2V1CC

Crystal structure and mutational study of recor provide insight into its role in dna repair
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
234
structure length
229
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINATION PROTEIN RECR
publication title Crystal Structure and Mutational Study of Recor Provide Insight Into its Mode of DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
total genus 52
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02565 RecO_C Recombination protein O C terminal
C PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2v1cC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2v1cC01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v1cC03
2R7ZH 5C4XH 1VQEA 2JQOA 1FJGQ 3CQZH 3NEMA 3I2ZA 3PUXA 4JI2L 5GQOA 1EUJA 4PG3A 4LF5L 2JA7G 2PQAA 4DPGA 1OXSC 5C44H 1G51A 4O2DA 4A3IG 1UEBA 1HR0Q 3GTQH 3L0OA 2ID0A 1PH4A 4JI5Q 3GTOH 4A3EH 3I4MG 1SMXA 4QL5A 1L2FA 2KBNA 3HOUG 2MO1A 1Y1WG 1VQ5A 1HNZL 1SRUA 4A76A 2Q2UA 3CCVA 5IYDH 4YCVA 4LF4L 5IYBG 2D62A 4WJ3M 2AHOB 4YY3L 2VL6A 3ULPA 1CSQA 1UE6A 4MNOA 2Q2HA 3PCOB 4X66L 4AIMA 1WYDA 3PIOA 1VQ4A 2JEAI 3S2HH 2VQEQ 1JJ2A 4DK3C 4NXML 4PZ8A 2I0QA 4LF6L 4IOAA 1VQ6A 2VQFL 5LMUL 1AE3A 3UDIA 5IWAL 4LF5Q 1K0RA 3E9IA 2D0OA 1KHIA 4UPAA 4DV6Q 1CUKA 3AYHB 2Y0SE 3J81c 4JI1L 3E9HA 3K7UC 4UP8A 4DKAC 3HKZG 1PH2A 1CKMA 2ZM6L 3T1HL 4R4OA 3RLOA 5C0XG 1HNZQ 1ASYA 2ES2A 1QVCA 1E22A 1GVPA 3J7A5 1IBLL 4OO1G 1VQGA 2R7FA 3PGZA 4LF4Q 1I3QH 2Z6KC 4YY3Q 4X6AH 3I7FA 2Z6KA 3GTGH 4A93H 4X66Q 2VW9A 2UXCL 2DUDA 4Y52H 1PHJA 2AKWB 3HOVH 3STBD 3K8AA 4R4QA 2VS1A 2BH2A 2XTIA 5IE8A 1D7QA 2WB1E 3OW2A 1Y1VH 3WWVA 3PUYA 4LF6Q 1WFQA 2VQFQ 4AYBE 5LMUQ 1Q82C 2VUMG 4H02A 2A1AA 2EQSA 4EQ5A 3KYHC 4POFA 2B3GA 2IHFA 4QJFA 4JI1Q 1EQQA 1H95A 3J7ZC 1VQ8A 3PO2H 2ZM6Q 2K52A 2GVAA 3T1HQ 4A3CG 1X3FA 1VQCA 2HQLA 1E1TA 2OQ0A 4DR1L 1VS0A 3RN2A 4DV5L 3F2BA 1XNRL 4MZ9A 5M3MG 1S40A 4OWWB 3HOWH 1SLJA 2ALYB 4KHPL 2L15A 3RZDH 3PO3G 4OX9Q 1XMQQ 3K0XA 1KIXA 2UXCQ 1PH7A 2LSSA 1PFSA 4DV3L 2R7DA 4GN3B 4ME3A 1OXTA 2XGTA 3MEFA 4DR2L 3U58A 1Z47A 3OTOL 5C0XI 1XPOA 1QVFA 5GROA 4DUYL 1Z9FA 4LW1A 1VQAA 3T1YL 3FHWA 4JI7L 1DGSA 4BA2I 3AQQA 4IPHA 1G291 4GOPA 1P8LA 4ALPA 4AQYL 3KDFA 4QQBX 1PYSB 2K4KA 2YTXA 4BY7H 2JA7H 4L5TA 5FJ8G 4IFDG 4JC0A 1QZGA 4QGUA 3GTJH 1O7IA 4A3IH 4DR1Q 1EWIA 1Q1EA 1RIPA 4DV5Q 5FLMG 4KHPQ 3I4MH 1PYBA 2FXQA 2Q2TA 4DUZL 2MNAA 3HOUH 4JI8L 1HH2P 5LMNQ 1Y1WH 1TWCH 4QY7A 4JBJA 4X65L 4DV3Q 1YJ9A 4A4IA 3CPWA 5IYBH 4JYAL 4DV0L 3B6YA 1X6OA 1BBWA 3EN2A 3I4OA 4A3FG 2PNHA 1V43A 5J3BA 1CKNA 4JI7Q 1OXVA 5M5XH 4WJ4A 3HOXG 1X54A 1PH8A 1C7YA 2E2HH 4B3SL 3BZCA 4RG1A 4JCVE 4GKJQ 1KQSA 4K0KL 3TS2A 1A0IA 4DR6Q 1A8VA 2ZTEA 1YITA 5FLXc 1QZHA 2JA6G 4MTNA 4DR5L 1C9OA 1CKOA 3I55A 2R92G 1BBUA 3CF5A 1V1QA 2IT1A 3E0EA 5GADC 3KDFB 2OWOA 3S1NH 4DV7L 3K81C 4X62L 4DUZQ 1OXXK 2AWOA 2I5HA 1N34L 2E5LL 1XNQQ 3KF6B 2UUAQ 2JEBI 5BR8L 3L2PA 3DM3A 2KHJA 3BJUA 5GAHC 1L1OC 4IFDI 4LNQA 2R93G 4JYAQ 5IT9c 1WCMG 2K50A 1PH6A 1L1OA 1X9NA 1LM0A 4DR7L 2YTYA 1MJCA 1JB7A 1XJVA 2WP8J 2HIVA 1X65A 4A3LG 5LMNW 3J81j 2IHEA 2LXKA 4DV4Q 4R4TA 5C0XJ 1XPRA 1YNXA 4B3SQ 4P72A 3J80i 2WAQG 4P75A 4K0KQ 3U4VA 1I6HH 2A19A 2K5HA 2MO0A 1S72A 2NVXH 4UY8C 3M3YH 3ULJA 2VUMH 4RMFA 1XPUA 1C0AA 1VQDA 2AMCB 4DR5Q 1A63A 3NBHB 3A5UA 3CCJA 2VY3A 5IYCH 3PIPA 1TWFH 4LUVA 2ZTCA 1Q7YC 3G71A 4GNXC 4IPCA 3S1MH 4O0AA 4KLKA 2QEXA 4NXNL 3KJPA 4DR3L 1PH5A 4GNXA 3M4QA 3CCLA 3FKIH 5BR8Q 4A3CH 1X56A 3ULLA 2Z0SA 2ASBA 1VQ7A 4LFBL 2C35B 1E24A 5M3MH 3PO3H 3HOYG 1TWAH 4DR7Q 2D0PA 4JG2A 2MQHA 4BXXG 2HIXA 3F2DA 4LF7L 4B3RL 2JA8H 4JI2Q 5M5WH 2PI2E 3RLNA 4QIWE 4DAMA 1L1OB 1Q12A 3PUZA 3F2CA 2JA5G 4LF8L 3S15H 4NPSA 2QGQA 2KCTA 3K80C 3PV0A 4JI6L 4C2MH 1MJEA 4BA1I 3PSIA 3HOZG 3M4OH 2PQAB 1FGUA 2UU9L 1P16A 3MXNB 4IO9A 1M90C 1HR0W 2N8NA 3CCSA 4DR3Q 5FJ8H 4JI4L 2YV5A 3CD6A 5IP9G 1GD7A 2LXJA 5ELOA 1I50H 2UUCL 5FLMH 2K14A 4TQUS 4JI3L 3HKZE 2Y0SG 1AH9A 3UE1A 1Q8KA 4P74A 4APVA 4FDBA 4BBRG 3A5ZB 5AJ3L 1VQIA 1YJWA 4NXMQ 4YCUA 3W1GA 2GVBA 2CCZA 3G48A 4IFDJ 1PH1A 4IOCA 2PMZE 3AFQA 1QUQA 1IBML 5IWAQ 4A3FH 2YU9H 4L5QA 1JE5A 4A3MG 3PUWA 1K83H 3L7ZC 1KAWA 1UWVA 3HOXH 2EXDA 4IPDA 5M3FG 4JI0L 3Q8DA 2NN6G 2PI2A 2HT1A 2N78A 3GTMH 2WB1G 4OONA 4JV5L 1EOVA 4AH6A 2JA6H 1IL2A 4A3BG 1IBLQ 4AYBG 4JI4Q 2R92H 5HY6A 1SROA 3GDEA 3UDFA 1JT8A 2UUBL 3CW2C 5C3EG 2UUCQ 3CMAA 1R9TH 1YZ6A 3I4NG 4OWTB 3TRZA 4L5SA 1E1OA 4OO1I 2ZJQA 1X3GA 2IX0A 1K3RA 2YTVA 5IP7G 2Q2IA 1L0WA 1WCMH 2R93H 1LYLA 4GOPC 1IBMQ 5JEAJ 1GM5A 1HZCA 5DLQE 4A3GG 4A3LH 4YCWA 3TEHB 3RNUA 3K7AH 3A0JA 1J6QA 4TVAB 1Q1BA 5M5YH 1SE8A 1Q81C 4JI0Q 3G6EA 3U50C 1E3PA 1KRTA 1IXRA 2I5MX 4GKKL 4JV5Q 1VCIA 3RN5A 4PMWA 1XNRQ 2N3SA 1U0LA 1HZAA 1A62A 1K9MC 2IX1A 3TREA 1ASZA 1U5KA 5C4JH 3S24A 1SN8A 2CFMA 2NN6I 3TQYA 4YWMA 1B8AA 3AFPA 4DR2Q 3OTOQ 2K5NA 1NY4A 1EFWA 3RZOH 1VQBA 3KJOA 4HIOA 1I94L 1VQJA 3SGIA 3CC2A 4DUYQ 3PF4A 3KFUA 2A8VA 4B3ML 1HNWL 3T1YQ 4OWXB 2HHHL 3HOYH 4A3KG 2KHIA 3ZJYC 5GAGC 4OXPA 2NVTH 3KF8B 4AQYQ 2UXBL 1N32L 3G4SA 3GD7A 4XTCS 2JA5H 2I5LX 1J5EL 1RL2A 4C3IH 3S17H 1VQHA 4GKKQ 4GOPB 2E2IH 1B7YB 4A3DG 3U4ZA 3S1RH 1OXUA 4C3HH 1Y1VG 1YI2A 3HOZH 2B29A 4JI8Q 2EIFA 4DV1L 4B3TL 4IJHA 4X65Q 2N49A 3FP9A 3EBEA 4A3JG 5EAYA 5IP9H 4DV0Q 2F4VL 1X3EA 1LTLA 2BH8A 3CC7A 1KXLA 4JOIA 2RHSB 1T9HA 1YHAA 1YVCA 1HNWQ 2MFIA 2HHHQ 4LWCA 4KI0A 4BBRH 2E8GA 1HR0L 1UE5A 3CC4A 1N36L 2GN5A 2UXBQ 3S16H 3M85A 2RF4A 1N32Q 1CKNB 3JC66 4YWKA 4DK6C 1YJNA 1J5EQ 4A3MH 3HFZB 3UDGA 1EIYB 4DV7Q 1N9WA 4X62Q 5M3FH 1N34Q 1HJPA 2E5LQ 5H1SE 2AWNA 4DV1Q 1NMGA 4B3TQ 2JK8A 1V9PA 5IY0A 2VQEL 3CPFA 1NBWA 2QA4A 1Q86C 4A3BH 4POGA 3KOJA 2F4VQ 2YYZA 3ERSX 5C3EH 1KD1C 1N33L 4BY7G 1YBYA 2ZTDA 3I4NH 2ZJRA 4GLXA 3S14H 4DV6L 4HJ9A 2OCEA 4NB3A 3NELA 1YHQA 1G6PA 1E7ZA 5IP7H 4HIDA 4HJ7A 4BY1G 1N36Q 2NVYH 1Q46A 3GTPH 4UP7A 3W5OA 1VQFA 1IZ6A 2BA0A 2ZJPA 2NVQH 4LF9L 3ER0A 4A3GH 1WJJA 3PF5A 2CKZB 3CP0A 2BA1A 3HKSA 3M4PA 3CCMA 4NXNQ 1EYGA 3DLLA 3OYYA 1YIJA 4GN5A 4R1JA 3H15A 2B63G 2CWPA 4LFBQ 1YEZA 3H0GG 2KENA 1NJIC 1MKHA 3AEVA 1N33Q 4GNXB 4B3RQ 1VQLA 1VQKA 4LF7Q 1KRSA 1VQPA 3BZKA 3H3VI 2OQKA 3CCQA 3W1BA 1PH9A 4L5RC 1PVOA 1HZBA 1XTDA 4DV2L 2NZHA 1PV4A 1WOCA 4GS3A 1HNXL 3J80c 4LF8Q 3KLWA 4GN4B 4DR4L 2H5XA 1TXYA 1NTGA 3GTLH 4A3KH 1EQRA 4JI6Q 3CCUA 4BBSG 4LF9Q 4A75A 4YHHL 4KHZA 4P73A 2UXDL 1VQOA 2UU9Q 1Y14B 2R7ZG 5C4XG 3S1QH 4OX9L 2ATWA 1XMQL 3M9BA 1IBKL 3F8TA 4JBKA 3GTKH 3JAMi 4A3DH 4HJ5A 1FL0A 4LFCL 4R4CA 4C3JH 4HIKA 5ELNA 4HJ8A 5E7NA 2F3IA 4JI3Q 4UP9A 3CCEA 1KC8C 3M7NA 3GO5A 5AJ3Q 5C44G 4GLVB 1TWHH 2KCMA 3NENA 3I56A 5K36G 2VNUD 4A3JH 1CSPA 5GAEC 2K75A 4A3EG 4X64L 5JJLA 1I5FA 5IYCG 2RCNA 1W3SA 1X55A 3D31A 4DV2Q 1HNXQ 2IY5B 5JJKA 4DR4Q 4EX5A 3F1ZA 5JJIA 5IYDG 1VQMA 4YWLA 2CQOA 3FKIG 1FVIA 1AE2A 2F52A 4YHHQ 3UE0A 1QUQB 1VQ9A 2OTLA 2UXDQ 1GO3E 1MIUA 4JBWA 3CCRA 4JBMA 3STBC 5LMNL 3S2DH 5HGQA 1IBKQ 2WFWA 4IJLA 2E2JH 2UUBQ 4GLAC 4LFCQ 2JA8G 4LFAL 3BU2A 1M1KC 3CMEA 1IYJB 3H3VH 1D8LA 3VDYA 1JMCA 2V1CC 1SFOH 4GKJL 2NZOA 4X64Q 4DR6L 3RLFA 1K73C 1LUZA 1N8RC 1PA6A 4BXXH 3KF6A 1NE3A 3ICEA 4J15A 1YHBA 4DAYB 1UE1A 1SR3A 2JE6I 1BVSA 1TWGH 2DGYA 1VQNA 4IPGA 3A74A 2JJQA 4HIMA 4BY1H 4A93G 1XNQL 3HOVG 2UUAL 1S3OA 1XMOL 1K8GA 4LUOA 1JJCB 1UE7A 4XIGS 3CXCA 4R4IA 4LFAQ 4Y7NH 2RHQB 3JAMc 3LGJA 4PZ6A 1OTCA 1BKBA 1FJGL 4LUZA 4JOIC 2B63H 4DV4L 1K8AC 1I94Q 1EIFA 4HJAA 2CWAA 1JJGA 3H0GH 4B3MQ 3PO2G 3J81i 2R6GA 3RR5A 1HZ9A 3IRBA 4JI5L 1W2BA 3HOWG 4DNIA 1B70B 1GKHA 1QVGA 5JEAG 1PH3A 3D0FA 2VZAA 1WI5A 2K5VA 1NMFA 3PUVA 1KL9A 3EIVA 2WAQE 3UDXA 2JA9A 1XMOQ 4PZ7A 4BBSH 4P71A 3TS0A 2OTJA 3CAMA
chains in the Genus database with same CATH superfamily
