 5K8MA 1T9VA 4HTJA 2HQIA 2LEPA 1NJZA 2E8GA 4A8XA 3FEYB 4NEZA 4P6QA 4E8UA 1NK6A 4C98A 2V67A 1HKAA 5FDLB 4OMFG 2JB1A 4K59A 2CAJA 3W2WB 4P74A 1X0FA 3PYEA 2R8GA 4KV8B 4BWJA 1D8YA 3BSNA 2R3VA 4ZJQA 4RW9A 3Q8RB 6AT1B 2H5JB 1DRZA 3D6FB 5IM0B 1HQUB 2OUGA 3GWCA 1SI9A 1VRUB 1N48A 1C1BB 2ALZA 1RTIA 4IR1A 1JIHA 1HL6A 4H4OB 2ROEA 4DL3A 1RBLA 1K0TA 5IWAJ 1VIXA 3IAM1 4M8LA 3RW6A 4CT9A 4TY9A 3HVTA 1ZZNA 5B0GA 3RW7A 3FFIA 3BYRA 3A3NB 2RUGA 2PE8A 1LOUA 3UVJA 2J9EA 2DGOA 1TQLA 4DR1J 1SCJB 5KFDA 3I55S 1EIYB 2KM8B 1VISA 2GQ2A 1LQ9A 1EAYC 2FUG1 4Y2AA 2LU1A 5HMYA 2VJVA 3RB3A 5D4PA 2M7SA 1TL5A 4RNOA 5KG2A 4IUFA 2W2OP 5C24B 4EK2A 4X62J 1KD1T 2OSQA 3TO8A 4O3SA 3MOZA 2VFUA 1U47A 5CYQA 2QC3A 2IRUA 1TDPA 3DOKB 3RTVA 1WSRA 5A2QU 2E5LF 3IN5A 3DLKA 2EC2A 2YKNA 4TKTA 4U7UK 3TQ1A 2HK2A 4ZVOB 2G1HA 5DG9A 3CDBA 4JI4J 1YJRA 3OVAA 2DK2A 3HVWA 3JSMB 3MMAA 3TARA 5A8RB 3I5CA 2YKQA 1IR0A 5D0GA 3AB4B 4LF9J 4C7QA 4RUBA 3SSRA 3E01A 3SFUA 3GYGA 2DIUA 3WDOA 1HPZA 4KYZA 1V5IB 2LQ9A 3EJMA 3D9BA 5F8LA 2W9BB 1HBOB 4CM2A 3DKDA 3P5TL 3M8PB 5CH7B 2HVDA 5ETNA 1LWCB 1RZMA 2B4OA 2OMLA 3HSGA 4FYDA 2XTRA 2QRRA 4I2PA 5H9EJ 4ZPWR 4JI3J 4X4VA 3PR4A 4P71A 1OJ4A 3RBEA 4B08A 1WKKA 2QX0A 4CYUA 1KR4A 3FRZA 1JLCA 1J5OB 4GMKA 4M63A 4GKJF 1Y4ZB 2FGCA 5JXSA 4PABA 2W1BA 3FUYA 3AXMA 1BWEA 2ROPA 1UETA 1V3SA 5LXRA 3J81j 4CH7A 2OPPB 3JB9k 2R4FA 4FXDA 1H2VZ 4QYRA 3SQGA 1Y10A 4KT0C 4UF4A 2CNOB 2BJ9A 2M8HA 2Q43A 2EFVA 2WW8A 3QMQA 3H2LA 3FC9A 2VU5A 5DM6Q 4QQBA 2POKA 1SKUB 1RT2A 4OIXA 3L9ZA 3MR3A 1JQGA 3RAQA 3OXLA 4FVMA 5DQHA 4YHHJ 1SB6A 2WHOA 1JJ4A 2UVUA 1HNIA 3GSDA 2HFOA 1DQAA 2BM0A 4ECVA 4CP5A 1AZSA 1TV6B 5LNK1 3R5CA 3SCKE 1TAUA 3A12A 2NS1B 4H4MB 4CT8A 3IFEA 2P6SA 1J27A 1QUPA 3NMRA 4EO6A 1N88A 2LQBA 4GO5X 2J6TA 2QA4S 2DRAA 4G6VB 1RLCL 5L1LA 5KFJA 3K57A 5KFZA 1M90T 4N8NA 1S72S 2V9KA 1NK0A 2OAUA 2G0IA 2DCLA 4ETXA 2LVWA 2BRLA 1TAQA 1SH2A 4F04B 2CWKA 3DLLQ 2MQQA 3AH6A 3EX7B 3ZNUA 4C0BA 2M5YA 3QRPA 3AJDA 2CPXA 3MM5A 3LP2A 2GVDA 2ZKUA 1JLBA 3KHRA 2AEFA 1LKZA 4DR2J 4JI6F 2VC1A 2IM0A 2R8IA 3Q8SB 3DRRB 2XG8A 1EKSA 4N7TA 3K5NA 4JV5J 3MCNA 2FHOB 3PJ9A 