2RADA

Crystal structure of the succinoglycan biosynthesis protein. northeast structural genomics consortium target bcr135
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
403
structure length
403
Chain Sequence
NQIAKWLEAHAKPLKTTNPTASLNDLKPLKNMVGSASIVGLGEATHGAHEVFTMKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKGNPSQHLTPVFKTKEMLDLLDWIRQYNANPKHKSKVRVIGMDIQSVNENVYNNIIEYIKANNSKLLPRVEEKIKGLIPVTKDMNTFESLTKEEKEKYVLDAKTISALLEENKSYLNGKSKEFAWIKQNARIIEQFTTMLATPPDKPADFYLKHDIAMYENAKWTEEHLGKTIVWGHNGHVSKTNMLSFIYPKVAGQHLAEYYGKRYVSIGTSVYEGQYNVKNSDGEFGPYGTLKSDDPNSYNYIFGQVKKDQFFIDLRKANGVTKTWLNEQHPIFAGITTEGPDIPKTVDISLGKAFDILVQIQKVSPSQVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the succinoglycan biosynthesis protein.
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Biosynthetic protein
molecule keywords Succinoglycan biosynthesis protein
total genus 127
structure length 403
sequence length 403
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05139 Erythro_esteras Erythromycin esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.30 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) Biosynthetic Protein domain 2radA03
3.30.1870.10 Alpha Beta 2-Layer Sandwich EreA/ChaN-like, small alpha-beta sandwich EreA-like; domain 2 2radA02
3.40.1660.10 Alpha Beta 3-Layer(aba) Sandwich EreA/ChaN-like fold EreA-like (biosynthetic domain) 2radA01
3B55A 2RADA 2QGMA
chains in the Genus database with same CATH superfamily
4JCVE 2BL8A 2XMXA 2FUG1 2JAEA 4OAVB 4AS2A 2FU2A 3SDJA 4AS3A 3LJ0A 2A2CA 4YZ9A 4G75A 2QZGA 4PL5A 2JB1A 1JQOA 4O1OA 4OAUC 4PL3A 2RLDA 3LJ1A 3DO9A 2JB2A 3VA9A 4NV2A 1YO7A 1W3SA 2MJFB 4O1PA 2JBWA 2F6MB 4Z7GA 2RIOA 2BL7A 2P22B 4U6RA 2E8GA 3I9V1 4HFVA 4PL4A 2JB3A 1SJ8A 2V6EA 2XTQA 5LNK1 3L0IA 3IAS1 4I1TA 4Z7HA 3P23A 3KP9A 2RADA 3AJFA 3LJ2A 3IAM1 5HGIA 4YZDA 4YZCA 1U5KA 2L1LB 3DA3A 3FBVA 2CAZB 3UITA 4DWLA 2HGKA 4G76A 2XTRA 2V1CC 4NV5A 2F66B 3F4MA 4HEA1 2ZRRA 2ETDA 2IP6A 3JSBA 3Q8DA 2GSCA 2QGMA 3FVVA 2QSBA 2YFBA 3B55A 2YFAA 3DA4A 2ZW3A 3FNBA 4Q9VA 2KKMA 2K19A 2A2DA 1TDPA 2FEFA 4GXTA
chains in the Genus database with same CATH topology
3B55A 2RADA 2QGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B55 A;  2RAD A;  2QGM A; 
#chains in the Genus database with same CATH topology
 4JCV E;  2BL8 A;  2XMX A;  2FUG 1;  2JAE A;  4OAV B;  4AS2 A;  2FU2 A;  3SDJ A;  4AS3 A;  3LJ0 A;  2A2C A;  4YZ9 A;  4G75 A;  2QZG A;  4PL5 A;  2JB1 A;  1JQO A;  4O1O A;  4OAU C;  4PL3 A;  2RLD A;  3LJ1 A;  3DO9 A;  2JB2 A;  3VA9 A;  4NV2 A;  1YO7 A;  1W3S A;  2MJF B;  4O1P A;  2JBW A;  2F6M B;  4Z7G A;  2RIO A;  2BL7 A;  2P22 B;  4U6R A;  2E8G A;  3I9V 1;  4HFV A;  4PL4 A;  2JB3 A;  1SJ8 A;  2V6E A;  2XTQ A;  5LNK 1;  3L0I A;  3IAS 1;  4I1T A;  4Z7H A;  3P23 A;  3KP9 A;  2RAD A;  3AJF A;  3LJ2 A;  3IAM 1;  5HGI A;  4YZD A;  4YZC A;  1U5K A;  2L1L B;  3DA3 A;  3FBV A;  2CAZ B;  3UIT A;  4DWL A;  2HGK A;  4G76 A;  2XTR A;  2V1C C;  4NV5 A;  2F66 B;  3F4M A;  4HEA 1;  2ZRR A;  2ETD A;  2IP6 A;  3JSB A;  3Q8D A;  2GSC A;  2QGM A;  3FVV A;  2QSB A;  2YFB A;  3B55 A;  2YFA A;  3DA4 A;  2ZW3 A;  3FNB A;  4Q9V A;  2KKM A;  2K19 A;  2A2D A;  1TDP A;  2FEF A;  4GXT A; 
#chains in the Genus database with same CATH homology
 3B55 A;  2RAD A;  2QGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...