4HMJA 1DOKA 1MHWC 5HI7A 2K19A 3NEMA 1GUGA 3DHQA 4JI2L 5GQOA 1PTOC 4CDCC 4LF5L 4IUQA 2PQAA 3OOCA 4DPGA 1U4LA 2NYZD 3NTHA 5A2QE 1NSNS 1JWMD 2PO4A 2B0UC 4TSSA 3I4MG 1Y1WG 2EPBA 4A76A 1FY7A 1MT1A 4YCVA 1LT3D 1WGCA 2AHOB 4G7ZC 3HZXA 1V1HA 2JEAI 5HGTA 2F3VA 2VQEQ 2WIIB 2RIJA 2I0QA 2EYHA 4IOAA 2VQFL 3FDTA 3E9IA 1TR5A 1KDAA 1BR9A 1KHIA 4CDFC 1EEFD 3K7UC 4OL7A 4DKAC 2XRSD 3RMHA 3HRZC 1QVCA 1GVPA 2ZRRA 3PGZA 1I3QH 4YY3Q 2EE1A 1IW7C 3MTSA 2UXCL 2DUDA 2BH2A 1XX8A 2HDMA 2XTIA 3BVZA 1D7QA 5EQ0A 5E1FA 1LT6D 1Y1VH 3WWVA 4LF6Q 5HGIA 2KKMA 2ENBA 1SMYD 2A1AA 4X3KA 3SE0A 2EQSA 1NR4A 3KYHC 2JA7B 2FNFX 2F0LA 3GTJB 1YO7A 4QJFA 4JI1Q 1H95A 1JICA 1PFNA 3T1HQ 2RSNA 1X3FA 2OQ0A 1E1TA 4DV5L 3F2BA 5FUVA 1S40A 1EY9A 5M3MG 5C4JB 3HOWH 1SLJA 3Q23A 1I4RA 4OX9Q 5JEAH 1XMQQ 2B2WC 5CBAE 3RZOB 2B2WA 4OEMB 3MEFA 2RVLA 1Z47A 2CW0C 2J0TD 2K32A 2ORWA 1YNJC 3TDQA 1J9OA 1FNUA 3ONAB 2EXZA 3AQQA 4BA2I 1G291 2OF1A 4GOPA 3KDFA 1PYSB 3AU7A 1HQMC 2YTXA 5NUCA 4IFDG 1I4HA 4JC0A 1O7IA 3DMUA 3KBXA 4DR1Q 1S5ED 1AZPA 2AQ1B 4HEDA 1YNND 4KHPQ 2MNAA 2QDLA 4DV3Q 2Q8RE 1HCZA 4A4IA 2IPKD 3I8ZA 1UNSA 4DV0L 1X6OA 4A3FG 5J3BA 5EKIA 3TP8A 1OXVA 1J8IA 4H0LC 2E2HH 1PH8A 4PQXA 5DEHA 3BZCA 1QE6A 4WJWA 3M3YB 2HQEA 1A0IA 3FRPB 1G6ZA 1QZHA 1PTOD 2RBMA 2A68C 3I55A 1TUSA 5M3FB 3CF5A 1OMTA 5E4XA 5IGEA 3E0EA 5GADC 2OWOA 3S1NH 2DY7A 2I5HA 2AWOA 4XDXA 1A3VA 4H7BA 4DUZQ 1N34L 2UZ3A 4YZDA 3L2PA 5GAHC 5A35A 4IFDI 3FSYA 3P75A 1LM0A 4DR7L 4A24A 1MJCA 3SDZA 1XJVA 3OSOA 3FSXA 3PQIA 1Q8IA 5KIXA 4R4TA 1XPRA 2RDHA 4B3SQ 2ZXRA 1F77A 4P72A 3J80i 5FLXL 3SGQI 3U4VA 2NVXH 2MO0A 4QUCA 4RMFA 1XPUA 3SHLA 4FO2A 2E73A 5IYCH 1CQFA 4LUVA 4K5WA 4IPCA 4KLKA 3D8GA 1UHAA 4DR3L 1WTRA 2CVRA 2KJXA 1X56A 2SNMA 2ASBA 5E3PA 2RC4A 1BMOA 1E24A 1DJRD 2R61A 1IW7D 2D0PA 3I72A 4BXXG 2HIXA 4YZCA 1FARA 2JA8H 2PI2E 3BVGA 3F2CA 1Q12A 1BF4A 3PUZA 3S15H 4C3IG 3MFYA 1S20A 3PV0A 1MJEA 2KUMA 4BA1I 4C3HG 1QB5D 2UU9L 1P16A 1M90C 3GTKB 2N8NA 2B39A 4PMCA 3CD6A 1W4RA 2NU3I 2KQ3A 3FEWX 5LNK1 3IAS1 4BBRG 5AJ3L 5I9PA 4A3JB 2R93B 3D6CA 1WCMB 3K5LA 2GVBA 2CCZA 4IFDJ 1DS3I 1PH1A 3A55A 1GUTA 2YU9H 4L5QA 2F3WA 1STGA 3G7LA 1YNJD 2WAQB 1K83H 3TP6A 3HOXH 1R79A 3Q8DA 2NN6G 3GTMH 2N78A 1EOVA 4AH6A 5TSSA 2JA6H 1IBLQ 1AN8A 4AYBG 2SEBD 2R92H 1BCPB 2K7VA 3UDFA 2O5IC 1PTOH 2SNSA 4OAVB 4DAPA 5FO9B 2UUCQ 1SE4A 2L8EA 1G2SA 1K8OA 1I6HH 1IKMA 1X3GA 2IX0A 2ROWA 3GOXA 2Z9HA 1L0WA 5JEAJ 3LX0A 1JC7A 3LNNA 5DLQE 4A3GG 3BJIA 1ENFA 3K7AH 5ELDA 3W2DA 3RNUA 1D5XC 1J6QA 4TVAB 3URYA 5M5YH 3G6EA 3U50C 1IXRA 3OMCA 2QQ0A 2A68D 4PMWA 1LLRD 1ESRA 1U5KA 1KDCA 2NN6I 4Z9CB 3TO9A 3OXLA 4YWMA 1F9SA 4ME5A 4A3KG 1I4PA 5GAGC 4UAIA 2ICEC 1EWHA 4AQYQ 3WDNA 5JHWC 2LEOA 5EKLA 1GHJA 1SJHD 3NXWA 4QMGA 5T1IA 4XTCS 2JA5H 2I46A 5CMDA 1VQHA 2E2IH 1B7YB 3U4ZA 3S1RH 3X3NA 2Q8IB 4XQQA 4M8AA 2JB1A 2EIFA 3HH2C 4WORA 3FP9A 4FF1A 4ABNA 1BOSA 3CKIB 5D3IB 4ZRZA 1AEXA 2BH8A 1A2TA 2HHHQ 4KI0A 4K8JA 3SVMA 4IUTA 1N36L 1EIHA 1YTPA 2RF4A 4YWKA 2F0GA 4OGQC 1SYCA 3UFFA 3UDGA 3E3XA 1EIYB 4DV7Q 3SK8A 2E5LQ 4EVOA 1ILQA 2AWNA 2YFAA 1EL0A 1V9PA 1Y8PB 5IY0A 1F2YA 4A3BH 5CYUA 2JN4A 2KA7A 2F4VQ 2F0QA 1DOMA 5C3EH 1KD1C 3WOFA 1CK1A 1N33L 3I4NH 2ZJRA 1I4XA 4CJ0B 2K5QA 4FF3A 3NELA 2ZW3A 3PDNA 4SGBI 3UOEA 3VA9A 4HJ7A 4KTAA 1OVOA 1VQFA 2NVQH 1I3QB 3ER0A 3ITPA 1P9GA 3SGBI 1VF7A 2DY8A 3CP0A 2G9HD 1CT4I 3LJ1A 3I70A 3H15A 1PXUA 1Y1VB 1STBA 4XYQA 2ETDA 3J7AV 4G7HC 2E5RA 4B3RQ 3FVVA 2K05A 1KRSA 3BZKA 2OQKA 4HSPA 3A8KE 1Q3LA 4AS2A 1XTDA 3KY9A 1UEAB 3J80c 4LF8Q 1HEVA 2EY1A 1K8MA 1SE2A 4BBSG 3HOWB 2AUJD 4KHZA 1V8QA 2OEOA 2R7ZG 1V1PB 4WFN3 2RDFA 4JBKA 1SGQI 3JAMi 4A3DH 4XQNA 4HJ8A 1L0XB 3P20A 2M00A 2F3IA 5E7NA 4UP9A 3CCEA 4XT1B 1ONLA 3TP5A 3I56A 3KLSX 2QKIC 1TVXA 2K6AA 3E59A 2RCNA 1X55A 4DV2Q 2RSOA 1KLUD 3MXUA 4I1TA 5JJIA 2CQOA 1B3AA 3FKIG 5C3WA 3OIQA 3UE0A 1XTCD 2TSSA 2LUYA 4LAAA 5LMNL 3S2DH 2EY2A 2WFWA 2UUBQ 4GLAC 4LFCQ 4LFAL 1VDDA 1D1KA 1PFBA 1D8LA 1NAPA 2E2HB 3MXPA 2F0OA 2MUYA 2ARPF 4GKJL 2NZOA 2LMCB 4DR6L 5FLXE 2HUGA 1K73C 4S3SA 2OVOA 1LABA 5E3RA 2ERWA 5FUWA 4J15A 2QW7A 1UE1A 5G3LF 1SR3A 3S1NB 1FNVA 1CHPD 2JE6I 4O1NA 1TWGH 4OIJA 4ZKCB 2JJQA 1LTID 2WKDA 3DA4A 1O80A 2UUAL 1U4RA 5C4XB 3Q22A 4PZ6A 1FJGL 4FYDA 2MHVA 4V190 1I94Q 1K8AC 5C44B 2NVXB 1ULKA 3ND9A 4N9TA 3PO2G 4WRDA 1KTKA 5LL6X 1F2MA 3IRBA 3MA2B 3T13A 5EBCA 3G6JB 4DNIA 1QVGA 2P6AC 1SYBA 5D65A 3D0FA 2VZAA 1NMFA 4HCEA 1GXDC 2L12A 1RKNA 1XXGA 2IP6A 2UVOA 2OTJA 5DNFA 2JA8B 2L9HA 3UGIA 4AMLA 1QILA 4KK7A 4K5XA 2SGDI 3I2ZA 3S15B 1EUJA 2JA7G 2K9HA 3MXNA 1OXSC 1HR0Q 1G51A 5JVG3 4A3IG 1X74A 1SNOA 1DONA 1EU4A 1TS2A 2QSBA 1STNA 4A3EH 1H9SA 2FINB 2SGEI 2F0JA 2J9RA 2NWGA 1B9NA 1HNZL 1SRUA 2Q2UA 3T53B 5CV9A 5IYDH 4LF4L 1HTLD 2A6EC 2D62A 2DKVA 4UXJA 1CE3A 3UGDA 5LHY1 1X32A 1UE6A 4MNOA 1BO0A 2Q2HA 3PCOB 4X66L 1WYDA 3PIOA 1G2TA 1SNMA 5IGBA 1JJ2A 4DK3C 1MJBA 2F0WA 4PZ8A 1GUSA 1JORA 1G91A 2V6EA 5LMUL 1AE3A 4LF5Q 3HOXB 2HD3A 3PMFA 2D0OA 2IL8A 4UPAA 4X3UA 1CUKA 2FMMA 2Y0SE 3IL8A 1DM0B 3E9HA 3HKZG 2ZM6L 2R92B 4R4OA 2L1LB 5L37A 1LO5D 5C0XG 5EJWA 4OO1G 1VQGA 3O13A 4IURA 4F87A 4A93H 1JQOA 1PHJA 3TO7A 4R4QA 2P5ZX 5IE8A 3OWEB 3OW2A 3CXLA 3PUYA 1WFQA 2VQFQ 2VUMG 4H02A 5M5YB 1FGBD 1EU3A 3HS0C 2DJFC 2K52A 3LJ2A 2GVAA 1LR8A 2QF7A 2HQLA 2BUSA 3RN2A 4OWWB 2ALYB 3QWNA 3RZDH 3FVQA 2RA4A 1KABA 3K0XA 2UXCQ 2H1EA 1PFSA 4GN3B 3U58A 3MWYW 1OXTA 4DR2L 3KF8A 3OTOL 5C0XI 1Z7KB 1QVFA 2JAEA 5M5XB 1GUNA 4LW1A 1HDLA 1TBOA 4LK1C 1P8LA 2N55A 5K5PA 1SSOA 4IZ8A 1RTOA 4QQBX 4O42A 3TOAA 2K28A 3DXJC 2JA5B 1STEA 2R3ZA 5DM73 2E2IB 4L5TA 4ZUJA 5FJ8G 1ILPA 2WCYA 3S1RB 1TQOA 2AUKA 4KY5A 4DV5Q 5FLMG 4Z7HA 4IQZA 3I4MH 2NU0I 2RCFA 1PCEA 1ESFA 2B2TC 1Y1WH 1HH2P 4F7XA 3C1EA 2B2TA 3VE5A 1YJ9A 1M8CA 3CPWA 4OAUC 3VDPA 1CSOI 4RHSA 1BBWA 3I4OA 3UI2A 1ZKOA 4R8IA 1P9ZA 3K5OA 1CKNA 5FKAC 4RG1A 4K0KL 3DWPA 1A8VA 1NCVA 2L7XA 4MTNA 4DR5L 4KN4C 3TZUA 1KMAA 2F0NA 3KDFB 5CCLA 4X62L 2CWGA 1CHQD 2JEBI 5BR8L 4HFVA 1L1OC 4PL3A 4LNQA 2R93G 4H44C 1U4PA 2A6ED 1WCMG 5IT9c 2K50A 1LTTD 1L1OA 3OWFA 4Q9VA 2WP8J 2HIVA 4NV5A 1HPTA 3SK6A 5M5WB 4OVOA 1QG7A 3J81j 1ZYRC 2IHEA 5C0XJ 2KEDA 1A6XA 2WAQG 4P75A 2KCNA 2K04A 2X6GA 3VA5A 5I6YA 2N17A 2NVQB 3PIP3 4C2MB 2C9OA 3M4YA 3ULJA 4R9WA 3QOLA 4FNFA 2VY3A 2ZTCA 5C6AA 5J39A 4GNXC 2QQEA 3S1MH 1ENAA 2QEXA 3KJPA 1CGJI 1RJTA 2A74C 4GNXA 1TS3A 2F6MB 3BVMA 4DFAA 4LFBL 5M3MH 3HOYG 1OO9B 1MJ9A 1UAPA 4DR7Q 2IX3A 3F2DA 4LF7L 5HURA 1SEBD 2JYYA 2KMPA 5DAEA 5JPMC 4KJOA 1STHA 3IAYA 1SGYI 2SDFA 1JWUD 2EJFC 4G4KA 3RUZA 1EY6A 1Y8FA 1F2ZA 3SK5A 1CA6A 4DNCA 1XWEA 3HOZG 2A5HA 3FBVA 3DEPA 2HGKA 4IO9A 1HR0W 1K0SA 4DR3Q 4JI4L 4IFDH 4FXKC 3K6OA 5IP9G 1GD7A 3VR2A 1I50H 2K14A 3HKZE 4FDBA 1B2TA 1BUVT 4NXMQ 4YCUA 1LTRD 5FO8B 4KJNA 1ULMA 4WP4A 2F0UA 3AFQA 1IBML 5IWAQ 4A3FH 1CHOI 1T5XD 3OPOA 2A6HC 4RKLA 3J81L 4A3MG 3L7ZC 5D14A 1R4PB 1A3UA 5FUXA 4JI0L 2HT1A 2V53A 4DXFA 3X3MA 1LR9A 2WB1G 4B9WA 3S2DB 1NUBA 1ULNA 3NBIA 1TY0A 4K2KA 3GDEA 4RKBA 4X3SA 3TSSA 1JT8A 1TBQR 3CW2C 1R9TH 1YZ6A 1SXTA 2I07B 4L5SA 5C4HA 5FO7B 4HMIA 3SDJA 1K3RA 1GUWA 1UUPA 2K5WA 4GOPC 2PCFB 3HGBA 1E0BA 4QF4A 3TEHB 2WACA 3CRLC 1OYVI 3R5BA 4N8FA 1LACA 1KRTA 1MSGA 2I5MX 4GKKL 1X3QA 1VCIA 1NUCA 3RN5A 1B44D 1XNRQ 4CJ1B 1HZAA 3W3AA 4UXIA 1ASZA 3RD4A 3KBGA 1PRTD 3AFPA 4I7ZC 2Z6BA 1NY4A 1VQBA 1IYVA 4DUYQ 3T1YQ 4CBVA 3ZJYC 2NTSA 1SYDA 2F0DA 2NVTH 3S16B 1ZYRD 3C1FA 5EBDA 5KNCA 5KYLA 4XQJA 1B9MA 3BDLA 1J5EL 1RL2A 1SDFA 4C3IH 4C3JG 1DZ1A 3I3CA 1OXUA 2RADA 1KAAA 1LTAD 1Y1VG 4C3HH 1HPCA 2B29A 4JI8Q 4DV1L 1YI2A 4RGNA 4X65Q 2YFBA 2EYPA 4JOIA 2RHSB 2ENNA 1YVCA 2BCOA 3S14B 1TS5A 3D3RA 2MFIA 4GI3C 4LWCA 4BBRH 3T16A 3P23A 2F0TA 2J4XA 3GQBA 3T51B 1YJNA 2G5DA 3HFZB 3FPPA 4JPBW 1PTOF 2NN6H 4JK1C 1ZXTA 2VQEL 2EYOA 2WINB 5CGKA 1EYAA 2CWHA 1BDOA 5ELCA 5E4WC 2GA4B 1C48A 5J1ZA 1UUCA 2OCEA 4PL5A 4J8QA 4NB3A 1YHQA 1E7ZA 5J22A 4HIDA 1N36Q 4BY1G 5J8FA 4EQOA 3VA7A 1Q46A 1EZ8A 4A3GH 3A7AB 2ZJPA 2A6HD 1WJJA 3S1QB 3R8BA 1FNWA 2NB0A 1Z6HA 3M4PA 1PDQA 4NXNQ 1Y1BA 4B08A 2ICIA 1EWCA 3OYYA 4GN5A 2B63G 2NBFA 3H0GG 3AEVA 1C4QA 1N33Q 2NU4I 1VQLA 1VQPA 2Y0MA 2D9UA 3H3VI 1QJOA 3W1BA 1PH9A 3T56B 1HNXL 1PV4A 1HQRD 3Q0AA 1A2UA 2F3CI 5BN3A 1RTNA 2KCCA 4DR4L 4ODGA 4A3KH 1X3PA 4JI6Q 4YHHL 2UXDL 2VB2X 2SGPI 5T1GA 1WTOA 5C4XG 2XIWA 4OX9L 2ATWA 1XMQL 5EX0A 2HCIA 3S9WA 4HJ5A 4HIKA 5ELNA 3Q6SA 4JI3Q 5EKKA 1KC8C 4UXHA 5KRUA 5C44G 1TWHH 4DAVA 3TZDA 4DAYA 2X69A 3MC0B 4C1NK 4X64L 5IYCG 3NE5B 3D31A 2CH4A 4QB4A 3F1ZA 4YWLA 4IUPA 4MIUA 4N8X1 2F52A 1QUQB 2MPMA 1Y1WB 3UGLA 1GO3E 2N1AB 1HTPA 4KKUA 2QILA 3NK9A 1EY4A 4IJLA 1WTXA 2E2JH 2JA8G 1M1KC 5KNBA 2RLDA 2K33A 2LFNA 1DYQA 4ID6A 2ELIA 4K2LA 1SGRI 1LUZA 1N8RC 2D2CC 1HA6A 5HQ8A 3OL0A 2V4DA 1YHBA 4XXEA 1JE4A 2QZGA 4KKTA 2KECA 4FP5D 1BVSA 4ZKBB 4IPGA 4RA8A 1VQNA 3HOVG 3R5CA 1S3OA 4LUOA 1JJCB 1UE7A 2M2LA 4MPIA 1FR3A 2ORVA 4LFAQ 3I4LA 3K59A 3LGJA 3NHHA 1BKBA 4LUZA 2QQCA 2H4OA 1EIFA 4HJAA 4NDXA 1JJGA 1CT2I 4B3MQ 1I4GA 4CHTB 1EY5A 2BL8A 2R6GA 4KN7C 5E3FA 4JI5L 3S1MB 2N71A 1GKHA 1EYCA 1CQVA 4LMQD 3PUVA 1KDBA 1KL9A 4BBSH 3L3OC 2JA9A 4CKEA 4PZ7A 3MAQA 3B55A 2MJ8A 2R7ZH 4ZAIA 3NQTA 1FJGQ 2F0IA 4XT3B 2LS01 3PUXA 1UVGA 1VDZA 4PG3A 4O2DA 1FD7D 3L0OA 2ID0A 3BDCA 3J81E 3GTOH 5EX3A 4PV1C 4QL5A 2KBNA 3HOUG 2MO1A 1VQ5A 1M8AA 2PW7A 