2MJFB 4A8SA 2EK6A 3DDKA 5F8IA 2I2YA 2F5GA 2H4WB 3PM9A 1YIJS 1ZA2B 1XR5A 2EFOA 3B8HA 4LJMA 4WBFA 2XQCA 5HAOA 2DR6A 3DGVA 4L74A 2DNLA 3Q8VA 4Q2LA 3RU0A 5CAAA 3KJVB 4DSEA 5EWFA 1JK9B 1Y3KA 3KJFB 3FDSA 2H3EB 1F5AA 2AF6A 2MB0B 1RWPB 2FLNA 2YKMA 4MYTA 4F4WA 5T7LA 1GAOA 2NXCA 4M5LA 1AFJA 1S79A 5LT5A 4G65A 2C2DA 1SJ1A 4WYWA 3R5GA 4Y00A 3TW0A 2YWWA 1JWWA 5IV4A 4GVLA 2HHHJ 1WHXA 1RU2A 4A47A 4LSLB 1DZ5A 2RH3A 2JAEA 4M1KA 1JLFB 4O0IA 2DO0A 5CCLA 4DLEA 2B4PA 1REVA 4S0MA 3S6EA 4JP8A 1KLMB 3M2RA 2J8AA 1H0HB 5IXUA 4BS2A 1FEHA 1GX5A 2MLXA 3EPIA 5DQGA 1H73A 4B3MF 1PC5A 3OL9A 2QLBB 4JI1F 4DX7A 1T9UA 1NK7A 1C0UB 5DETA 1RABB 5LMNF 3AB2B 2CQ1A 4AL7A 4OHXA 1S5ZA 3JTOA 4KTQA 2CQHA 2C3UA 3B4MA 3I9V1 3MWBA 3PRBA 1TK8A 1JNZB 2NUHA 4PYAA 1FJGJ 1DFDA 2ZE2A 4ED3A 3MM7A 4EBCA 2Z0GA 4HT7A 3D0IE 4Y3CA 5KOXA 3LOUA 2BDPA 4ZHRA 2GQQA 2VICA 4EZ6A 3W60A 3GJTB 3P96A 5BJRA 2P9GA 3DOLA 4E98A 1FJEB 4ZVPB 3UFCX 2PSZA 2MKKA 4UUXA 2ASDA 1K1SA 1RSCA 2D41A 2EC0A 2GIQA 2N82B 4OX8A 2H9ZA 3TA2A 5GAHU 5A6WA 3U7JA 1RKJA 4LQ9A 4N8OA 2HG4A 2J0QD 2CQ3A 3ZTQA 1WF2A 1XERA 4NV2A 4LIWA 1U2RA 4RW8A 2GS8A 1BQMB 1LK7A 4NZ6A 1S9GA 1UFLA 1NEEA 1F3FA 1HI1A 3RAMA 2GX8A 4XPEA 4RNNA 1ICEB 4UT4A 2M4MA 2BQUA 2RDIA 1XNQF 3I4PA 2DYAA 1PO6A 1HNXF 3D0GE 4ZVGA 1Y00A 2K3IA 3TVYA 2YX4A 1UKUA 2ETDA 2FVSA 1C4AA 5A8KA 2XMJA 4Y6IA 2UXBJ 3FVYA 2XWYA 2F65A 5EX3A 2HHUA 3VWSA 4V1Ak 2VG7B 2EG1A 1P1LA 3A8IA 1PGZA 3A3OB 3KP9A 4LF4F 5H9FK 4C8LA 1X5PA 4CRJA 3T3FA 4H4KC 5AXMA 1HMVB 4Q8EA 2H1YA 4B3TF 4YDDB 1NZ8A 3OUYB 3SZ2A 2R7SA 1UPMB 1FKPB 1KQKA 1RYRA 3MXHP 1MMLA 1LNQA 3KHLA 2N7CA 4JI7J 2V4QA 3PY8A 1VHFA 2MKHA 2MKIA 4ZP7A 1U2CA 5B08A 2FJVA 2HQGA 3D66A 1MU2B 1TL3B 2BKOA 3N6NA 3CF5Q 4CCHA 8AT1B 4QWEA 1N33J 3GLJA 1S1WB 1HQ2A 3IA0A 3J80U 4L3KA 4X84A 1HNVA 2HS3A 4UQGA 1CSJA 1RDRA 2E5GA 4NLOA 2V94A 1VFJA 4B3RJ 2X1AA 3F56A 4WXOA 1GMWD 3BEGB 1PJ6A 5D0RA 1HBUA 5AXKA 2MKSA 4QU6A 4Q0BB 2UUAJ 2NZ4A 1NK5A 4KGMA 1LFPA 2FC9A 3DXSX 2CADA 4TQRA 1L3TA 1JJCB 2DNKA 3MMBB 2GJIA 3KK3A 4KKOB 1RT5B 2BJEA 4LR7A 2MQPA 5D6GA 3M2VB 3R3TA 4WP9A 4PPDA 2FVCA 2BBEA 2C3YA 2V50A 4QWCA 