1E2VA 4BS9A 1BNZA 3CCVA 4NMZA 1I50B 1CM9A 5IYBG 4WJ3M 2JP1A 1M4VA 3ULPA 2XRCA 1SGEI 1K3BC 4ZK9B 4H13C 3QTLD 4CDDC 1TKWB 5CV6A 3IFTA 1OMUA 4U673 2OU2A 1K0RA 1BCPC 2QQDA 2HCCA 4DV6Q 1CGII 4K14A 3AYHB 3V05A 3J81c 3NPPA 1WTPA 1S5DD 4UP8A 1PH2A 3EFXD 1HNZQ 3AB9A 4KD3A 1ASYA 3J7A5 2KMQA 1E22A 1IBLL 2R7FA 4LF4Q 3Q24A 3I9V1 1VF5C 4X6AH 3A8JE 3BYTB 4X66Q 2VW9A 4Y52H 1I4QA 4DNTB 2VXWA 3K8AA 1EZ6A 4ZYSA 2FU2A 3D6WA 3KLSA 2AQ2B 1PLFA 1SE3A 4AYBE 5LMUQ 1Q82C 2JYOA 3SEBA 4POFA 4KY6A 2B3GA 2IHFA 3FNBA 4YIJA 3J7ZC 1VQ8A 3PO2H 1HHVA 2ZM6Q 2VB3X 4A3CG 1VQCA 3GTLH 2BE5C 2L15A 3PO3G 4PL4A 2DNEA 1KIXA 1PH7A 1QOHA 4DN4M 2XGTA 2XWJB 1XPOA 1SYEA 1FYBA 1Z2IA 3MXGA 1Z9FA 4JI7L 3FHWA 2NVTB 1DGSA 2JZMA 4IPHA 4ALPA 4AQYL 4RAUC 9WGAA 2K4KA 3M7GA 2GKTI 4BY7H 4C3IB 2JA7H 2K1BA 3GTJH 4A3IH 1B4OA 1EWIA 1Q1EA 3J7YW 4F88A 5I6WA 4RGTA 1I6VC 2Q2TA 2MGSA 2G9DA 4JBJA 1R0RI 2CQAA 4JYAL 4L6TB 3QO2A 3EN2A 3GV3A 4BBRB 4AS3A 2L0CA 1AW7A 3DA3A 4RFBA 4L63B 2NZ1D 2B8TA 4WJ4A 2F1MA 3A54A 1KQSA 5BN4A 4OHJA 1YITA 5FLXc 2B2YC 3K5NA 2B2YA 4Q0FA 1MJAA 1V1QA 2IT1A 1B53A 3AJFA 1H9KA 3JSBA 4GXTA 3CU7A 4DV7L 3K81C 2GVIA 1OXXK 2E5LL 1XNQQ 1QNKA 3R5AA 3KF6B 5C0XH 2EJMA 3DM3A 1PH6A 1X9NA 2ZXPA 2YTYA 3N52A 4A3LG 1EYDA 1B1ZA 4DU9A 3K0YA 5LMNW 4DV4Q 2L5TA 3OXGA 1SYFA 4K0KQ 3MHBA 2XTQA 2K5HA 1BQQT 4MN3A 4UY8C 4RGMA 3M3YH 4A3GB 2VUMH 5K36H 1VQDA 4DR5Q 1A63A 4K6LA 1BCPD 3NBHB 3CCJA 1UVFA 1RD9D 1A15A 1TWFH 4FKDA 3P7JA 1Q7YC 3G71A 5EPJA 1Y8OB 5DM63 2EYJA 1PH5A 1STYA 3HP3A 1TIID 3M4QA 5BR8Q 1D1IA 2C35B 1II3A 1PZKD 3R2TA 1TWAH 5KEEA 2MQHA 3MZ5A 4C56C 4B3RL 2YU9B 4JI2Q 4U6RA 1K83B 4IUUA 1MBYA 1ICWA 1L1OB 4LJZC 4QIWE 4LF8L 2PQ8A 2QGQA 5J8CA 2FJ2A 3H3VC 3GTMB 5M9OA 3QOJA 2JA6B 3M4OH 2PQAB 1PTOB 3CCSA 3UEYA 5FJ8H 4DA2A 3V2TA 1CA5A 5JJZA 2F66B 2LXJA 4I65A 4O1OA 3L0IA 5FLMH 4TQUS 5C3XA 2BE5D 5KNDA 3A5ZB 1YJWA 3W1GA 1G8ZD 3G48A 4X3TA 4IOCA 2Q8TA 2PMZE 2O5JC 3K7AB 4MHEA 2RDGA 1JE5A 1KAWA 1UWVA 3DWAA 5CV8A 2L55A 2F0VA 5M3FG 5CV4A 3RU0A 3ZYYX 4OONA 2YQPA 4JV5L 1E2WA 2A73B 1N13A 1Y8NB 5C5MA 4JI4Q 2M9VA 1Q90A 2DNCA 1SROA 5AFWA 2UUBL 3BG3A 3KK7A 5JPNC 4NW2A 3QWPA 2ZXOA 2E74C 1BUSA 4OWTB 3C46A 4DK1A 2JXDA 4OO1I 2ZJQA 5IP7G 2R93H 2B2UC 2Q2IA 1WCMH 3VYUA 4HEA1 2L1BA 1IBMQ 2B2UA 5FOBB 4YCWA 1EQTA 2F0PA 1SGNI 3DEOA 3QJYA 1Q1BA 3J7AF 1SE8A 2JB2A 4JI0Q 1H9MA 1O7LA 4YZ9A 2O2LD 1U9RA 2MJFB 4FXDA 2QPOA 2EYMA 2NU2I 5CC4A 1U0LA 1A62A 2Z8LA 1K9MC 2F0SA 3TREA 2IX1A 1SN8A 3R5DA 2CFMA 1EY7A 3TQYA 1SNCA 2Y0SB 5IIFA 3KJOA 1I94L 3PF4A 1VQJA 3SGIA 3CC2A 1KBFA 1HNWL 2A69C 3HOYH 5C4ZA 4DNRB 3BZDB 2UXBL 1EOTA 3G4SA 1N32L 4BBSB 3VDUA 3S17H 4GKKQ 1NXUA 4GOPB 2DN8A 2R7ZB 4A3BB 1PRTC 3HOZH 1TS4A 3H6MA 5I2XA 4B3TL 2OZUA 3TOBA 1JCKB 1WTJA 5C3EB 4A3JG 4B6DA 5EAYA 3VYSA 5IP9H 1RODA 4DV0Q 3I4NB 1LTLA 4J1MA 1KXLA 2LB7A 1T9HA 1YHAA 5I2YA 1LT5D 1HR0L 5FUYA 1UE5A 3K58A 4OIKA 3GTOB 2WGCA 1IW4A 2EJGC 1DD2A 1HFNA 1XA6A 1CZGA 1AZQA 2B8FA 3M85A 3FC3A 4KY7A 1PMRA 1SYGA 4DK6C 1J5EQ 4A3MH 4DF7A 2RIOA 4ZCKA 1N34Q 1HJPA 5CCMA 2JSOA 4FVMA 4DV1Q 1Q86C 3CPFA 3K5MA 2TMPA 2QA4A 2KMOA 4POGA 5COYA 2YYZA 3ERSX 3LWUA 1YBYA 2F0EA 3VYTA 1HUMA 2ENZA 4NV2A 3NSWA 4ULLA 3VR3A 5JOBA 2DJGC 4HJ9A 3C3LA 4TKOB 2NVYH 3GTPH 4UP7A 2B8GA 1WGTA 4LF9L 1PFMA 4NKLA 3PF5A 2CKZB 3U9OA 2BA1A 2XMXA 3HKSA 1AP0A 1SGPI 4A3DB 1EYGA 4G7OC 3DLLA 1RFHA 1YIJA 4R1JA 2CWPA 4HGUA 2KENA 4BWGB 1MKHA 2PNRC 1SNDA 4DGZA 1VQKA 2XNAC 4CDEC 3CCQA 1PVOA 1HZBA 1WOCA 3PO2B 3B4VC 1SBBB 1IYUA 3F2UA 4GN4B 2H5XA 1TXYA 1NTGA 3GTLB 1H0ZA 1MGSA 1EQRA 3CCUA 5JVH3 1IY5A 3QR8A 3OMGA 2UU9Q 5C5LA 1WKXA 1IBKL 3F8TA 3SK4A 4CKBA 5IGCA 4C3JH 3OW7A 5AJ3Q 2JB3A 2PZWA 2VNUD 5CV7A 4RCNA 2JBWA 4BY7B 3J80L 5JJLA 1I5FA 4M1UB 1HNXQ 2F03A 2A20A 1HA5A 4A3IB 5JJKA 2A69D 4DR4Q 2BDNA 4EX5A 3SEKC 1TWGB 1VQMA 1LR7A 1FVIA 3CRKC 4YHHQ 2OTLA 2L11A 2N88A 2UXDQ 1MIUA 1SNQA 1PTRA 3CCRA 3STBC 1H9RA 2N52A 5HGQA 5KGUA 2FHTA 2J7ZA 2O4XA 1K7TA 1W6JA 3H94A 3CMEA 3H3VH 2E76C 1JMCA 4E1PA 1PZJD 1TBNA 1SFOH 3OVOA 4Q5VA 1VMPA 4K6DA 4X64Q 4RH6A 4QCLA 1PA6A 4BXXH 2EOTA 2XWBB 1ET9A 1NE3A 4DAYB 3ICEA 4GZYC 1V1IA 4DK0A 2EDGA 3R93A 1TU2B 4NP5A 5I4DA 2A2DA 3HKZB 1CI3M 2DGYA 4BY1H 4K5VA 3TJQA 1BBXC 1XMOL 1V1OA 2M5XA 4XIGS 3C2PA 4R4IA 4Y7NH 2RHQB 1OTCA 1ENCA 3NWSA 3SR1A 4JOIC 3DM1A 2B63H 3I91A 4K8IA 2CWAA 1I6HB 3H0GH 2VUMB 4ILWA 1PRTF 1KBEA 1TY2A 5JAVA 3J81i 4A3EB 2YUUA 3QAHA 2J87A 1TWFB 3HOWG 1PZID 5JEAG 1PH3A 1WI5A 3D4DA 2RKSA 2WAQE 1LTGD 3EIVA 3UDXA 2NTTA 1TWAB 4E1RA 3TS0A 3CAMA 5E3QA 2BL7A 5C4XH 1VQEA 2JQOA 3OIPA 3CQZH 2AQ3B 3T4AC 2WV6D 2JW6A 5C44H 3I90A 1UEBA 3GTQH 1JB3A 4L9MA 1WVLA 1GJXA 1SJED 1CZWA 1PH4A 4JI5Q 3M4OB 3CHBD 3E2IA 1SMXA 1L2FA 3EA6A 2QGMA 3ND8A 4HTHA 3PIO3 4A93B 2QCPX 4YY3L 2VL6A 1CSQA 4AIMA 1DXMA 5ISRA 1VQ4A 4ZQ3A 3S2HH 1JR0D 1SNPA 4NXML 2PQEA 1RDPD 4Z7GA 3LWEA 1HJAI 3NQIA 4LF6L 1VQ6A 3UDIA 4CGYB 4F8MA 5IWAL 3TMEA 2FFKB 1EIGA 2SGQI 1LT4D 2F0MA 4JI1L 1K28A 1CKMA 2ES2A 3T1HL 3RLOA 3D4WA 1D5MC 3RZDB 3IFDA 1FAQA 2KEEA 4I7AA 2Z6KC 3ERQA 4IN3A 2ODDA 3I7FA 2Z6KA 3GTGH 2AKWB 3HOVH 3STBD 2VS1A 2WB1E 3VR5A 2CW0D 1U4MA 4XYOA 1F9PA 2K5DA 4EQ5A 4E6IA 3NTKA 1GOZA 2EVBA 3OXFA 1EQQA 2JXMB 3I4MB 4DR1L 2C5CA 1VS0A 1XNRL 4KHPL 4MZ9A 2MP1A 2LSSA 2CJSC 4DV3L 2R7DA 4ME3A 3VR4A 4L8JA 2F0HA 1KLGD 3EJIA 5GROA 3U9SA 3HOYB 4DUYL 1TT2A 1HXYD 3N6RA 1VQAA 3T1YL 1YU6C 4FXGC 3HG9A 2DB6A 3MEHA 3EROA 4KMUC 5FK9C 3S17B 4P2CB 1QZGA 4QGUA 3D4RA 1O7ZA 3MFGA 5CV5A 1RIPA 3DUZA 3HOZB 1PYBA 2FXQA 4DUZL 3HOUH 2NU1I 1DOLA 5BN5A 4JI8L 5LMNQ 1TWCH 4QY7A 4X65L 3FPUB 1EY8A 5IYBH 5IGDA 3B6YA 1CTMA 2GKRI 1HUNA 1LTSD 2L4NA 1FYCA 2PNHA 3FMCA 7WGAA 5EPLA 4DXGA 1V43A 2EY6A 1WD0A 2GKVA 4JI7Q 5M5XH 2SOBA 3HOXG 1X54A 1C7YA 4B3SL 4GKJQ 4JCVE 3TS2A 4DR6Q 4KD4A 2FEFA 1EY0A 2ZTEA 1VMCA 2K01A 4A3MB 2JA6G 1C9OA 1CKOA 1R4QB 2R92G 1BBUA 1Y69U 2WB1B 4HAEA 2UUAQ 2X52A 5M3MB 3EQLC 2OT2A 2KHJA 3BJUA 3JAML 2HDLA 1QNUA 3TN2A 3SXHA 4JYAQ 2ZT9C 5IGFA 3AMUA 1PJUA 2A2CA 1JB7A 1X65A 3UITA 3H91A 2LXKA 3TP7A 1YNXA 4CJ2C 5CBEE 2NVYB 4G75A 3TO6A 3GTPB 2A19A 2D5DA 3WOEA 1S72A 1C0AA 2AMCB 2EYLA 4UDUC 2VRWB 3A5UA 1L0YB 3PIPA 1B3QA 4O0AA 2F4IA 1K7UA 1SGDI 4NXNL 3NTIA 3CCLA 3FKIH 4A3CH 2EY5A 5IT9L 3ULLA 2Z0SA 1VQ7A 3VYRA 1IL8A 3PO3H 1GUOA 1JWSD 1IHZA 4JG2A 4JVZA 1A3TA 3LJ0A 1PYWD 5IOCA 4A3FB 1CT1D 5M5WH 1C8CA 3RLNA 4DAMA 3J80E 4IUVA 3NWTA 2JA5G 3E0JA 4ZUIA 4NPSA 2KCTA 3K80C 4JI6L 4PMBA 4C2MH 2RQXA 4HCSA 1W6KA 3E5SA 3QIAA 3PSIA 1EEID 1FGUA 3UEJA 3MXNB 2YV5A 4C3JB 5EGTA 5EPKA 3MEKA 1R9TB 5ELOA 1H9SB 4N9PA 2UUCL 3EVQA 4JI3L 2Y0SG 4EQNA 3UE1A 1Q8KA 4DWLA 4P74A 4APVA 1AH9A 1VQIA 1ZEQX 1O7YA 4JW0A 1QWYA 1QUQA 2PYKA 5A2QL 1IY6A 2KCXA 3PUWA 2DIPA 2OD1A 4FF2A 3A8IE 2OXPA 2EXDA 4IPDA 3A7LA 3BDOA 2PI2A 2XN9C 1M8BA 3NUCA 4KKSA 2WKCA 4J6HA 1IL2A 4A3BG 3OHXC 5HY6A 5ELFA 5C3EG 3CMAA 3I4NG 1Z7TA 1SFOB 3TRZA 1S4ZA 1STAA 2KVMA 1E1OA 2GSCA 5ELBA 1TOTA 1ICFB 2YTVA 1F9QA 1NNXA 2X6LA 3BYYB 5G3LD 1LYLA 1Q9BA 4FF4A 3VR6A 1GM5A 1HFGA 1HZCA 5IODA 4A3LH 1XX6A 2FMCA 3A0JA 2XSCA 1JOQA 4BY1B 1Q81C 4HN7A 3R3OA 2CWFA 3V96A 1E3PA 4JV5Q 1QCBD 4C3HB 3QB3A 1KNEA 2N3SA 4Y7NB 1JOKA 3F4MA 5C4JH 1PTQA 3S24A 2B63B 1GHKA 1B8AA 4DR2Q 1JOOA 2LY7A 2K5NA 4R8NA 3H0GB 3OTOQ 4HIOA 1EFWA 4G76A 1MI2A 2EZVA 3RZOH 3TBIB 2W0TA 4EQPA 4ZLTF 3KFUA 1KNAA 2A8VA 4B3ML 2WVJA 4OWXB 2XRQD 2HHHL 1ET6A 2KHIA 4OXPA 1XBTA 3KF8B 1CT0I 2QDBA 2F0KA 3GD7A 5D3DA 2I5LX 2NUCA 4A3DG 1Y1CA 2EYFA 4B9XA 4O1PA 4V0BA 4AYBB 4IJHA 4IUNA 4OO1H 2N49A 3CQZB 5LL6S 3EBEA 5DAUA 2F4VL 1X3EA 3CC7A 1NR2A 2CHBD 4TRDA 3GTQB 1HNWQ 2E8GA 2QEJC 3CC4A 2CH4W 2GN5A 2UXBQ 3S16H 1SJ8A 1N32Q 1CKNB 1E2ZA 3JC66 1TURA 2PZUA 1D6EC 2Z1CA 1TDPA 1RF2D 1N9WA 1F9RA 4X62Q 5M3FH 4KHVA 5H1SE 3S2HB 1NMGA 4HR7B 4B3TQ 2JK8A 1K7VA 3QG1A 1NBWA 4RGOS 3KOJA 4BY7G 2ZTDA 4GLXA 1PRTB 3S14H 4DV6L 1CFMA 4IALA 5KYIA 5IP7H 1WTHA 4A3KB 4RCOA 1G6PA 2FUG1 1AFPA 4C1NI 1V1PA 3W5OA 5CORA 2BA0A 1IZ6A 3KUPA 3KLRA 3GTGB 3CCMA 1WTWA 1MSHA 2BDOA 1D5ZC 1BCPF 3HOVB 1HRJA 5IGGA 3P1HA 4LFBQ 1D2BA 1TWHB 1YEZA 1NJIC 4GNXB 1X4SA 4LF7Q 4L5RC 4DV2L 2NZHA 1MD2D 4GS3A 3KLWA 4RWSC 2KMRA 4LF9Q 4A75A 5F2DA 4P73A 4EGVA 1VQOA 1Y14B 2LKVA 1PPFI 3S1QH 2E2JB 3M9BA 3MVVA 1RCVD 1SAPA 2IWHA 1LV9A 3GTKH 1WTQA 1FL0A 1LTBD 2E75C 3NP8A 4R4CA 4LFCL 3M7NA 3GO5A 4GLVB 2KCMA 3NENA 5K36G 4A3JH 1CSPA 5GAEC 2XTRA 2K75A 2K03A 4UHVA 4A3EG 2SGFI 2IJ0A 3IKJA 1WD1A 1TGSI 1W3SA 1ML0D 1RHPA 2IY5B 1AN1I 2XVSA 2PZTA 2IW3A 2PPBC 5IYDG 1H9JA 3E6ZX 2GIVA 3HOUB 1AE2A 1O78A 1VQ9A 4G57A 1TWCB 4JBWA 1IKLA 4JBMA 1T5EA 1XYIA 3KP9A 2KOLA 4QUFA 1IBKQ 3I73A 3GV6A 4KV6A 2KHSA 1TIHA 3JAME 3BU2A 4QIWB 1SMYC 1IYJB 3VDYA 5ELEA 1EQVA 4OELB 4HSVA 2V1CC 3D00A 1WTVA 1B50A 2V1CA 1S5FD 3H09A 3RLFA 3DWQA 4MTKA 3HEJA 3KF6A 3R2IA 3DO9A 1BXTA 4PNYA 1JQYD 4A93G 4HIMA 3A74A 2BOSA 1F2LA 2PW5A 5I9OA 3K57A 1XNQL 1K8GA 1S5CD 1S5BD 3L9AX 2P22B 3GP7A 2PMZB 3CXCA 5IT9E 2X3TA 2Z4IA 3JAMc 2Z4HA 1TBRR 4DV4L 3NBHA 5CR3A 4CKCA 2CAZB 1DCZA 3RR5A 2B2VC 1HZ9A 1W2BA 1YNNC 2E2DC 2F0FA 1B70B 2B2VA 3BS1A 4U68A 2JA1A 3IAM1 3FKIB 2K5VA 3A56A 1XMOQ 1DS2I 1EFID 3PO3B 4P71A 4RHRA
chains in the Genus database with same CATH topology
5HI7A 2K19A 3NEMA 4JI2L 5GQOA 4LF5L 2PQAA 4DPGA 2B0UC 3I4MG 1Y1WG 4A76A 1MT1A 4YCVA 2AHOB 1V1HA 2JEAI 2VQEQ 2I0QA 4IOAA 2VQFL 3E9IA 1KHIA 3K7UC 4DKAC 1QVCA 1GVPA 2ZRRA 3PGZA 1I3QH 4YY3Q 2UXCL 2DUDA 2BH2A 2XTIA 1D7QA 1Y1VH 3WWVA 4LF6Q 5HGIA 2KKMA 2A1AA 2EQSA 3KYHC 2FNFX 1YO7A 4QJFA 4JI1Q 1H95A 3T1HQ 1X3FA 2OQ0A 1E1TA 4DV5L 3F2BA 5FUVA 1S40A 5M3MG 3HOWH 1SLJA 4OX9Q 1XMQQ 3MEFA 1Z47A 2ORWA 4BA2I 3AQQA 1G291 4GOPA 3KDFA 1PYSB 2YTXA 4IFDG 4JC0A 1O7IA 4DR1Q 4KHPQ 2MNAA 4DV3Q 4A4IA 4DV0L 1X6OA 4A3FG 5J3BA 1OXVA 2E2HH 1PH8A 3BZCA 1A0IA 1QZHA 3I55A 1TUSA 3CF5A 1OMTA 3E0EA 5GADC 2OWOA 3S1NH 4DUZQ 2I5HA 2AWOA 1N34L 2UZ3A 4YZDA 3L2PA 5GAHC 4IFDI 4A24A 1LM0A 4DR7L 1MJCA 1XJVA 4R4TA 1XPRA 4B3SQ 4P72A 3J80i 3SGQI 3U4VA 2NVXH 2MO0A 4RMFA 1XPUA 2E73A 5IYCH 4LUVA 4IPCA 4KLKA 4DR3L 1X56A 2ASBA 1BMOA 1E24A 2D0PA 4BXXG 2HIXA 4YZCA 1FARA 2JA8H 2PI2E 3F2CA 1Q12A 3PUZA 3S15H 3PV0A 1MJEA 4BA1I 2UU9L 1P16A 1M90C 2N8NA 1W4RA 3CD6A 2NU3I 5LNK1 3IAS1 4BBRG 5AJ3L 2GVBA 2CCZA 4IFDJ 1DS3I 1PH1A 2YU9H 4L5QA 1K83H 3HOXH 1R79A 3Q8DA 2NN6G 3GTMH 2N78A 1EOVA 4AH6A 2JA6H 1IBLQ 4AYBG 2R92H 3UDFA 4OAVB 2UUCQ 2L8EA 1X3GA 2IX0A 2ROWA 3GOXA 1L0WA 5JEAJ 5DLQE 4A3GG 3BJIA 3RNUA 3K7AH 1J6QA 4TVAB 5M5YH 3G6EA 3U50C 1IXRA 2QQ0A 4PMWA 1U5KA 2NN6I 3OXLA 4YWMA 4A3KG 5GAGC 4AQYQ 5JHWC 2LEOA 4XTCS 2JA5H 1VQHA 2E2IH 1B7YB 3U4ZA 3S1RH 2JB1A 2EIFA 3HH2C 3FP9A 2BH8A 2HHHQ 4KI0A 1N36L 1YTPA 2RF4A 4YWKA 3UFFA 3UDGA 1EIYB 4DV7Q 2E5LQ 2AWNA 2YFAA 1V9PA 5IY0A 4A3BH 2F4VQ 5C3EH 1KD1C 1N33L 3I4NH 2ZJRA 3NELA 3PDNA 4SGBI 3VA9A 4HJ7A 1OVOA 1VQFA 2NVQH 3ER0A 3SGBI 3CP0A 1CT4I 3LJ1A 3H15A 2E5RA 4B3RQ 1KRSA 3BZKA 2OQKA 4AS2A 1XTDA 3KY9A 3J80c 4LF8Q 4BBSG 4KHZA 2R7ZG 1SGQI 4JBKA 3JAMi 4A3DH 4HJ8A 5E7NA 2F3IA 4UP9A 3CCEA 3I56A 3E59A 2RCNA 1X55A 4DV2Q 4I1TA 5JJIA 2CQOA 3FKIG 3UE0A 2LUYA 5LMNL 3S2DH 2WFWA 2UUBQ 4GLAC 4LFCQ 4LFAL 1VDDA 1D8LA 2ARPF 4GKJL 2NZOA 4DR6L 1K73C 2OVOA 2ERWA 5FUWA 4J15A 1UE1A 1SR3A 2JE6I 1TWGH 2JJQA 3DA4A 2UUAL 4PZ6A 1FJGL 1I94Q 1K8AC 3PO2G 3IRBA 4DNIA 1QVGA 2P6AC 3D0FA 2VZAA 1NMFA 2IP6A 2OTJA 3UGIA 2SGDI 3I2ZA 1EUJA 2JA7G 2K9HA 1OXSC 1HR0Q 1G51A 4A3IG 1X74A 4A3EH 2SGEI 2J9RA 1HNZL 1SRUA 2Q2UA 5IYDH 4LF4L 4UXJA 2D62A 1CE3A 3UGDA 1UE6A 4MNOA 2Q2HA 3PCOB 4X66L 3PIOA 1WYDA 1JJ2A 4DK3C 4PZ8A 2V6EA 5LMUL 1AE3A 4LF5Q 2D0OA 4UPAA 1CUKA 2Y0SE 3E9HA 3HKZG 2ZM6L 4R4OA 2L1LB 5C0XG 4OO1G 1VQGA 4A93H 1PHJA 4R4QA 5IE8A 3OW2A 3CXLA 3PUYA 1WFQA 2VQFQ 2VUMG 4H02A 2K52A 3LJ2A 2GVAA 1LR8A 2HQLA 2BUSA 3RN2A 4OWWB 2ALYB 3RZDH 3K0XA 2UXCQ 1PFSA 4GN3B 3U58A 1OXTA 4DR2L 3OTOL 1Z7KB 5C0XI 1QVFA 2JAEA 4LW1A 1HDLA 1TBOA 1P8LA 4QQBX 4L5TA 5FJ8G 2WCYA 4DV5Q 5FLMG 4Z7HA 3I4MH 2NU0I 1PCEA 1Y1WH 1HH2P 3VE5A 1YJ9A 1M8CA 3CPWA 4OAUC 3VDPA 1CSOI 1BBWA 3I4OA 1CKNA 4RG1A 4K0KL 1A8VA 2L7XA 4MTNA 4DR5L 1KMAA 3KDFB 5CCLA 4X62L 2JEBI 5BR8L 4HFVA 1L1OC 4PL3A 4LNQA 2R93G 5IT9c 1WCMG 2K50A 1L1OA 4Q9VA 2WP8J 2HIVA 4NV5A 1HPTA 4OVOA 3J81j 2IHEA 5C0XJ 2WAQG 4P75A 2N17A 3ULJA 2VY3A 2ZTCA 4GNXC 2QQEA 3S1MH 2QEXA 3KJPA 1CGJI 4GNXA 2F6MB 4LFBL 5M3MH 3HOYG 4DR7Q 3F2DA 4LF7L 2JYYA 2KMPA 5DAEA 1SGYI 1Y8FA 3HOZG 3FBVA 4IO9A 1HR0W 4DR3Q 4JI4L 5IP9G 1GD7A 1I50H 2K14A 3HKZE 4FDBA 4NXMQ 4YCUA 3AFQA 1IBML 5IWAQ 4A3FH 1CHOI 4A3MG 3L7ZC 5FUXA 4JI0L 2HT1A 2V53A 1LR9A 2WB1G 1NUBA 3GDEA 1JT8A 1TBQR 3CW2C 1R9TH 1YZ6A 4L5SA 3SDJA 1K3RA 4GOPC 3TEHB 1OYVI 1KRTA 2I5MX 4GKKL 1VCIA 3RN5A 1XNRQ 1HZAA 4UXIA 1ASZA 3AFPA 1NY4A 1VQBA 4DUYQ 3T1YQ 3ZJYC 2NVTH 1J5EL 1RL2A 4C3IH 1OXUA 4C3HH 1Y1VG 1YI2A 2B29A 4JI8Q 4DV1L 4X65Q 2YFBA 4JOIA 2RHSB 2ENNA 1YVCA 4GI3C 2MFIA 4LWCA 4BBRH 3P23A 1YJNA 3HFZB 2VQEL 1UUCA 2OCEA 4PL5A 4NB3A 1YHQA 1E7ZA 4HIDA 1N36Q 4BY1G 1Q46A 4A3GH 2ZJPA 1WJJA 3M4PA 4NXNQ 1Y1BA 3OYYA 4GN5A 2B63G 3H0GG 3AEVA 1N33Q 2NU4I 1VQLA 1VQPA 3H3VI 3W1BA 1PH9A 1HNXL 1PV4A 2F3CI 4DR4L 4A3KH 4JI6Q 4YHHL 2UXDL 2SGPI 5C4XG 4OX9L 2ATWA 1XMQL 5EX0A 4HJ5A 4HIKA 5ELNA 4JI3Q 1KC8C 4UXHA 5C44G 1TWHH 4X64L 5IYCG 3D31A 3F1ZA 4YWLA 2F52A 1QUQB 3UGLA 1GO3E 2N1AB 4IJLA 2E2JH 2JA8G 1M1KC 2ELIA 1SGRI 1LUZA 1N8RC 5HQ8A 3OL0A 1YHBA 1BVSA 1VQNA 4IPGA 3HOVG 1S3OA 4LUOA 1JJCB 1UE7A 2ORVA 4LFAQ 3LGJA 1BKBA 4LUZA 2QQCA 1EIFA 4HJAA 1JJGA 1CT2I 4B3MQ 2R6GA 4JI5L 2N71A 1GKHA 3PUVA 1KL9A 4BBSH 2JA9A 4PZ7A 2R7ZH 1FJGQ 3PUXA 1UVGA 4PG3A 4O2DA 3L0OA 2ID0A 3GTOH 5EX3A 4QL5A 2KBNA 3HOUG 2MO1A 1VQ5A 3CCVA 5IYBG 4WJ3M 2XRCA 3ULPA 1SGEI 3QTLD 1OMUA 1K0RA 2QQDA 4DV6Q 1CGII 3AYHB 3J81c 4UP8A 1PH2A 1HNZQ 1ASYA 3J7A5 2KMQA 1E22A 1IBLL 2R7FA 4LF4Q 3I9V1 4X6AH 4X66Q 2VW9A 4Y52H 3K8AA 4AYBE 5LMUQ 1Q82C 4POFA 2B3GA 2IHFA 3J7ZC 1VQ8A 3PO2H 2ZM6Q 4A3CG 1VQCA 3GTLH 2L15A 3PO3G 4PL4A 1KIXA 1PH7A 2XGTA 1XPOA 1FYBA 1Z9FA 4JI7L 3FHWA 1DGSA 2JZMA 4IPHA 4ALPA 4AQYL 2K4KA 2GKTI 4BY7H 2JA7H 3GTJH 4A3IH 1EWIA 1Q1EA 2Q2TA 4JBJA 1R0RI 4JYAL 3EN2A 4AS3A 2B8TA 3DA3A 4WJ4A 1KQSA 1YITA 5FLXc 1V1QA 2IT1A 3AJFA 3JSBA 4GXTA 4DV7L 3K81C 2GVIA 1OXXK 2E5LL 1XNQQ 3KF6B 3DM3A 1PH6A 1X9NA 2YTYA 4A3LG 5LMNW 4DV4Q 3OXGA 4K0KQ 1I6HH 2XTQA 2K5HA 3M3YH 4UY8C 2VUMH 1VQDA 4DR5Q 1A63A 3NBHB 3CCJA 1UVFA 1TWFH 4FKDA 1Q7YC 3G71A 1PH5A 3M4QA 5BR8Q 2C35B 1TWAH 2MQHA 4B3RL 4JI2Q 4U6RA 4QIWE 1L1OB 4LF8L 2QGQA 3M4OH 2PQAB 3CCSA 3UEYA 5FJ8H 2F66B 2LXJA 4O1OA 3L0IA 5FLMH 4TQUS 3A5ZB 1YJWA 3W1GA 3G48A 4IOCA 2PMZE 1JE5A 1KAWA 1UWVA 5M3FG 3RU0A 4OONA 2YQPA 4JV5L 1N13A 4JI4Q 1SROA 2UUBL 3QWPA 1BUSA 4OWTB 2JXDA 4OO1I 2ZJQA 5IP7G 2R93H 2Q2IA 1WCMH 4HEA1 1IBMQ 4YCWA 1SGNI 1Q1BA 1SE8A 2JB2A 4JI0Q 4YZ9A 2MJFB 2QPOA 2NU2I 1U0LA 1A62A 1K9MC 2IX1A 3TREA 1SN8A 2CFMA 3TQYA 1KBFA 3KJOA 1I94L 3PF4A 1VQJA 3SGIA 3CC2A 1HNWL 3HOYH 2UXBL 1N32L 3G4SA 3VDUA 3S17H 4GKKQ 4GOPB 3HOZH 4B3TL 4A3JG 4B6DA 5EAYA 5IP9H 4DV0Q 1LTLA 1KXLA 1T9HA 1YHAA 1HR0L 5FUYA 1UE5A 1IW4A 1XA6A 3FC3A 3M85A 4DK6C 1J5EQ 4A3MH 2RIOA 1N34Q 1HJPA 5CCMA 4DV1Q 1Q86C 3CPFA 2QA4A 2KMOA 4POGA 2YYZA 3ERSX 1YBYA 2ENZA 4NV2A 4HJ9A 2NVYH 3GTPH 4UP7A 4LF9L 3PF5A 2CKZB 2BA1A 2XMXA 3HKSA 1SGPI 1EYGA 3DLLA 1RFHA 1YIJA 4R1JA 2CWPA 4HGUA 2KENA 1MKHA 1VQKA 3CCQA 1PVOA 1HZBA 1WOCA 3B4VC 4GN4B 2H5XA 1TXYA 1NTGA 1H0ZA 1EQRA 3CCUA 1IY5A 2UU9Q 1IBKL 3F8TA 4C3JH 5AJ3Q 2JB3A 2VNUD 5JJLA 1I5FA 1HNXQ 2A20A 5JJKA 4DR4Q 4EX5A 3SEKC 1VQMA 1LR7A 1FVIA 4YHHQ 2OTLA 2UXDQ 1MIUA 1PTRA 3CCRA 3STBC 2N52A 5HGQA 3CMEA 3H3VH 1JMCA 4E1PA 1TBNA 1SFOH 3OVOA 4X64Q 1PA6A 4BXXH 1NE3A 3ICEA 4DAYB 1V1IA 2A2DA 2DGYA 4BY1H 3TJQA 1XMOL 2M5XA 4XIGS 4R4IA 4Y7NH 2RHQB 1OTCA 4JOIC 2B63H 2CWAA 3H0GH 1KBEA 3J81i 2YUUA 2J87A 3HOWG 5JEAG 1PH3A 1WI5A 3EIVA 2WAQE 3UDXA 4E1RA 3TS0A 3CAMA 5C4XH 1VQEA 2JQOA 3CQZH 2JW6A 5C44H 1UEBA 3GTQH 4L9MA 1PH4A 4JI5Q 3E2IA 1SMXA 1L2FA 4YY3L 2VL6A 1CSQA 4AIMA 1VQ4A 3S2HH 4NXML 4Z7GA 1HJAI 4LF6L 1VQ6A 3UDIA 5IWAL 2SGQI 4JI1L 1CKMA 2ES2A 3T1HL 3RLOA 1FAQA 2Z6KC 2ODDA 3I7FA 2Z6KA 3GTGH 2AKWB 3HOVH 3STBD 2VS1A 2WB1E 4EQ5A 3OXFA 1EQQA 4DR1L 1VS0A 1XNRL 4KHPL 4MZ9A 2LSSA 2CJSC 4DV3L 2R7DA 4ME3A 5GROA 4DUYL 1VQAA 3T1YL 1YU6C 2DB6A 1QZGA 4QGUA 1RIPA 1PYBA 2FXQA 4DUZL 3HOUH 2NU1I 4JI8L 5LMNQ 1TWCH 4QY7A 4X65L 5IYBH 3B6YA 2GKRI 2PNHA 1V43A 2GKVA 4JI7Q 5M5XH 3HOXG 1X54A 1C7YA 4B3SL 4GKJQ 4JCVE 3TS2A 4DR6Q 2ZTEA 2JA6G 1C9OA 1CKOA 2R92G 1BBUA 2UUAQ 2KHJA 3BJUA 4JYAQ 1PJUA 2A2CA 1JB7A 1X65A 3UITA 2LXKA 1YNXA 4G75A 2A19A 1S72A 1C0AA 2AMCB 2VRWB 3A5UA 3PIPA 4O0AA 1SGDI 4NXNL 3CCLA 3FKIH 4A3CH 3ULLA 2Z0SA 1VQ7A 3PO3H 4JG2A 3LJ0A 5M5WH 3RLNA 4DAMA 2JA5G 4NPSA 2KCTA 3K80C 4JI6L 4C2MH 3PSIA 1FGUA 3UEJA 3MXNB 2YV5A 3MEKA 5ELOA 2UUCL 4JI3L 2Y0SG 1AH9A 3UE1A 1Q8KA 4DWLA 4P74A 4APVA 1VQIA 1QUQA 1IY6A 2KCXA 3PUWA 2DIPA 2OD1A 2EXDA 4IPDA 2PI2A 1M8BA 1IL2A 4A3BG 5HY6A 5C3EG 3CMAA 3I4NG 3TRZA 1E1OA 1TOTA 2YTVA 1LYLA 1GM5A 1HZCA 4A3LH 1XX6A 3A0JA 1Q81C 1E3PA 4JV5Q 2N3SA 3F4MA 5C4JH 1PTQA 3S24A 1B8AA 4DR2Q 3OTOQ 