2F9DA 1RWUA 4L6V3 1UTAA 2XM3A 2FJBB 1IJFB 3CE8A 4I69A 1CJVA 3POTB 1G1XA 2HHTA 3WC0A 5LOQA 3PX4A 4I6YA 3DRPA 3RJMB 2IP6A 2GC8A 4OZJA 4LIRA 3MUTP 3BBFA 1R7IA 2OPSB 4U9RA 4C11B 3ZC4A 1W2IA 1KOHA 4OX6A 3PW4A 3LJ2A 2IHR1 3OLAA 2QEXS 4AL5A 3HKWA 3AA8A 1CJUB 1WD6A 3CPWR 2HNZB 2RQCA 4RZRA 3J7Z5 2G0JA 1PAUB 3DXBA 2ZH8A 2ATLA 2B43A 3IMQJ 4CWBA 1E6VB 4IOBA 5J2NA 3M9MB 5J2QA 4C3LA 4YB1P 3NGDA 4I7FB 2IVFB 1HBNB 5GADU 1SQEA 2MTLA 3LGMA 1G7CB 1VI7A 1UWBB 3K17A 2RU3A 2CJXB 1FKAF 2YPYA 3JAMU 4ZVTB 4KHMA 2ALYB 1SH0A 2DIVA 2IVMA 3LJ0A 4M5IA 1WOSA 2XLKA 2NQPA 2MYFA 3NGUA 5KFBA 4K5SA 4DR3F 1FRHA 2VUGA 3CCMS 4C6AA 4KGXB 4DDFA 5D77A 3T19A 5D0EA 4MIBA 2JEIA 2NR0A 1WACA 4QR1A 1QD1A 4H54A 3BB5A 2GZOA 2WVEA 5J1NA 2CJ9A 4P9SA 1HHTP 4AYBD 1R8HA 5IOLA 1E6YB 1H7XA 1S6QA 1G4CA 3NLCA 3HFZB 3TEGA 1VQMS 4BWMA 4K4SA 3LGHA 4OZ1A 3VAGA 4HT5A 2V2VA 5FJ4A 4P10A 4U6RA 3HHLD 2E7VA 4NI2B 5GMEA 3PW5A 3VHQA 3G8SA 5I42B 2BKPA 3K5MA 1GEHA 2BM1A 1N36J 2V6AA 1F9HA 3C46A 1FT8A 5DG7A 1OPIA 2KJVA 3Q8UA 4ELUA 3QZ8A 1N34J 1HI8A 1MMDA 1WG4A 1ZM9A 3PRDA 2H51B 2V2ZA 4OX9F 3CJTA 4NLTA 5FDLA 3D1OA 2VASA 3W2WA 3JQKA 2C2RA 2X51A 1IM6A 4KV8A 1VQ7S 2CQBA 4OYBA 1S12A 4KO0A 4ANCA 1VBXA 4I6AA 4TY8B 4J9LA 1HQUA 2XI3A 4EBEA 5KFUA 3V6HA 4NMLA 1VRUA 3C2PA 4FP9A 4WFNQ 2JX2A 4CLPA 1C1BA 5A8WB 5E5NA 1K73T 3EVMA 3FBBA 3SDEA 4XAKA 3KK2A 1JLQB 4C9DA 5EUHA 4OHZA 1S9EB 2DB1A 3TX0A 3CDAA 2QG9B 2C42A 2Y1LB 4K8RA 1Y5IB 2QGMA 5LL6d 4X65F 4WE1A 2YWGA 3NEKA 2XC9A 3AFGA 2UZAA 3TX8A 1XNRF 3H5UA 1QAXA 3IS9B 3CO0P 4GVBA 1A9NB 1HFEL 2BQRA 4WJBA 5C24A 3MOJB 4EEYA 4F50A 2ZNYA 1RHJB 3TWZA 1TUGB 3TUZC 1OWXA 2EK1A 1VK3A 3DOKA 3FSYA 4ZIVA 3HHDA 1B0VA 4DMZA 1NDPA 4ZLNA 3NKYA 5M2UA 1SL0A 2R2RA 3OQ2A 3FBCA 3UDVA 4CM0A 4YR3A 3TA0A 5F9LA 3U1MA 3PEHA 3JSMA 3LANA 2VG5B 2O66A 5A8RA 5E3PA 4DV1F 4F25A 5K8NA 5JVHQ 5CD4A 1FRMA 1RJJA 3OTOJ 4IOAQ 1TVRA 4ZIWA 3C8YA 4FDFA 5K8OA 2PI4A 1OQ3A 4LRAA 4IQXA 3M8PA 2R7WA 1IKYA 4F4XA 3OBIA 1RB0A 1U6FA 3DHXA 3GR0A 3UW1A 1YRUA 2JEFA 1KN6A 5EGYA 5CA5A 5I3UB 1VBKA 3NNCA 2F4VF 2F40A 3CB4A 2VHGA 1J5OA 5BYQA 5IS2A 2KT2A 4WP3A 3RR7A 3D6MB 4PCQA 2KDOA 3LAKA 2CDQA 2DT9A 2ZUAA 2XNQA 1DBDA 4USHA 1M1GA 2FZGB 1YJUA 2DGVA 4WIQA 3M8SA 1TKTA 1MWYA 3R5JB 2W4CA 1JXVA 4RKUC 3EDQB 2OO4A 2QLXA 3CJ3A 2HK3A 3GIKA 1YJ7A 4OI1A 4DSKA 2GNKA 2DR9A 2BVZA 2HHPA 2EWHA 3TANA 2ZFHA 4F8RA 2YFAA 3H90A 1TV6A 4LQ3A 1T8EA 5IFMA 2KH9A 5F8JA 3D6TB 2HHWA 3KHGA 1H6KX 3PYDA 3R5AA 5AE2A 4DF8A 3HZEA 2C22A 5DLFA 3PX6A 4DFJA 4DR4F 1GH8A 4M5MA 5HGIA 3VAJA 4USKA 4U95A 4PWDB 4ZDNA 4B9MA 2BL8A 3EGWB 3V81B 4J5OA 1RWVB 3M1VB 1SQFA 1Q95G 2RU9A 1UJ5A 4OJ3A 1N5YA 3QYYA 4HEA1 4CNYA 4C8NA 4UZBA 1U1NA 5IQQA 1DURA 1LWEB 1HA1A 3W5YA 3P6YC 3H8YA 4IDKA 3GV7B 3C3LA 4OZ0A 3NMAA 2OP5A 4W98A 3UWTA 2RMLA 1NJWA 4HACB 1EHWA 2VC0A 5B09A 1H74A 4PXEA 1MNEA 3NWGA 3DRRA 3LAMA 4QYZJ 2PD1A 3MR2A 3IAS1 1T9YA 3H5SA 2VQEF 5AXNA 4PR6A 4FNIA 3IM8A 3DCAA 3Q8DA 3ZZUA 4QWBA 1IQTA 3VALA 2CQDA 4ZOSA 2KZMA 2HHVA 1GNKA 2BUNA 4O3RA 5DS7A 3MM6A 4DL2A 3IAM9 2KL8A 4LF8J 3M8ZA 3OFHA 4PL5A 2R2TA 3MI7X 3T41A 3W2VB 3LO3A 4IG0A 1U1PA 1FNOA 2CQCA 3M30A 1OY8A 3DGPA 1TMJA 1YJ9S 1KS2A 2F3JA 1RUSA 2UUBJ 4EI2A 4CZCA 5B0FA 1HNWF 1N6QB 4ER8A 2XI2A 3QO9A 2Y8WA 1H72C 2RHQB 4WPAA 2WCXA 1B64A 3DLGA 4LSLA 2QA4G 2PA8D 2E66A 1S6PB 2QMXA 1JLFA 1KHVA 4KHPF 1D0EA 3L7UA 3QRQA 1IM4A 3CO9A 2BYCA 4X66J 2HMIB 2B7BB 1ZM3A 5CCMA 1SJQA 2CPIA 3H7HB 1Z2ZA 1TUVA 2G9OA 3W64A 4EFAC 1TKDA 1QDUB 2Q1LA 1K47A 2HRTA 4J91A 4PG5A 4DL4A 1AT1B 2P2CB 2SXLA 3DMJB 1KEKA 4F0KA 1XR6A 4NXMF 3GG0A 4UOFA 3V4MA 2FDNA 2Y0SD 3KFWX 1X5OA 5KFGA 2C2NA 2XZWA 1FE0A 3G96A 3DA4A 1URRA 2HS0A 4I56A 5KT3A 3KNAA 5A0YA 2HRYA 2DNGA 4IFYB 5F3ZA 2RF2A 3IBFB 4K4TA 2KKMA 3FZBA 2WK4A 4ES3A 3HJVA 2LDYA 4MH8A 4HHHA 4DSIA 4O4GB 1VQLS 2M70A 3BKTA 3S1TA 4DX6A 3G82A 3SIPB 4C0HA 1BGXT 1MROB 2HBZB 3TRGA 3H25A 1NRKA 5GVQA 3JSBA 3HKZD 5E3RA 1UJ4A 2V69A 1N5TA 1Y0HA 1OSDA 4NMXA 4A8WA 3FMWA 2CG8A 1VQOS 4GKKF 2HBQB 2QL5B 2CPYA 1FXDA 1M1KT 3R1HA 3O8WA 2M8DB 5LXYA 3OTCA 4YEAA 2HYIB 2E44A 5EX0A 4O44A 3L4BC 4AE5A 4CTAB 3CD0A 4P73A 3QIPB 1NJYA 4ZCKA 4BC9A 2V0NA 3SI8A 1U1QA 2DR5A 1OIAA 4B3MJ 3CC2S 4JI1J 2NXEA 2V1CC 1F6TA 1KQGB 5LMNJ 2XMMA 3C6TB 2F66B 4QW9A 2WVBA 4J9PA 4RW7B 