2K5NA 1EFWA 3RZOH 4HIOA 4G76A 2W0TA 3KFUA 2WVJA 2A8VA 4B3ML 4OWXB 2HHHL 2KHIA 4OXPA 1XBTA 3KF8B 1CT0I 3GD7A 2I5LX 4A3DG 1Y1CA 4O1PA 4IJHA 2N49A 3EBEA 2F4VL 1X3EA 3CC7A 1HNWQ 2E8GA 3CC4A 2GN5A 2UXBQ 3S16H 1SJ8A 1N32Q 1CKNB 3JC66 1TURA 1N9WA 4X62Q 5M3FH 5H1SE 1NMGA 4B3TQ 2JK8A 1NBWA 3KOJA 4BY7G 2ZTDA 4GLXA 3S14H 4DV6L 1G6PA 5IP7H 2FUG1 3W5OA 2BA0A 1IZ6A 3CCMA 4LFBQ 1YEZA 1NJIC 4GNXB 1X4SA 4LF7Q 4L5RC 4DV2L 2NZHA 4GS3A 3KLWA 2KMRA 4LF9Q 4A75A 4P73A 1VQOA 1Y14B 1PPFI 3S1QH 3M9BA 3GTKH 1FL0A 4LFCL 4R4CA 3M7NA 3GO5A 4GLVB 2KCMA 3NENA 5K36G 4A3JH 1CSPA 5GAEC 2XTRA 2K75A 4A3EG 2SGFI 1TGSI 1W3SA 2IY5B 1AN1I 5IYDG 1AE2A 1VQ9A 4JBWA 4JBMA 3KP9A 1IBKQ 1TIHA 3BU2A 1IYJB 3VDYA 2V1CC 3D00A 2V1CA 3RLFA 3KF6A 3DO9A 4A93G 4HIMA 3A74A 1XNQL 1K8GA 2P22B 3CXCA 3JAMc 1TBRR 4DV4L 2CAZB 3RR5A 1HZ9A 1W2BA 1B70B 2JA1A 3IAM1 2K5VA 1XMOQ 1DS2I 4P71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z H;  5C4X H;  1VQE A;  2JQO A;  1FJG Q;  3CQZ H;  3NEM A;  3I2Z A;  3PUX A;  4JI2 L;  5GQO A;  1EUJ A;  4PG3 A;  4LF5 L;  2JA7 G;  2PQA A;  4DPG A;  1OXS C;  5C44 H;  1G51 A;  4O2D A;  4A3I G;  1UEB A;  1HR0 Q;  3GTQ H;  3L0O A;  2ID0 A;  1PH4 A;  4JI5 Q;  3GTO H;  4A3E H;  3I4M G;  1SMX A;  4QL5 A;  1L2F A;  2KBN A;  3HOU G;  2MO1 A;  1Y1W G;  1VQ5 A;  1HNZ L;  1SRU A;  4A76 A;  2Q2U A;  3CCV A;  5IYD H;  4YCV A;  4LF4 L;  5IYB G;  2D62 A;  4WJ3 M;  2AHO B;  4YY3 L;  2VL6 A;  3ULP A;  1CSQ A;  1UE6 A;  4MNO A;  2Q2H A;  3PCO B;  4X66 L;  4AIM A;  1WYD A;  3PIO A;  1VQ4 A;  2JEA I;  3S2H H;  2VQE Q;  1JJ2 A;  4DK3 C;  4NXM L;  4PZ8 A;  2I0Q A;  4LF6 L;  4IOA A;  1VQ6 A;  2VQF L;  5LMU L;  1AE3 A;  3UDI A;  5IWA L;  4LF5 Q;  1K0R A;  3E9I A;  2D0O A;  1KHI A;  4UPA A;  4DV6 Q;  1CUK A;  3AYH B;  2Y0S E;  3J81 c;  4JI1 L;  3E9H A;  3K7U C;  4UP8 A;  4DKA C;  3HKZ G;  1PH2 A;  1CKM A;  2ZM6 L;  3T1H L;  4R4O A;  3RLO A;  5C0X G;  1HNZ Q;  1ASY A;  2ES2 A;  1QVC A;  1E22 A;  1GVP A;  3J7A 5;  1IBL L;  4OO1 G;  1VQG A;  2R7F A;  3PGZ A;  4LF4 Q;  1I3Q H;  2Z6K C;  4YY3 Q;  4X6A H;  3I7F A;  2Z6K A;  3GTG H;  4A93 H;  4X66 Q;  2VW9 A;  2UXC L;  2DUD A;  4Y52 H;  1PHJ A;  2AKW B;  3HOV H;  3STB D;  3K8A A;  4R4Q A;  2VS1 A;  2BH2 A;  2XTI A;  5IE8 A;  1D7Q A;  2WB1 E;  3OW2 A;  1Y1V H;  3WWV A;  3PUY A;  4LF6 Q;  1WFQ A;  2VQF Q;  4AYB E;  5LMU Q;  1Q82 C;  2VUM G;  4H02 A;  2A1A A;  2EQS A;  4EQ5 A;  3KYH C;  4POF A;  2B3G A;  2IHF A;  4QJF A;  4JI1 Q;  1EQQ A;  1H95 A;  3J7Z C;  1VQ8 A;  3PO2 H;  2ZM6 Q;  2K52 A;  2GVA A;  3T1H Q;  4A3C G;  1X3F A;  1VQC A;  2HQL A;  1E1T A;  2OQ0 A;  4DR1 L;  1VS0 A;  3RN2 A;  4DV5 L;  3F2B A;  1XNR L;  4MZ9 A;  5M3M G;  1S40 A;  4OWW B;  3HOW H;  1SLJ A;  2ALY B;  4KHP L;  2L15 A;  3RZD H;  3PO3 G;  4OX9 Q;  1XMQ Q;  3K0X A;  1KIX A;  2UXC Q;  1PH7 A;  2LSS A;  1PFS A;  4DV3 L;  2R7D A;  4GN3 B;  4ME3 A;  1OXT A;  2XGT A;  3MEF A;  4DR2 L;  3U58 A;  1Z47 A;  3OTO L;  5C0X I;  1XPO A;  1QVF A;  5GRO A;  4DUY L;  1Z9F A;  4LW1 A;  1VQA A;  3T1Y L;  3FHW A;  4JI7 L;  1DGS A;  4BA2 I;  3AQQ A;  4IPH A;  1G29 1;  4GOP A;  1P8L A;  4ALP A;  4AQY L;  3KDF A;  4QQB X;  1PYS B;  2K4K A;  2YTX A;  4BY7 H;  2JA7 H;  4L5T A;  5FJ8 G;  4IFD G;  4JC0 A;  1QZG A;  4QGU A;  3GTJ H;  1O7I A;  4A3I H;  4DR1 Q;  1EWI A;  1Q1E A;  1RIP A;  4DV5 Q;  5FLM G;  4KHP Q;  3I4M H;  1PYB A;  2FXQ A;  2Q2T A;  4DUZ L;  2MNA A;  3HOU H;  4JI8 L;  1HH2 P;  5LMN Q;  1Y1W H;  1TWC H;  4QY7 A;  4JBJ A;  4X65 L;  4DV3 Q;  1YJ9 A;  4A4I A;  3CPW A;  5IYB H;  4JYA L;  4DV0 L;  3B6Y A;  1X6O A;  1BBW A;  3EN2 A;  3I4O A;  4A3F G;  2PNH A;  1V43 A;  5J3B A;  1CKN A;  4JI7 Q;  1OXV A;  5M5X H;  4WJ4 A;  3HOX G;  1X54 A;  1PH8 A;  1C7Y A;  2E2H H;  4B3S L;  3BZC A;  4RG1 A;  4JCV E;  4GKJ Q;  1KQS A;  4K0K L;  3TS2 A;  1A0I A;  4DR6 Q;  1A8V A;  2ZTE A;  1YIT A;  5FLX c;  1QZH A;  2JA6 G;  4MTN A;  4DR5 L;  1C9O A;  1CKO A;  3I55 A;  2R92 G;  1BBU A;  3CF5 A;  1V1Q A;  2IT1 A;  3E0E A;  5GAD C;  3KDF B;  2OWO A;  3S1N H;  4DV7 L;  3K81 C;  4X62 L;  4DUZ Q;  1OXX K;  2AWO A;  2I5H A;  1N34 L;  2E5L L;  1XNQ Q;  3KF6 B;  2UUA Q;  2JEB I;  5BR8 L;  3L2P A;  3DM3 A;  2KHJ A;  3BJU A;  5GAH C;  1L1O C;  4IFD I;  4LNQ A;  2R93 G;  4JYA Q;  5IT9 c;  1WCM G;  2K50 A;  1PH6 A;  1L1O A;  1X9N A;  1LM0 A;  4DR7 L;  2YTY A;  1MJC A;  1JB7 A;  1XJV A;  2WP8 J;  2HIV A;  1X65 A;  4A3L G;  5LMN W;  3J81 j;  2IHE A;  2LXK A;  4DV4 Q;  4R4T A;  5C0X J;  1XPR A;  1YNX A;  4B3S Q;  4P72 A;  3J80 i;  2WAQ G;  4P75 A;  4K0K Q;  3U4V A;  1I6H H;  2A19 A;  2K5H A;  2MO0 A;  1S72 A;  2NVX H;  4UY8 C;  3M3Y H;  3ULJ A;  2VUM H;  4RMF A;  1XPU A;  1C0A A;  1VQD A;  2AMC B;  4DR5 Q;  1A63 A;  3NBH B;  3A5U A;  3CCJ A;  2VY3 A;  5IYC H;  3PIP A;  1TWF H;  4LUV A;  2ZTC A;  1Q7Y C;  3G71 A;  4GNX C;  4IPC A;  3S1M H;  4O0A A;  4KLK A;  2QEX A;  4NXN L;  3KJP A;  4DR3 L;  1PH5 A;  4GNX A;  3M4Q A;  3CCL A;  3FKI H;  5BR8 Q;  4A3C H;  1X56 A;  3ULL A;  2Z0S A;  2ASB A;  1VQ7 A;  4LFB L;  2C35 B;  1E24 A;  5M3M H;  3PO3 H;  3HOY G;  1TWA H;  4DR7 Q;  2D0P A;  4JG2 A;  2MQH A;  4BXX G;  2HIX A;  3F2D A;  4LF7 L;  4B3R L;  2JA8 H;  4JI2 Q;  5M5W H;  2PI2 E;  3RLN A;  4QIW E;  4DAM A;  1L1O B;  1Q12 A;  3PUZ A;  3F2C A;  2JA5 G;  4LF8 L;  3S15 H;  4NPS A;  2QGQ A;  2KCT A;  3K80 C;  3PV0 A;  4JI6 L;  4C2M H;  1MJE A;  4BA1 I;  3PSI A;  3HOZ G;  3M4O H;  2PQA B;  1FGU A;  2UU9 L;  1P16 A;  3MXN B;  4IO9 A;  1M90 C;  1HR0 W;  2N8N A;  3CCS A;  4DR3 Q;  5FJ8 H;  4JI4 L;  2YV5 A;  3CD6 A;  5IP9 G;  1GD7 A;  2LXJ A;  5ELO A;  1I50 H;  2UUC L;  5FLM H;  2K14 A;  4TQU S;  4JI3 L;  3HKZ E;  2Y0S G;  1AH9 A;  3UE1 A;  1Q8K A;  4P74 A;  4APV A;  4FDB A;  4BBR G;  3A5Z B;  5AJ3 L;  1VQI A;  1YJW A;  4NXM Q;  4YCU A;  3W1G A;  2GVB A;  2CCZ A;  3G48 A;  4IFD J;  1PH1 A;  4IOC A;  2PMZ E;  3AFQ A;  1QUQ A;  1IBM L;  5IWA Q;  4A3F H;  2YU9 H;  4L5Q A;  1JE5 A;  4A3M G;  3PUW A;  1K83 H;  3L7Z C;  1KAW A;  1UWV A;  3HOX H;  2EXD A;  4IPD A;  5M3F G;  4JI0 L;  3Q8D A;  2NN6 G;  2PI2 A;  2HT1 A;  2N78 A;  3GTM H;  2WB1 G;  4OON A;  4JV5 L;  1EOV A;  4AH6 A;  2JA6 H;  1IL2 A;  4A3B G;  1IBL Q;  4AYB G;  4JI4 Q;  2R92 H;  5HY6 A;  1SRO A;  3GDE A;  3UDF A;  1JT8 A;  2UUB L;  3CW2 C;  5C3E G;  2UUC Q;  3CMA A;  1R9T H;  1YZ6 A;  3I4N G;  4OWT B;  3TRZ A;  4L5S A;  1E1O A;  4OO1 I;  2ZJQ A;  1X3G A;  2IX0 A;  1K3R A;  2YTV A;  5IP7 G;  2Q2I A;  1L0W A;  1WCM H;  2R93 H;  1LYL A;  4GOP C;  1IBM Q;  5JEA J;  1GM5 A;  1HZC A;  5DLQ E;  4A3G G;  4A3L H;  4YCW A;  3TEH B;  3RNU A;  3K7A H;  3A0J A;  1J6Q A;  4TVA B;  1Q1B A;  5M5Y H;  1SE8 A;  1Q81 C;  4JI0 Q;  3G6E A;  3U50 C;  1E3P A;  1KRT A;  1IXR A;  2I5M X;  4GKK L;  4JV5 Q;  1VCI A;  3RN5 A;  4PMW A;  1XNR Q;  2N3S A;  1U0L A;  1HZA A;  1A62 A;  1K9M C;  2IX1 A;  3TRE A;  1ASZ A;  1U5K A;  5C4J H;  3S24 A;  1SN8 A;  2CFM A;  2NN6 I;  3TQY A;  4YWM A;  1B8A A;  3AFP A;  4DR2 Q;  3OTO Q;  2K5N A;  1NY4 A;  1EFW A;  3RZO H;  1VQB A;  3KJO A;  4HIO A;  1I94 L;  1VQJ A;  3SGI A;  3CC2 A;  4DUY Q;  3PF4 A;  3KFU A;  2A8V A;  4B3M L;  1HNW L;  3T1Y Q;  4OWX B;  2HHH L;  3HOY H;  4A3K G;  2KHI A;  3ZJY C;  5GAG C;  4OXP A;  2NVT H;  3KF8 B;  4AQY Q;  2UXB L;  1N32 L;  3G4S A;  3GD7 A;  4XTC S;  2JA5 H;  2I5L X;  1J5E L;  1RL2 A;  4C3I H;  3S17 H;  1VQH A;  4GKK Q;  4GOP B;  2E2I H;  1B7Y B;  4A3D G;  3U4Z A;  3S1R H;  1OXU A;  4C3H H;  1Y1V G;  1YI2 A;  3HOZ H;  2B29 A;  4JI8 Q;  2EIF A;  4DV1 L;  4B3T L;  4IJH A;  4X65 Q;  2N49 A;  3FP9 A;  3EBE A;  4A3J G;  5EAY A;  5IP9 H;  4DV0 Q;  2F4V L;  1X3E A;  1LTL A;  2BH8 A;  3CC7 A;  1KXL A;  4JOI A;  2RHS B;  1T9H A;  1YHA A;  1YVC A;  1HNW Q;  2MFI A;  2HHH Q;  4LWC A;  4KI0 A;  4BBR H;  2E8G A;  1HR0 L;  1UE5 A;  3CC4 A;  1N36 L;  2GN5 A;  2UXB Q;  3S16 H;  3M85 A;  2RF4 A;  1N32 Q;  1CKN B;  3JC6 6;  4YWK A;  4DK6 C;  1YJN A;  1J5E Q;  4A3M H;  3HFZ B;  3UDG A;  1EIY B;  4DV7 Q;  1N9W A;  4X62 Q;  5M3F H;  1N34 Q;  1HJP A;  2E5L Q;  5H1S E;  2AWN A;  4DV1 Q;  1NMG A;  4B3T Q;  2JK8 A;  1V9P A;  5IY0 A;  2VQE L;  3CPF A;  1NBW A;  2QA4 A;  1Q86 C;  4A3B H;  4POG A;  3KOJ A;  2F4V Q;  2YYZ A;  3ERS X;  5C3E H;  1KD1 C;  1N33 L;  4BY7 G;  1YBY A;  2ZTD A;  3I4N H;  2ZJR A;  4GLX A;  3S14 H;  4DV6 L;  4HJ9 A;  2OCE A;  4NB3 A;  3NEL A;  1YHQ A;  1G6P A;  1E7Z A;  5IP7 H;  4HID A;  4HJ7 A;  4BY1 G;  1N36 Q;  2NVY H;  1Q46 A;  3GTP H;  4UP7 A;  3W5O A;  1VQF A;  1IZ6 A;  2BA0 A;  2ZJP A;  2NVQ H;  4LF9 L;  3ER0 A;  4A3G H;  1WJJ A;  3PF5 A;  2CKZ B;  3CP0 A;  2BA1 A;  3HKS A;  3M4P A;  3CCM A;  4NXN Q;  1EYG A;  3DLL A;  3OYY A;  1YIJ A;  4GN5 A;  4R1J A;  3H15 A;  2B63 G;  2CWP A;  4LFB Q;  1YEZ A;  3H0G G;  2KEN A;  1NJI C;  1MKH A;  3AEV A;  1N33 Q;  4GNX B;  4B3R Q;  1VQL A;  1VQK A;  4LF7 Q;  1KRS A;  1VQP A;  3BZK A;  3H3V I;  2OQK A;  3CCQ A;  3W1B A;  1PH9 A;  4L5R C;  1PVO A;  1HZB A;  1XTD A;  4DV2 L;  2NZH A;  1PV4 A;  1WOC A;  4GS3 A;  1HNX L;  3J80 c;  4LF8 Q;  3KLW A;  4GN4 B;  4DR4 L;  2H5X A;  1TXY A;  1NTG A;  3GTL H;  4A3K H;  1EQR A;  4JI6 Q;  3CCU A;  4BBS G;  4LF9 Q;  4A75 A;  4YHH L;  4KHZ A;  4P73 A;  2UXD L;  1VQO A;  2UU9 Q;  1Y14 B;  2R7Z G;  5C4X G;  3S1Q H;  4OX9 L;  2ATW A;  1XMQ L;  3M9B A;  1IBK L;  3F8T A;  4JBK A;  3GTK H;  3JAM i;  4A3D H;  4HJ5 A;  1FL0 A;  4LFC L;  4R4C A;  4C3J H;  4HIK A;  5ELN A;  4HJ8 A;  5E7N A;  2F3I A;  4JI3 Q;  4UP9 A;  3CCE A;  1KC8 C;  3M7N A;  3GO5 A;  5AJ3 Q;  5C44 G;  4GLV B;  1TWH H;  2KCM A;  3NEN A;  3I56 A;  5K36 G;  2VNU D;  4A3J H;  1CSP A;  5GAE C;  2K75 A;  4A3E G;  4X64 L;  5JJL A;  1I5F A;  5IYC G;  2RCN A;  1W3S A;  1X55 A;  3D31 A;  4DV2 Q;  1HNX Q;  2IY5 B;  5JJK A;  4DR4 Q;  4EX5 A;  3F1Z A;  5JJI A;  5IYD G;  1VQM A;  4YWL A;  2CQO A;  3FKI G;  1FVI A;  1AE2 A;  2F52 A;  4YHH Q;  3UE0 A;  1QUQ B;  1VQ9 A;  2OTL A;  2UXD Q;  1GO3 E;  1MIU A;  4JBW A;  3CCR A;  4JBM A;  3STB C;  5LMN L;  3S2D H;  5HGQ A;  1IBK Q;  2WFW A;  4IJL A;  2E2J H;  2UUB Q;  4GLA C;  4LFC Q;  2JA8 G;  4LFA L;  3BU2 A;  1M1K C;  3CME A;  1IYJ B;  3H3V H;  1D8L A;  3VDY A;  1JMC A;  2V1C C;  1SFO H;  4GKJ L;  2NZO A;  4X64 Q;  4DR6 L;  3RLF A;  1K73 C;  1LUZ A;  1N8R C;  1PA6 A;  4BXX H;  3KF6 A;  1NE3 A;  3ICE A;  4J15 A;  1YHB A;  4DAY B;  1UE1 A;  1SR3 A;  2JE6 I;  1BVS A;  1TWG H;  2DGY A;  1VQN A;  4IPG A;  3A74 A;  2JJQ A;  4HIM A;  4BY1 H;  4A93 G;  1XNQ L;  3HOV G;  2UUA L;  1S3O A;  1XMO L;  1K8G A;  4LUO A;  1JJC B;  1UE7 A;  4XIG S;  3CXC A;  4R4I A;  4LFA Q;  4Y7N H;  2RHQ B;  3JAM c;  3LGJ A;  4PZ6 A;  1OTC A;  1BKB A;  1FJG L;  4LUZ A;  4JOI C;  2B63 H;  4DV4 L;  1K8A C;  1I94 Q;  1EIF A;  4HJA A;  2CWA A;  1JJG A;  3H0G H;  4B3M Q;  3PO2 G;  3J81 i;  2R6G A;  3RR5 A;  1HZ9 A;  3IRB A;  4JI5 L;  1W2B A;  3HOW G;  4DNI A;  1B70 B;  1GKH A;  1QVG A;  5JEA G;  1PH3 A;  3D0F A;  2VZA A;  1WI5 A;  2K5V A;  1NMF A;  3PUV A;  1KL9 A;  3EIV A;  2WAQ E;  3UDX A;  2JA9 A;  1XMO Q;  4PZ7 A;  4BBS H;  4P71 A;  3TS0 A;  2OTJ A;  3CAM A; 
#chains in the Genus database with same CATH topology
 4HMJ A;  1DOK A;  1MHW C;  5HI7 A;  2K19 A;  3NEM A;  1GUG A;  3DHQ A;  4JI2 L;  5GQO A;  1PTO C;  4CDC C;  4LF5 L;  4IUQ A;  2PQA A;  3OOC A;  4DPG A;  1U4L A;  2NYZ D;  3NTH A;  5A2Q E;  1NSN S;  1JWM D;  2PO4 A;  2B0U C;  4TSS A;  3I4M G;  1Y1W G;  2EPB A;  4A76 A;  1FY7 A;  1MT1 A;  4YCV A;  1LT3 D;  1WGC A;  2AHO B;  4G7Z C;  3HZX A;  1V1H A;  2JEA I;  5HGT A;  2F3V A;  2VQE Q;  2WII B;  2RIJ A;  2I0Q A;  2EYH A;  4IOA A;  2VQF L;  3FDT A;  3E9I A;  1TR5 A;  1KDA A;  1BR9 A;  1KHI A;  4CDF C;  1EEF D;  3K7U C;  4OL7 A;  4DKA C;  2XRS D;  3RMH A;  3HRZ C;  1QVC A;  1GVP A;  2ZRR A;  3PGZ A;  1I3Q H;  4YY3 Q;  2EE1 A;  1IW7 C;  3MTS A;  2UXC L;  2DUD A;  2BH2 A;  1XX8 A;  2HDM A;  2XTI A;  3BVZ A;  1D7Q A;  5EQ0 A;  5E1F A;  1LT6 D;  1Y1V H;  3WWV A;  4LF6 Q;  5HGI A;  2KKM A;  2ENB A;  1SMY D;  2A1A A;  4X3K A;  3SE0 A;  2EQS A;  1NR4 A;  3KYH C;  2JA7 B;  2FNF X;  2F0L A;  3GTJ B;  1YO7 A;  4QJF A;  4JI1 Q;  1H95 A;  1JIC A;  1PFN A;  3T1H Q;  2RSN A;  1X3F A;  2OQ0 A;  1E1T A;  4DV5 L;  3F2B A;  5FUV A;  1S40 A;  1EY9 A;  5M3M G;  5C4J B;  3HOW H;  1SLJ A;  3Q23 A;  1I4R A;  4OX9 Q;  5JEA H;  1XMQ Q;  2B2W C;  5CBA E;  3RZO B;  2B2W A;  4OEM B;  3MEF A;  2RVL A;  1Z47 A;  2CW0 C;  2J0T D;  2K32 A;  2ORW A;  1YNJ C;  3TDQ A;  1J9O A;  1FNU A;  3ONA B;  2EXZ A;  3AQQ A;  4BA2 I;  1G29 1;  2OF1 A;  4GOP A;  3KDF A;  1PYS B;  3AU7 A;  1HQM C;  2YTX A;  5NUC A;  4IFD G;  1I4H A;  4JC0 A;  1O7I A;  3DMU A;  3KBX A;  4DR1 Q;  1S5E D;  1AZP A;  2AQ1 B;  4HED A;  1YNN D;  4KHP Q;  2MNA A;  2QDL A;  4DV3 Q;  2Q8R E;  1HCZ A;  4A4I A;  2IPK D;  3I8Z A;  1UNS A;  4DV0 L;  1X6O A;  4A3F G;  5J3B A;  5EKI A;  3TP8 A;  1OXV A;  1J8I A;  4H0L C;  2E2H H;  1PH8 A;  4PQX A;  5DEH A;  3BZC A;  1QE6 A;  4WJW A;  3M3Y B;  2HQE A;  1A0I A;  3FRP B;  1G6Z A;  1QZH A;  1PTO D;  2RBM A;  2A68 C;  3I55 A;  1TUS A;  5M3F B;  3CF5 A;  1OMT A;  5E4X A;  5IGE A;  3E0E A;  5GAD C;  2OWO A;  3S1N H;  2DY7 A;  2I5H A;  2AWO A;  4XDX A;  1A3V A;  4H7B A;  4DUZ Q;  1N34 L;  2UZ3 A;  4YZD A;  3L2P A;  5GAH C;  5A35 A;  4IFD I;  3FSY A;  3P75 A;  1LM0 A;  4DR7 L;  4A24 A;  1MJC A;  3SDZ A;  1XJV A;  3OSO A;  3FSX A;  3PQI A;  1Q8I A;  5KIX A;  4R4T A;  1XPR A;  2RDH A;  4B3S Q;  2ZXR A;  1F77 A;  4P72 A;  3J80 i;  5FLX L;  3SGQ I;  3U4V A;  2NVX H;  2MO0 A;  4QUC A;  4RMF A;  1XPU A;  3SHL A;  4FO2 A;  2E73 A;  5IYC H;  1CQF A;  4LUV A;  4K5W A;  4IPC A;  4KLK A;  3D8G A;  1UHA A;  4DR3 L;  1WTR A;  2CVR A;  2KJX A;  1X56 A;  2SNM A;  2ASB A;  5E3P A;  2RC4 A;  1BMO A;  1E24 A;  1DJR D;  2R61 A;  1IW7 D;  2D0P A;  3I72 A;  4BXX G;  2HIX A;  4YZC A;  1FAR A;  2JA8 H;  2PI2 E;  3BVG A;  3F2C A;  1Q12 A;  1BF4 A;  3PUZ A;  3S15 H;  4C3I G;  3MFY A;  1S20 A;  3PV0 A;  1MJE A;  2KUM A;  4BA1 I;  4C3H G;  1QB5 D;  2UU9 L;  1P16 A;  1M90 C;  3GTK B;  2N8N A;  2B39 A;  4PMC A;  3CD6 A;  1W4R A;  2NU3 I;  2KQ3 A;  3FEW X;  5LNK 1;  3IAS 1;  4BBR G;  5AJ3 L;  5I9P A;  4A3J B;  2R93 B;  3D6C A;  1WCM B;  3K5L A;  2GVB A;  2CCZ A;  4IFD J;  1DS3 I;  1PH1 A;  3A55 A;  1GUT A;  2YU9 H;  4L5Q A;  2F3W A;  1STG A;  3G7L A;  1YNJ D;  2WAQ B;  1K83 H;  3TP6 A;  3HOX H;  1R79 A;  3Q8D A;  2NN6 G;  3GTM H;  2N78 A;  1EOV A;  4AH6 A;  5TSS A;  2JA6 H;  1IBL Q;  1AN8 A;  4AYB G;  2SEB D;  2R92 H;  1BCP B;  2K7V A;  3UDF A;  2O5I C;  1PTO H;  2SNS A;  4OAV B;  4DAP A;  5FO9 B;  2UUC Q;  1SE4 A;  2L8E A;  1G2S A;  1K8O A;  1I6H H;  1IKM A;  1X3G A;  2IX0 A;  2ROW A;  3GOX A;  2Z9H A;  1L0W A;  5JEA J;  3LX0 A;  1JC7 A;  3LNN A;  5DLQ E;  4A3G G;  3BJI A;  1ENF A;  3K7A H;  5ELD A;  3W2D A;  3RNU A;  1D5X C;  1J6Q A;  4TVA B;  3URY A;  5M5Y H;  3G6E A;  3U50 C;  1IXR A;  3OMC A;  2QQ0 A;  2A68 D;  4PMW A;  1LLR D;  1ESR A;  1U5K A;  1KDC A;  2NN6 I;  4Z9C B;  3TO9 A;  3OXL A;  4YWM A;  1F9S A;  4ME5 A;  4A3K G;  1I4P A;  5GAG C;  4UAI A;  2ICE C;  1EWH A;  4AQY Q;  3WDN A;  5JHW C;  2LEO A;  5EKL A;  1GHJ A;  1SJH D;  3NXW A;  4QMG A;  5T1I A;  4XTC S;  2JA5 H;  2I46 A;  5CMD A;  1VQH A;  2E2I H;  1B7Y B;  3U4Z A;  3S1R H;  3X3N A;  2Q8I B;  4XQQ A;  4M8A A;  2JB1 A;  2EIF A;  3HH2 C;  4WOR A;  3FP9 A;  4FF1 A;  4ABN A;  1BOS A;  3CKI B;  5D3I B;  4ZRZ A;  1AEX A;  2BH8 A;  1A2T A;  2HHH Q;  4KI0 A;  4K8J A;  3SVM A;  4IUT A;  1N36 L;  1EIH A;  1YTP A;  2RF4 A;  4YWK A;  2F0G A;  4OGQ C;  1SYC A;  3UFF A;  3UDG A;  3E3X A;  1EIY B;  4DV7 Q;  3SK8 A;  2E5L Q;  4EVO A;  1ILQ A;  2AWN A;  2YFA A;  1EL0 A;  1V9P A;  1Y8P B;  5IY0 A;  1F2Y A;  4A3B H;  5CYU A;  2JN4 A;  2KA7 A;  2F4V Q;  2F0Q A;  1DOM A;  5C3E H;  1KD1 C;  3WOF A;  1CK1 A;  1N33 L;  3I4N H;  2ZJR A;  1I4X A;  4CJ0 B;  2K5Q A;  4FF3 A;  3NEL A;  2ZW3 A;  3PDN A;  4SGB I;  3UOE A;  3VA9 A;  4HJ7 A;  4KTA A;  1OVO A;  1VQF A;  2NVQ H;  1I3Q B;  3ER0 A;  3ITP A;  1P9G A;  3SGB I;  1VF7 A;  2DY8 A;  3CP0 A;  2G9H D;  1CT4 I;  3LJ1 A;  3I70 A;  3H15 A;  1PXU A;  1Y1V B;  1STB A;  4XYQ A;  2ETD A;  3J7A V;  4G7H C;  2E5R A;  4B3R Q;  3FVV A;  2K05 A;  1KRS A;  3BZK A;  2OQK A;  4HSP A;  3A8K E;  1Q3L A;  4AS2 A;  1XTD A;  3KY9 A;  1UEA B;  3J80 c;  4LF8 Q;  1HEV A;  2EY1 A;  1K8M A;  1SE2 A;  4BBS G;  3HOW B;  2AUJ D;  4KHZ A;  1V8Q A;  2OEO A;  2R7Z G;  1V1P B;  4WFN 3;  2RDF A;  4JBK A;  1SGQ I;  3JAM i;  4A3D H;  4XQN A;  4HJ8 A;  1L0X B;  3P20 A;  2M00 A;  2F3I A;  5E7N A;  4UP9 A;  3CCE A;  4XT1 B;  1ONL A;  3TP5 A;  3I56 A;  3KLS X;  2QKI C;  1TVX A;  2K6A A;  