5KFQA 3BPSP 2VG6B 3G86A 3MUMP 4EGLA 3UD4P 2Z2LA 3KG4A 2IDEA 2A6OA 1NNDA 1HBMA 3R6LB 2J0WA 1HQEB 1KP6A 1X60A 2VG7A 4F67A 1X31C 2PEBA 2YNGB 4DPYA 2DCUB 2PMHA 1WG1A 1Y3JA 4F4YA 1FXLA 3JYTB 1VBYA 1Q16B 1XQIA 4WTYA 1FKOB 4DV0F 3THTA 4FN5A 2YQ1A 3MM9B 2FVPA 2P5VA 2ZC3A 1HMVA 2WOMA 3PW7A 4AFFA 4J7CA 4G76A 3OUYA
chains in the Genus database with same CATH topology
2OFGX 3VTIA 3DOMA 4DQPA 3M9NB 1T03B 1F5CA 2PE8A 2RUGA 3CVKA 1F2GA 5E0OA 1VQ8S 1QSSA 2GMHA 3KK1B 2EFNA 2KT5A 3CCTA 1Q82T 1LOUA 1QAIA 3PX0A 1FVSA 1WELA 2J9EA 1RT6B 4IH6A 5KFVA 4NCGB 2W8LA 2DGOA 4JI7F 2E1MC 1TQLA 3DRXA 2AGOA 1U26A 5KFDA 3I55S 2AGPA 2KM8B 1T7PA 2GQ2A 1LQ9A 2FUG1 1SUQA 1DTTA 4I1TA 2K1RA 3R27A 2LU1A 4P7TA 4Y2AA 3DA3A 5KFIA 5HMYA 2UXCF 3KLFA 3RB3A 5KFSA 5D4PA 2M7SA 1TL5A 4RNOA 5KG2A 4B9NA 2XSFA 4IUFA 2D9PA 5C24B 1YI2S 1KD1T 3EUNA 2J5AA 2OSQA 2ZNZA 4NLYA 3TO8A 4O3SA 1D9AA 2FPHX 3MOZA 4K4VA 1S9GB 2VFUA 1U47A 2W4DA 4EYIB 4RW4B 4ECTA 4G1PA 2ASYA 2CYYA 3K5LA 5KFCA 3RB4A 3AHPA 3K2YA 1VOMA 2EVZA 5CYQA 5FIIA 5B7WA 2IRUA 3DOKB 3RTVA 4JV2A 3AJ1A 1NHVA 4MK7A 4BHQA 4O23A 3OVBA 4ZVFA 3ZZRA 2E5LF 4DR6F 2CPZA 3BGFA 3MR5A 3EGZA 2E7XA 1FF2A 5CZVA 3IN5A 3DLKA 4TU9A 2GMLA 2YKNA 3DU6A 4TKTA 1ZYQA 4U7UK 3TQ1A 1QM9A 4Y65A 1UA1A 2HAIA 2DGSA 2YWKA 5D4OA 3ZZPA 5HL7Q 2RS8A 5DG9A 2MHEA 3BGLA 4NYZA 3CDBA 3MF5A 1YJRA 4OJHA 3OJUA 4OQJA 3OVAA 5F0WA 2EFPA 2DK2A 1QJHA 3HVWA 5A8KB 4Q0BA 3LGNA 2KXHA 3JSMB 2RNEA 4ZMMA 4YQWA 3MMAA 4MTPA 3TARA 2VKRA 3Q8QB 1V6HA 5A8RB 2UUAF 3I5CA 2YKQA 4YY3F 2YVSA 3C6UA 5C5JA 3W3SA 3MZIA 2L41A 5DGAA 3PACA 1IR0A 3MMCB 1U2FA 3AB4B 4XPCA 3JSRA 3DC2A 3H59A 5KFAA 4UY8T 3MMBA 4C7QA 4IFVB 2UUTA 1S6UA 5AE1A 2V5HG 2DGWA 2ZH7A 1UVNA 1HARA 3MECA 3HX9A 5DDOC 3SSRA 1XR7A 2HNYB 3E01A 3VF0B 2GHPA 3SFUA 4CQ1A 4N56A 2DIUA 1U6ZA 3WDOA 1HPZA 3K8WA 2OTLS 4DX8H 2LQ9A 5H9FJ 5L1JA 3M2VA 4NLDA 2XY5A 1JXLA 5F8LA 2W9BB 2ILZA 4NOHA 4RWXA 5H1SV 1HBOB 3GQCA 2GO8A 2JVOA 2CJBA 4XO0A 5J1PA 3IR6B 2DNZA 2L9NA 3P5TL 2JHEA 3HI9A 3M8PB 5CH7B 4MYUA 4IRKA 3SMZA 4ZLPA 4PXBA 1LWCB 1RISA 2B4OA 2OMLA 1WI6A 2LU2A 3PFEA 2UVWA 4FYDA 1P6TA 2XTRA 3SSSA 2I38A 