3E59 A;  2RCN A;  1X55 A;  4DV2 Q;  2RSO A;  1KLU D;  3MXU A;  4I1T A;  5JJI A;  2CQO A;  1B3A A;  3FKI G;  5C3W A;  3OIQ A;  3UE0 A;  1XTC D;  2TSS A;  2LUY A;  4LAA A;  5LMN L;  3S2D H;  2EY2 A;  2WFW A;  2UUB Q;  4GLA C;  4LFC Q;  4LFA L;  1VDD A;  1D1K A;  1PFB A;  1D8L A;  1NAP A;  2E2H B;  3MXP A;  2F0O A;  2MUY A;  2ARP F;  4GKJ L;  2NZO A;  2LMC B;  4DR6 L;  5FLX E;  2HUG A;  1K73 C;  4S3S A;  2OVO A;  1LAB A;  5E3R A;  2ERW A;  5FUW A;  4J15 A;  2QW7 A;  1UE1 A;  5G3L F;  1SR3 A;  3S1N B;  1FNV A;  1CHP D;  2JE6 I;  4O1N A;  1TWG H;  4OIJ A;  4ZKC B;  2JJQ A;  1LTI D;  2WKD A;  3DA4 A;  1O80 A;  2UUA L;  1U4R A;  5C4X B;  3Q22 A;  4PZ6 A;  1FJG L;  4FYD A;  2MHV A;  4V19 0;  1I94 Q;  1K8A C;  5C44 B;  2NVX B;  1ULK A;  3ND9 A;  4N9T A;  3PO2 G;  4WRD A;  1KTK A;  5LL6 X;  1F2M A;  3IRB A;  3MA2 B;  3T13 A;  5EBC A;  3G6J B;  4DNI A;  1QVG A;  2P6A C;  1SYB A;  5D65 A;  3D0F A;  2VZA A;  1NMF A;  4HCE A;  1GXD C;  2L12 A;  1RKN A;  1XXG A;  2IP6 A;  2UVO A;  2OTJ A;  5DNF A;  2JA8 B;  2L9H A;  3UGI A;  4AML A;  1QIL A;  4KK7 A;  4K5X A;  2SGD I;  3I2Z A;  3S15 B;  1EUJ A;  2JA7 G;  2K9H A;  3MXN A;  1OXS C;  1HR0 Q;  1G51 A;  5JVG 3;  4A3I G;  1X74 A;  1SNO A;  1DON A;  1EU4 A;  1TS2 A;  2QSB A;  1STN A;  4A3E H;  1H9S A;  2FIN B;  2SGE I;  2F0J A;  2J9R A;  2NWG A;  1B9N A;  1HNZ L;  1SRU A;  2Q2U A;  3T53 B;  5CV9 A;  5IYD H;  4LF4 L;  1HTL D;  2A6E C;  2D62 A;  2DKV A;  4UXJ A;  1CE3 A;  3UGD A;  5LHY 1;  1X32 A;  1UE6 A;  4MNO A;  1BO0 A;  2Q2H A;  3PCO B;  4X66 L;  1WYD A;  3PIO A;  1G2T A;  1SNM A;  5IGB A;  1JJ2 A;  4DK3 C;  1MJB A;  2F0W A;  4PZ8 A;  1GUS A;  1JOR A;  1G91 A;  2V6E A;  5LMU L;  1AE3 A;  4LF5 Q;  3HOX B;  2HD3 A;  3PMF A;  2D0O A;  2IL8 A;  4UPA A;  4X3U A;  1CUK A;  2FMM A;  2Y0S E;  3IL8 A;  1DM0 B;  3E9H A;  3HKZ G;  2ZM6 L;  2R92 B;  4R4O A;  2L1L B;  5L37 A;  1LO5 D;  5C0X G;  5EJW A;  4OO1 G;  1VQG A;  3O13 A;  4IUR A;  4F87 A;  4A93 H;  1JQO A;  1PHJ A;  3TO7 A;  4R4Q A;  2P5Z X;  5IE8 A;  3OWE B;  3OW2 A;  3CXL A;  3PUY A;  1WFQ A;  2VQF Q;  2VUM G;  4H02 A;  5M5Y B;  1FGB D;  1EU3 A;  3HS0 C;  2DJF C;  2K52 A;  3LJ2 A;  2GVA A;  1LR8 A;  2QF7 A;  2HQL A;  2BUS A;  3RN2 A;  4OWW B;  2ALY B;  3QWN A;  3RZD H;  3FVQ A;  2RA4 A;  1KAB A;  3K0X A;  2UXC Q;  2H1E A;  1PFS A;  4GN3 B;  3U58 A;  3MWY W;  1OXT A;  4DR2 L;  3KF8 A;  3OTO L;  5C0X I;  1Z7K B;  1QVF A;  2JAE A;  5M5X B;  1GUN A;  4LW1 A;  1HDL A;  1TBO A;  4LK1 C;  1P8L A;  2N55 A;  5K5P A;  1SSO A;  4IZ8 A;  1RTO A;  4QQB X;  4O42 A;  3TOA A;  2K28 A;  3DXJ C;  2JA5 B;  1STE A;  2R3Z A;  5DM7 3;  2E2I B;  4L5T A;  4ZUJ A;  5FJ8 G;  1ILP A;  2WCY A;  3S1R B;  1TQO A;  2AUK A;  4KY5 A;  4DV5 Q;  5FLM G;  4Z7H A;  4IQZ A;  3I4M H;  2NU0 I;  2RCF A;  1PCE A;  1ESF A;  2B2T C;  1Y1W H;  1HH2 P;  4F7X A;  3C1E A;  2B2T A;  3VE5 A;  1YJ9 A;  1M8C A;  3CPW A;  4OAU C;  3VDP A;  1CSO I;  4RHS A;  1BBW A;  3I4O A;  3UI2 A;  1ZKO A;  4R8I A;  1P9Z A;  3K5O A;  1CKN A;  5FKA C;  4RG1 A;  4K0K L;  3DWP A;  1A8V A;  1NCV A;  2L7X A;  4MTN A;  4DR5 L;  4KN4 C;  3TZU A;  1KMA A;  2F0N A;  3KDF B;  5CCL A;  4X62 L;  2CWG A;  1CHQ D;  2JEB I;  5BR8 L;  4HFV A;  1L1O C;  4PL3 A;  4LNQ A;  2R93 G;  4H44 C;  1U4P A;  2A6E D;  1WCM G;  5IT9 c;  2K50 A;  1LTT D;  1L1O A;  3OWF A;  4Q9V A;  2WP8 J;  2HIV A;  4NV5 A;  1HPT A;  3SK6 A;  5M5W B;  4OVO A;  1QG7 A;  3J81 j;  1ZYR C;  2IHE A;  5C0X J;  2KED A;  1A6X A;  2WAQ G;  4P75 A;  2KCN A;  2K04 A;  2X6G A;  3VA5 A;  5I6Y A;  2N17 A;  2NVQ B;  3PIP 3;  4C2M B;  2C9O A;  3M4Y A;  3ULJ A;  4R9W A;  3QOL A;  4FNF A;  2VY3 A;  2ZTC A;  5C6A A;  5J39 A;  4GNX C;  2QQE A;  3S1M H;  1ENA A;  2QEX A;  3KJP A;  1CGJ I;  1RJT A;  2A74 C;  4GNX A;  1TS3 A;  2F6M B;  3BVM A;  4DFA A;  4LFB L;  5M3M H;  3HOY G;  1OO9 B;  1MJ9 A;  1UAP A;  4DR7 Q;  2IX3 A;  3F2D A;  4LF7 L;  5HUR A;  1SEB D;  2JYY A;  2KMP A;  5DAE A;  5JPM C;  4KJO A;  1STH A;  3IAY A;  1SGY I;  2SDF A;  1JWU D;  2EJF C;  4G4K A;  3RUZ A;  1EY6 A;  1Y8F A;  1F2Z A;  3SK5 A;  1CA6 A;  4DNC A;  1XWE A;  3HOZ G;  2A5H A;  3FBV A;  3DEP A;  2HGK A;  4IO9 A;  1HR0 W;  1K0S A;  4DR3 Q;  4JI4 L;  4IFD H;  4FXK C;  3K6O A;  5IP9 G;  1GD7 A;  3VR2 A;  1I50 H;  2K14 A;  3HKZ E;  4FDB A;  1B2T A;  1BUV T;  4NXM Q;  4YCU A;  1LTR D;  5FO8 B;  4KJN A;  1ULM A;  4WP4 A;  2F0U A;  3AFQ A;  1IBM L;  5IWA Q;  4A3F H;  1CHO I;  1T5X D;  3OPO A;  2A6H C;  4RKL A;  3J81 L;  4A3M G;  3L7Z C;  5D14 A;  1R4P B;  1A3U A;  5FUX A;  4JI0 L;  2HT1 A;  2V53 A;  4DXF A;  3X3M A;  1LR9 A;  2WB1 G;  4B9W A;  3S2D B;  1NUB A;  1ULN A;  3NBI A;  1TY0 A;  4K2K A;  3GDE A;  4RKB A;  4X3S A;  3TSS A;  1JT8 A;  1TBQ R;  3CW2 C;  1R9T H;  1YZ6 A;  1SXT A;  2I07 B;  4L5S A;  5C4H A;  5FO7 B;  4HMI A;  3SDJ A;  1K3R A;  1GUW A;  1UUP A;  2K5W A;  4GOP C;  2PCF B;  3HGB A;  1E0B A;  4QF4 A;  3TEH B;  2WAC A;  3CRL C;  1OYV I;  3R5B A;  4N8F A;  1LAC A;  1KRT A;  1MSG A;  2I5M X;  4GKK L;  1X3Q A;  1VCI A;  1NUC A;  3RN5 A;  1B44 D;  1XNR Q;  4CJ1 B;  1HZA A;  3W3A A;  4UXI A;  1ASZ A;  3RD4 A;  3KBG A;  1PRT D;  3AFP A;  4I7Z C;  2Z6B A;  1NY4 A;  1VQB A;  1IYV A;  4DUY Q;  3T1Y Q;  4CBV A;  3ZJY C;  2NTS A;  1SYD A;  2F0D A;  2NVT H;  3S16 B;  1ZYR D;  3C1F A;  5EBD A;  5KNC A;  5KYL A;  4XQJ A;  1B9M A;  3BDL A;  1J5E L;  1RL2 A;  1SDF A;  4C3I H;  4C3J G;  1DZ1 A;  3I3C A;  1OXU A;  2RAD A;  1KAA A;  1LTA D;  1Y1V G;  4C3H H;  1HPC A;  2B29 A;  4JI8 Q;  4DV1 L;  1YI2 A;  4RGN A;  4X65 Q;  2YFB A;  2EYP A;  4JOI A;  2RHS B;  2ENN A;  1YVC A;  2BCO A;  3S14 B;  1TS5 A;  3D3R A;  2MFI A;  4GI3 C;  4LWC A;  4BBR H;  3T16 A;  3P23 A;  2F0T A;  2J4X A;  3GQB A;  3T51 B;  1YJN A;  2G5D A;  3HFZ B;  3FPP A;  4JPB W;  1PTO F;  2NN6 H;  4JK1 C;  1ZXT A;  2VQE L;  2EYO A;  2WIN B;  5CGK A;  1EYA A;  2CWH A;  1BDO A;  5ELC A;  5E4W C;  2GA4 B;  1C48 A;  5J1Z A;  1UUC A;  2OCE A;  4PL5 A;  4J8Q A;  4NB3 A;  1YHQ A;  1E7Z A;  5J22 A;  4HID A;  1N36 Q;  4BY1 G;  5J8F A;  4EQO A;  3VA7 A;  1Q46 A;  1EZ8 A;  4A3G H;  3A7A B;  2ZJP A;  2A6H D;  1WJJ A;  3S1Q B;  3R8B A;  1FNW A;  2NB0 A;  1Z6H A;  3M4P A;  1PDQ A;  4NXN Q;  1Y1B A;  4B08 A;  2ICI A;  1EWC A;  3OYY A;  4GN5 A;  2B63 G;  2NBF A;  3H0G G;  3AEV A;  1C4Q A;  1N33 Q;  2NU4 I;  1VQL A;  1VQP A;  2Y0M A;  2D9U A;  3H3V I;  1QJO A;  3W1B A;  1PH9 A;  3T56 B;  1HNX L;  1PV4 A;  1HQR D;  3Q0A A;  1A2U A;  2F3C I;  5BN3 A;  1RTN A;  2KCC A;  4DR4 L;  4ODG A;  4A3K H;  1X3P A;  4JI6 Q;  4YHH L;  2UXD L;  2VB2 X;  2SGP I;  5T1G A;  1WTO A;  5C4X G;  2XIW A;  4OX9 L;  2ATW A;  1XMQ L;  5EX0 A;  2HCI A;  3S9W A;  4HJ5 A;  4HIK A;  5ELN A;  3Q6S A;  4JI3 Q;  5EKK A;  1KC8 C;  4UXH A;  5KRU A;  5C44 G;  1TWH H;  4DAV A;  3TZD A;  4DAY A;  2X69 A;  3MC0 B;  4C1N K;  4X64 L;  5IYC G;  3NE5 B;  3D31 A;  2CH4 A;  4QB4 A;  3F1Z A;  4YWL A;  4IUP A;  4MIU A;  4N8X 1;  2F52 A;  1QUQ B;  2MPM A;  1Y1W B;  3UGL A;  1GO3 E;  2N1A B;  1HTP A;  4KKU A;  2QIL A;  3NK9 A;  1EY4 A;  4IJL A;  1WTX A;  2E2J H;  2JA8 G;  1M1K C;  5KNB A;  2RLD A;  2K33 A;  2LFN A;  1DYQ A;  4ID6 A;  2ELI A;  4K2L A;  1SGR I;  1LUZ A;  1N8R C;  2D2C C;  1HA6 A;  5HQ8 A;  3OL0 A;  2V4D A;  1YHB A;  4XXE A;  1JE4 A;  2QZG A;  4KKT A;  2KEC A;  4FP5 D;  1BVS A;  4ZKB B;  4IPG A;  4RA8 A;  1VQN A;  3HOV G;  3R5C A;  1S3O A;  4LUO A;  1JJC B;  1UE7 A;  2M2L A;  4MPI A;  1FR3 A;  2ORV A;  4LFA Q;  3I4L A;  3K59 A;  3LGJ A;  3NHH A;  1BKB A;  4LUZ A;  2QQC A;  2H4O A;  1EIF A;  4HJA A;  4NDX A;  1JJG A;  1CT2 I;  4B3M Q;  1I4G A;  4CHT B;  1EY5 A;  2BL8 A;  2R6G A;  4KN7 C;  5E3F A;  4JI5 L;  3S1M B;  2N71 A;  1GKH A;  1EYC A;  1CQV A;  4LMQ D;  3PUV A;  1KDB A;  1KL9 A;  4BBS H;  3L3O C;  2JA9 A;  4CKE A;  4PZ7 A;  3MAQ A;  3B55 A;  2MJ8 A;  2R7Z H;  4ZAI A;  3NQT A;  1FJG Q;  2F0I A;  4XT3 B;  2LS0 1;  3PUX A;  1UVG A;  1VDZ A;  4PG3 A;  4O2D A;  1FD7 D;  3L0O A;  2ID0 A;  3BDC A;  3J81 E;  3GTO H;  5EX3 A;  4PV1 C;  4QL5 A;  2KBN A;  3HOU G;  2MO1 A;  1VQ5 A;  1M8A A;  2PW7 A;  1E2V A;  4BS9 A;  1BNZ A;  3CCV A;  4NMZ A;  1I50 B;  1CM9 A;  5IYB G;  4WJ3 M;  2JP1 A;  1M4V A;  3ULP A;  2XRC A;  1SGE I;  1K3B C;  4ZK9 B;  4H13 C;  3QTL D;  4CDD C;  1TKW B;  5CV6 A;  3IFT A;  