2KFZA 2QRRA 4DQRA 1J5EF 4I2PA 1GXUA 2ZH6A 3MUVP 1JLAB 5E33A 4WYLA 3PJXA 2FJXA 1QAJA 2VA2A 1DLOA 5E2QA 1U09A 3J7YI 1X5TA 4MKBA 5H9EJ 2UUWA 3CUNA 2ZH4A 1JX4A 2KB2A 1D8ZA 2CPDA 2FIUA 1JB0C 4ZPWR 2OJ3A 3V4IB 4X4VA 2HIQA 3AJ2A 3PR4A 4QR0A 1HWIA 5SUHA 3FJ2A 3RBEA 3IO1A 3BN7A 1R6YA 3AY0A 3VZHA 2B0GA 2OPSA 4B08A 2C2EA 2XHWA 1Q81T 2WB4A 1KR4A 2BACA 3FRZA 1JLCA 3ITHA 1J5OB 4QZVB 3HK2A 1X4AA 4X4UA 4CNZA 4GMKA 2HGLA 3G8QA 2XSJB 4M63A 4V19X 4GKJF 1S9FA 1Y4ZB 3M05A 4DV5F 2FGCA 4TQSA 2BE2A 5JXSA 2FB0A 3M9OB 2D3OR 2V4JB 5EHHA 3QZ7A 3LW5C 5L9NA 2J6UA 1CG2A 3VQSA 2J7UA 1BWEA 3NAIA 4BDPA 2ROPA 2QYCA 2IBKA 1UETA 6FD1A 4ZCMA 1G2EA 2HNZA 3OR1B 1V3SA 2QO3A 1ZAWA 5LXRA 3KLEB 3CCZA 4FF2A 2PDAA 4CH7A 2OPPB 2J7WA 3V6DA 3ISND 1Q8IA 5IQ6A 1KTVA 4NA1A 2CPJA 1HW9A 4ED2A 3JB9k 2R4FA 4PG7A 3KMQA 4FXDA 5HROA 1H2VZ 1HNVB 4QYRA 3SQGA 7FDRA 5GAGU 2ZHBA 5KG7A 4KT0C 2QLWA 1UFWA 3D2WA 2P9CA 2AW0A 3I9V9 2M8HA 2Q43A 2EFVA 2WW8A 3QMQA 2R8HA 3U1LA 1VBZA 3H2LA 2R2SA 3LF0A 2FHMA 5J1EB 3TUJC 4TN2A 5GAEI 1QTMA 2F7VA 2YKAA 5DM6Q 4QQBA 1TFYA 1YWXA 2POKA 1WHVA 1HBUB 1RT2A 4I7FA 4OIXA 4D3HA 5C25B 3MR3A 2YKPA 4DQSA 1TKZB 3IWNC 3C66A 5KFEA 4DV6F 2JVRA 2LQJA 3MEEA 3OXLA 3RAQA 2AWZA 4FVMA 5DQHA 1SB6A 2WHOA 1UWBA 1N0VC 1JJ4A 2UVUA 1HNIA 2AX1A 3GSDA 5KFHA 4PG6A 2HFOA 1H3DA 2CJQA 2DO4A 4GC7A 4DL7A 1Q1KA 4AS2A 1DQAA 3VA9A 5I3PA 2BM0A 2Y1IA 3KKFA 5B0DA 4ECVA 2J76E 1U45A 2F9JA 3LUYA 4A46A 1S1XB 1TV6B 2DGXA 5LNK1 3R5CA 3SCKE 1TAUA 3KK3B 4DPOA 3W2VA 3M2UA 2D1CA 2NS1B 2D3ZA 4H4MB 2JSXA 1AXQA 3IFEA 2ZOMA 4CT8A 4O4RA 2G0CA 2P6SA 2XS5A 3BJYA 1QUPA 2Q6BA 2PMZD 5G0RB 4ECSA 2M2BA 2KXNB 3LQVA 2QSFA 3NMRA 4EO6A 1N88A 2XLJA 2LQBA 2QE5A 2RD5C 2O01C 2XBPA 4K5RA 4GO5X 2BXJA 2J6TA 4Q44A 1FA0A 2ERRA 2A2DA 2QA4S 1ZOTA 4NL5A 1UA0A 4KQZA 4NWBA 1YTYA 1CC7A 2MZSA 2PGCA 3NP5A 4DV2F 1N6QA 1M5OC 2DRAA 2B51A 5KG6A 2VL1A 6FDRA 3VAHA 2B5JB 4G6VB 4RX6A 4C8KA 1AW0A 2LXUA 3EZ5A 4LFBF 4F02A 5L1LA 3L95X 1NB7A 5KFJA 3K57A 5KFZA 4WU3A 1FNXH 1S10A 4WFZA 1M90T 4N8NA 2L9DA 2APOA 1S72S 2V9KA 5HBMB 2J7KA 3D1QA 1S6PA 3O44A 2F8EX 2J6SA 5C42B 1NK0A 1UVIA 5EWGA 4YOEA 1S6OA 5D4LA 1E6YA 5J2MA 2OAUA 5EDWA 2DCLA 2YH0A 1T95A 4ETXA 2LVWA 2BRLA 1TAQA 4N5SA 4ZPAA 3OL8A 1SH2A 4ZKAA 3I96A 3NGKA 4MKAA 3TVKA 3DLLQ 3EZUA 2MQQA 1XMBA 5CYMB 1IKVB 2IM3A 1VRTA 3HJFA 4NXNF 3AH6A 3EX7B 1NK8A 4MAKA 4C0BA 1VQ6S 2M5YA 2HNDA 4NPOA 1R8AA 3IG1A 1FHTA 4JCVE 2DHGA 3J7YU 2KZZA 4WFYA 2CPXA 1ZPVA 3MM5A 3ONQA 1RT1B 1TP7A 2L1LB 3LP2A 5E3QA 3GFXA 2GMJA 4G1QA 2XY6A 2ZKUA 1TL1A 2PIIA 3EXCX 1JLBA 3KHRA 2ZZMA 2NPFA 1LKZA 4MK9A 4PG4A 2MPUA 1BD6A 4IG3B 4UY85 5IT4A 5A2QY 4JI6F 2VC1A 4DOZA 1S1UB 2IM0A 2KHDA 3I0RA 4KFBB 2DNPA 3Q8SB 2R8IA 1KLNA 2FUG9 4I6WA 3DRRB 4RNFA 2XG8A 3VAMA 1R0AB 3K5NA 3LP0A 5D3GB 4U7CA 3V6JA 5HP1B 3FSIA 1FTRA 4Z7GA 4IFYA 2DPIA 2FHOB 1UVJA 1C1CA 5HMZA 2MJFB 4A8SA 1RTDA 1TKXA 2EK6A 5AJ3F 1N36F 4OL8A 3DDKA 2A2CA 5F8IA 3BO3A 2I2YA 4G3IA 1IKWB 4ECWA 4ZPTR 1WG5A 2VPYB 2JFKA 3PM9A 1TR0A 1YIJS 3IGVA 1XR5A 3MDFA 3OR2B 5KFWA 5T14A 2EFOA 2XS2A 3SEOA 1NHUA 2IRXA 3B8HA 3CXCR 5HLFB 1G6BA 1BQNA 1FD2A 4LJMA 2NUUG 1N34F 1I6JA 3O6QA 3CGIA 3SCIE 1QSYA 2XMWA 4HKQA 4WFAQ 3MD1A 1R89A 2YX7A 4KGKA 4XDDA 4PPZA 1KRPA 5EN1A 4I2QB 5M2PA 4G75A 1NK9A 1ZAVA 3HHLB 2D7SA 3AA9A 2DNLA 1X5SA 2LXFA 3E3XA 4Q2LA 3UI3A 3RU0A 3Q8PB 2WTFA 2AYBA 3KJVB 3CSKA 4DN0A 4JYAF 1FRIA 2HVIA 3CCVS 2BJDA 2RJZA 2KG1A 4DSEA 2OTJS 2WRMA 1GTEA 1JK9B 5EWFA 1Y3KA 4KE5A 2AU0A 3FDSA 1F5AA 2AF6A 2WONB 2MB0B 1BY9A 2FLNA 4JI0F 3EGNA 5K9FA 5T41A 1HI0P 2YKMA 2ZOGA 3N4WA 2BV3A 2F8MA 4MYTA 4F4WA 1Q79A 1BLUA 2RRBA 5T7LA 1GAOA 1YHQS 4YB5A 3CC7S 1LW2A 4RW6A 4HH1A 4CO5A 2U2FA 1AFJA 1S79A 2NSBA 2YNIA 1ZTWA 5LT5A 4OFZA 2QZ8A 4MIAA 3KLIB 3NBPA 4R8UA 2C2DA 1HWUA 3U1NA 3B4DA 2XLIA 1SJ1A 4QBUA 4WYWA 2ZM6F 1FDNA 1YG0A 4O3QA 1NAQA 4O1PA 4Y00A 1X4BA 3TW0A 1U8SA 1JWWA 5J2PA 4IRCA 4RWWA 2E29A 1K8AT 1IKXB 1WHXA 4W92B 4A47A 4LSLB 2QA1A 4Q9VA 1DZ5A 4LFAF 2RH3A 2JAEA 4M1KA 1JLFB 2W24A 3CULA 1JLQA 4O0IA 5KOWA 3GE9A 2DO0A 3FMBA 5CCLA 1S9EA 4TNOA 3J7A1 4DLEA 2VBZA 2B4PA 3I0SA 2V8VA 1REVA 1S6QB 1VC0A 3S6EA 1KLMB 4DQQA 3SV3A 2YNFB 2KT3A 1V3RA 3M2RA 4DG1A 3DI6A 2J8AA 4ZS6A 2FLPA 1H0HB 1ZM4A 4ICLA 5IXUA 1FEHA 1GX5A 2RQKA 4BS2A 3U02A 4WZMA 4MIWA 1IXKA 3EPIA 1L3VA 2LMIA 2EFGA 5DQGA 3N9UC 1Y7PA 5K14A 3UITA 4HTIA 3HHEA 2MMYA 1FJCA 2PFFB 5B0AA 2MZQA 2LA4A 4B3MF 1PC5A 3OL9A 2EPIA 2B4VA 4G1IA 4JI1F 1OSCA 2ABYA 2R2UA 1CLFA 3THPA 1ZETA 3IS9A 1GXLA 2C3PA 3H5XA 3GFZA 3IC1A 4X4PA 1Q78A 1NK7A 2FLOA 1C0UB 3BGRB 5HI7A 5DETA 3TAMB 3LWMA 5LMNF 4N47A 1S0OA 4RW7A 2VG6A 3BM7A 3AB2B 2CQ1A 5IM0A 2CPHA 4AL7A 4OHXA 3JTOA 3I5AA 4KTQA 2CQHA 3CD5A 3CJKA 3OJSA 1N8RT 2C3UA 3B4MA 4MK8A 3I9V1 3MWBA 3PRBA 4JV0A 2KKHA 1TK8A 3UDLA 1JNZB 2FTRA 2JZ5A 2NUHA 5DDQC 3DLHA 3OL7A 1DFDA 2ZE2A 4ED3A 1HQEA 3M32A 1YRTA 3MM7A 4EBCA 2Z0GA 4RU9A 3JTPA 2VPWB 2DJWA 4HT7A 1N56A 4DV7F 2YNGA 2VH7A 2YNHB 3D0IE 4H4OA 1IUJA 4WCEQ 1GT8A 4ID8A 2R7VA 4TXSA 2CIMA 3SCLE 2JFDA 2K3KA 1FD8A 3G6XA 4A8OA 2XTQA 4Y3CA 5KOXA 3LOUA 1EETA 1FKOA 4Q45A 2Q6CA 4A8KA 2BDPA 4EU0A 4IH7A 4TU8A 4ZHRA 1U24A 2GQQA 1DQ8A 4EZ6A 1J2VA 4TYAA 3AQOA 3CIMA 4KHRA 2ADCA 3P96A 5BJRA 2MGZB 2JEGA 2P9GA 3DOLA 4YMEA 3IRWP 1APSA 3RR8A 1HWLA 2FLLA 2YWFA 3FQKA 3ZZTA 3MR6A 4E98A 5AE3A 3TA1A 4KO0B 4Y2MA 1FJEB 1FERA 1X4FA 4AL6A 4WF9Q 3DM2B 4PXDA 4LSNA 2FC8A 1XK8A 1RYSA 2OPRB 4NRTA 1S1VA 3UFCX 2M3DA 5KFOA 2M52A 2PSZA 4RBUA 2MKKA 3CCJS 4UUXA 2ASDA 1K1SA 2D41A 4OI2A 2DH9A 2FVRA 2EC0A 2GIQA 2N82B 5HN0A 4HL9A 3OTOF 4OX8A 2H9ZA 3TA2A 5GAHU 5A6WA 4I4BA 2YQ3A 4OV1A 3UE2A 1WEZA 2VPZB 3QGGA 3U7JA 3I6PA 2WBMA 1RKJA 4I67A 1YO7A 4LQ9A 2JC1A 2HG4A 4N8OA 2J0QD 1DTQB 2CQ3A 3D1HA 1YJTA 3SDEB 2PT0A 2XWXA 1VQSA 2WAQD 1WF2A 3SYZA 1XERA 4NV2A 1UEUA 4LIWA 5F9NA 1U2RA 3UR0A 1T05B 4RW8A 1JLGA 3KK2B 1BQMB 1LK7A 4NZ6A 2C28A 1S9GA 5HO4A 1UFLA 1IBKF 1NEEA 1HI1A 4RW4A 3RAMA 2VODA 3PEJA 2GX8A 4XPEA 4RNNA 3MM8B 2KJWA 4DLGA 5LSLA 2M4MA 1LWFB 2BQUA 2RDIA 2XGPA 1M5KC 1SKSA 4FNHA 1XNQF 3I4PA 1HNXF 3LP1B 1PO6A 1UL3A 3D0GE 4WE1B 1VMBA 4O3OA 3S01A 3K5PA 4URQU 1Y00A 4ZVGA 4C8MA 2K3IA 3TVYA 2YX4A 5KT6A 1UKUA 5I3UA 2XMUA 2FVSA 1C4AA 2I5JB 1NK4A 2KHCA 2PO4A 1KFSA 1OS5A 4IQMA 3UCZP 5A8KA 3BQ2A 2XMJA 4Y6IA 3PKMA 4H4KA 5LSRA 3F41A 1FTCA 4PXCA 3NS6A 2B6AB 2FHKA 2YWHA 4RW9B 5KG1A 5GAGI 1H2TZ 1Z1ZA 1QY7A 1FESA 1RKIA 1SV5B 4Y2CA 3BSAA 3DRYA 3V2UC