1OMU A;  4U67 3;  2OU2 A;  1K0R A;  1BCP C;  2QQD A;  2HCC A;  4DV6 Q;  1CGI I;  4K14 A;  3AYH B;  3V05 A;  3J81 c;  3NPP A;  1WTP A;  1S5D D;  4UP8 A;  1PH2 A;  3EFX D;  1HNZ Q;  3AB9 A;  4KD3 A;  1ASY A;  3J7A 5;  2KMQ A;  1E22 A;  1IBL L;  2R7F A;  4LF4 Q;  3Q24 A;  3I9V 1;  1VF5 C;  4X6A H;  3A8J E;  3BYT B;  4X66 Q;  2VW9 A;  4Y52 H;  1I4Q A;  4DNT B;  2VXW A;  3K8A A;  1EZ6 A;  4ZYS A;  2FU2 A;  3D6W A;  3KLS A;  2AQ2 B;  1PLF A;  1SE3 A;  4AYB E;  5LMU Q;  1Q82 C;  2JYO A;  3SEB A;  4POF A;  4KY6 A;  2B3G A;  2IHF A;  3FNB A;  4YIJ A;  3J7Z C;  1VQ8 A;  3PO2 H;  1HHV A;  2ZM6 Q;  2VB3 X;  4A3C G;  1VQC A;  3GTL H;  2BE5 C;  2L15 A;  3PO3 G;  4PL4 A;  2DNE A;  1KIX A;  1PH7 A;  1QOH A;  4DN4 M;  2XGT A;  2XWJ B;  1XPO A;  1SYE A;  1FYB A;  1Z2I A;  3MXG A;  1Z9F A;  4JI7 L;  3FHW A;  2NVT B;  1DGS A;  2JZM A;  4IPH A;  4ALP A;  4AQY L;  4RAU C;  9WGA A;  2K4K A;  3M7G A;  2GKT I;  4BY7 H;  4C3I B;  2JA7 H;  2K1B A;  3GTJ H;  4A3I H;  1B4O A;  1EWI A;  1Q1E A;  3J7Y W;  4F88 A;  5I6W A;  4RGT A;  1I6V C;  2Q2T A;  2MGS A;  2G9D A;  4JBJ A;  1R0R I;  2CQA A;  4JYA L;  4L6T B;  3QO2 A;  3EN2 A;  3GV3 A;  4BBR B;  4AS3 A;  2L0C A;  1AW7 A;  3DA3 A;  4RFB A;  4L63 B;  2NZ1 D;  2B8T A;  4WJ4 A;  2F1M A;  3A54 A;  1KQS A;  5BN4 A;  4OHJ A;  1YIT A;  5FLX c;  2B2Y C;  3K5N A;  2B2Y A;  4Q0F A;  1MJA A;  1V1Q A;  2IT1 A;  1B53 A;  3AJF A;  1H9K A;  3JSB A;  4GXT A;  3CU7 A;  4DV7 L;  3K81 C;  2GVI A;  1OXX K;  2E5L L;  1XNQ Q;  1QNK A;  3R5A A;  3KF6 B;  5C0X H;  2EJM A;  3DM3 A;  1PH6 A;  1X9N A;  2ZXP A;  2YTY A;  3N52 A;  4A3L G;  1EYD A;  1B1Z A;  4DU9 A;  3K0Y A;  5LMN W;  4DV4 Q;  2L5T A;  3OXG A;  1SYF A;  4K0K Q;  3MHB A;  2XTQ A;  2K5H A;  1BQQ T;  4MN3 A;  4UY8 C;  4RGM A;  3M3Y H;  4A3G B;  2VUM H;  5K36 H;  1VQD A;  4DR5 Q;  1A63 A;  4K6L A;  1BCP D;  3NBH B;  3CCJ A;  1UVF A;  1RD9 D;  1A15 A;  1TWF H;  4FKD A;  3P7J A;  1Q7Y C;  3G71 A;  5EPJ A;  1Y8O B;  5DM6 3;  2EYJ A;  1PH5 A;  1STY A;  3HP3 A;  1TII D;  3M4Q A;  5BR8 Q;  1D1I A;  2C35 B;  1II3 A;  1PZK D;  3R2T A;  1TWA H;  5KEE A;  2MQH A;  3MZ5 A;  4C56 C;  4B3R L;  2YU9 B;  4JI2 Q;  4U6R A;  1K83 B;  4IUU A;  1MBY A;  1ICW A;  1L1O B;  4LJZ C;  4QIW E;  4LF8 L;  2PQ8 A;  2QGQ A;  5J8C A;  2FJ2 A;  3H3V C;  3GTM B;  5M9O A;  3QOJ A;  2JA6 B;  3M4O H;  2PQA B;  1PTO B;  3CCS A;  3UEY A;  5FJ8 H;  4DA2 A;  3V2T A;  1CA5 A;  5JJZ A;  2F66 B;  2LXJ A;  4I65 A;  4O1O A;  3L0I A;  5FLM H;  4TQU S;  5C3X A;  2BE5 D;  5KND A;  3A5Z B;  1YJW A;  3W1G A;  1G8Z D;  3G48 A;  4X3T A;  4IOC A;  2Q8T A;  2PMZ E;  2O5J C;  3K7A B;  4MHE A;  2RDG A;  1JE5 A;  1KAW A;  1UWV A;  3DWA A;  5CV8 A;  2L55 A;  2F0V A;  5M3F G;  5CV4 A;  3RU0 A;  3ZYY X;  4OON A;  2YQP A;  4JV5 L;  1E2W A;  2A73 B;  1N13 A;  1Y8N B;  5C5M A;  4JI4 Q;  2M9V A;  1Q90 A;  2DNC A;  1SRO A;  5AFW A;  2UUB L;  3BG3 A;  3KK7 A;  5JPN C;  4NW2 A;  3QWP A;  2ZXO A;  2E74 C;  1BUS A;  4OWT B;  3C46 A;  4DK1 A;  2JXD A;  4OO1 I;  2ZJQ A;  5IP7 G;  2R93 H;  2B2U C;  2Q2I A;  1WCM H;  3VYU A;  4HEA 1;  2L1B A;  1IBM Q;  2B2U A;  5FOB B;  4YCW A;  1EQT A;  2F0P A;  1SGN I;  3DEO A;  3QJY A;  1Q1B A;  3J7A F;  1SE8 A;  2JB2 A;  4JI0 Q;  1H9M A;  1O7L A;  4YZ9 A;  2O2L D;  1U9R A;  2MJF B;  4FXD A;  2QPO A;  2EYM A;  2NU2 I;  5CC4 A;  1U0L A;  1A62 A;  2Z8L A;  1K9M C;  2F0S A;  3TRE A;  2IX1 A;  1SN8 A;  3R5D A;  2CFM A;  1EY7 A;  3TQY A;  1SNC A;  2Y0S B;  5IIF A;  3KJO A;  1I94 L;  3PF4 A;  1VQJ A;  3SGI A;  3CC2 A;  1KBF A;  1HNW L;  2A69 C;  3HOY H;  5C4Z A;  4DNR B;  3BZD B;  2UXB L;  1EOT A;  3G4S A;  1N32 L;  4BBS B;  3VDU A;  3S17 H;  4GKK Q;  1NXU A;  4GOP B;  2DN8 A;  2R7Z B;  4A3B B;  1PRT C;  3HOZ H;  1TS4 A;  3H6M A;  5I2X A;  4B3T L;  2OZU A;  3TOB A;  1JCK B;  1WTJ A;  5C3E B;  4A3J G;  4B6D A;  5EAY A;  3VYS A;  5IP9 H;  1ROD A;  4DV0 Q;  3I4N B;  1LTL A;  4J1M A;  1KXL A;  2LB7 A;  1T9H A;  1YHA A;  5I2Y A;  1LT5 D;  1HR0 L;  5FUY A;  1UE5 A;  3K58 A;  4OIK A;  3GTO B;  2WGC A;  1IW4 A;  2EJG C;  1DD2 A;  1HFN A;  1XA6 A;  1CZG A;  1AZQ A;  2B8F A;  3M85 A;  3FC3 A;  4KY7 A;  1PMR A;  1SYG A;  4DK6 C;  1J5E Q;  4A3M H;  4DF7 A;  2RIO A;  4ZCK A;  1N34 Q;  1HJP A;  5CCM A;  2JSO A;  4FVM A;  4DV1 Q;  1Q86 C;  3CPF A;  3K5M A;  2TMP A;  2QA4 A;  2KMO A;  4POG A;  5COY A;  2YYZ A;  3ERS X;  3LWU A;  1YBY A;  2F0E A;  3VYT A;  1HUM A;  2ENZ A;  4NV2 A;  3NSW A;  4ULL A;  3VR3 A;  5JOB A;  2DJG C;  4HJ9 A;  3C3L A;  4TKO B;  2NVY H;  3GTP H;  4UP7 A;  2B8G A;  1WGT A;  4LF9 L;  1PFM A;  4NKL A;  3PF5 A;  2CKZ B;  3U9O A;  2BA1 A;  2XMX A;  3HKS A;  1AP0 A;  1SGP I;  4A3D B;  1EYG A;  4G7O C;  3DLL A;  1RFH A;  1YIJ A;  4R1J A;  2CWP A;  4HGU A;  2KEN A;  4BWG B;  1MKH A;  2PNR C;  1SND A;  4DGZ A;  1VQK A;  2XNA C;  4CDE C;  3CCQ A;  1PVO A;  1HZB A;  1WOC A;  3PO2 B;  3B4V C;  1SBB B;  1IYU A;  3F2U A;  4GN4 B;  2H5X A;  1TXY A;  1NTG A;  3GTL B;  1H0Z A;  1MGS A;  1EQR A;  3CCU A;  5JVH 3;  1IY5 A;  3QR8 A;  3OMG A;  2UU9 Q;  5C5L A;  1WKX A;  1IBK L;  3F8T A;  3SK4 A;  4CKB A;  5IGC A;  4C3J H;  3OW7 A;  5AJ3 Q;  2JB3 A;  2PZW A;  2VNU D;  5CV7 A;  4RCN A;  2JBW A;  4BY7 B;  3J80 L;  5JJL A;  1I5F A;  4M1U B;  1HNX Q;  2F03 A;  2A20 A;  1HA5 A;  4A3I B;  5JJK A;  2A69 D;  4DR4 Q;  2BDN A;  4EX5 A;  3SEK C;  1TWG B;  1VQM A;  1LR7 A;  1FVI A;  3CRK C;  4YHH Q;  2OTL A;  2L11 A;  2N88 A;  2UXD Q;  1MIU A;  1SNQ A;  1PTR A;  3CCR A;  3STB C;  1H9R A;  2N52 A;  5HGQ A;  5KGU A;  2FHT A;  2J7Z A;  2O4X A;  1K7T A;  1W6J A;  3H94 A;  3CME A;  3H3V H;  2E76 C;  1JMC A;  4E1P A;  1PZJ D;  1TBN A;  1SFO H;  3OVO A;  4Q5V A;  1VMP A;  4K6D A;  4X64 Q;  4RH6 A;  4QCL A;  1PA6 A;  4BXX H;  2EOT A;  2XWB B;  1ET9 A;  1NE3 A;  4DAY B;  3ICE A;  4GZY C;  1V1I A;  4DK0 A;  2EDG A;  3R93 A;  1TU2 B;  4NP5 A;  5I4D A;  2A2D A;  3HKZ B;  1CI3 M;  2DGY A;  4BY1 H;  4K5V A;  3TJQ A;  1BBX C;  1XMO L;  1V1O A;  2M5X A;  4XIG S;  3C2P A;  4R4I A;  4Y7N H;  2RHQ B;  1OTC A;  1ENC A;  3NWS A;  3SR1 A;  4JOI C;  3DM1 A;  2B63 H;  3I91 A;  4K8I A;  2CWA A;  1I6H B;  3H0G H;  2VUM B;  4ILW A;  1PRT F;  1KBE A;  1TY2 A;  5JAV A;  3J81 i;  4A3E B;  2YUU A;  3QAH A;  2J87 A;  1TWF B;  3HOW G;  1PZI D;  5JEA G;  1PH3 A;  1WI5 A;  3D4D A;  2RKS A;  2WAQ E;  1LTG D;  3EIV A;  3UDX A;  2NTT A;  1TWA B;  4E1R A;  3TS0 A;  3CAM A;  5E3Q A;  2BL7 A;  5C4X H;  1VQE A;  2JQO A;  3OIP A;  3CQZ H;  2AQ3 B;  3T4A C;  2WV6 D;  2JW6 A;  5C44 H;  3I90 A;  1UEB A;  3GTQ H;  1JB3 A;  4L9M A;  1WVL A;  1GJX A;  1SJE D;  1CZW A;  1PH4 A;  4JI5 Q;  3M4O B;  3CHB D;  3E2I A;  1SMX A;  1L2F A;  3EA6 A;  2QGM A;  3ND8 A;  4HTH A;  3PIO 3;  4A93 B;  2QCP X;  4YY3 L;  2VL6 A;  1CSQ A;  4AIM A;  1DXM A;  5ISR A;  1VQ4 A;  4ZQ3 A;  3S2H H;  1JR0 D;  1SNP A;  4NXM L;  2PQE A;  1RDP D;  4Z7G A;  3LWE A;  1HJA I;  3NQI A;  4LF6 L;  1VQ6 A;  3UDI A;  4CGY B;  4F8M A;  5IWA L;  3TME A;  2FFK B;  1EIG A;  2SGQ I;  1LT4 D;  2F0M A;  4JI1 L;  1K28 A;  1CKM A;  2ES2 A;  3T1H L;  3RLO A;  3D4W A;  1D5M C;  3RZD B;  3IFD A;  1FAQ A;  2KEE A;  4I7A A;  2Z6K C;  3ERQ A;  4IN3 A;  2ODD A;  3I7F A;  2Z6K A;  3GTG H;  2AKW B;  3HOV H;  3STB D;  2VS1 A;  2WB1 E;  3VR5 A;  2CW0 D;  1U4M A;  4XYO A;  1F9P A;  2K5D A;  4EQ5 A;  4E6I A;  3NTK A;  1GOZ A;  2EVB A;  3OXF A;  1EQQ A;  2JXM B;  3I4M B;  4DR1 L;  2C5C A;  1VS0 A;  1XNR L;  4KHP L;  4MZ9 A;  2MP1 A;  2LSS A;  2CJS C;  4DV3 L;  2R7D A;  4ME3 A;  3VR4 A;  4L8J A;  2F0H A;  1KLG D;  3EJI A;  5GRO A;  3U9S A;  3HOY B;  4DUY L;  1TT2 A;  1HXY D;  3N6R A;  1VQA A;  3T1Y L;  1YU6 C;  4FXG C;  3HG9 A;  2DB6 A;  3MEH A;  3ERO A;  4KMU C;  5FK9 C;  3S17 B;  4P2C B;  1QZG A;  4QGU A;  3D4R A;  1O7Z A;  3MFG A;  5CV5 A;  1RIP A;  3DUZ A;  3HOZ B;  1PYB A;  2FXQ A;  4DUZ L;  3HOU H;  2NU1 I;  1DOL A;  5BN5 A;  4JI8 L;  5LMN Q;  1TWC H;  4QY7 A;  4X65 L;  3FPU B;  1EY8 A;  5IYB H;  5IGD A;  3B6Y A;  1CTM A;  2GKR I;  1HUN A;  1LTS D;  2L4N A;  1FYC A;  2PNH A;  3FMC A;  7WGA A;  5EPL A;  4DXG A;  1V43 A;  2EY6 A;  1WD0 A;  2GKV A;  4JI7 Q;  5M5X H;  2SOB A;  3HOX G;  1X54 A;  1C7Y A;  4B3S L;  4GKJ Q;  4JCV E;  3TS2 A;  4DR6 Q;  4KD4 A;  2FEF A;  1EY0 A;  2ZTE A;  1VMC A;  2K01 A;  4A3M B;  2JA6 G;  1C9O A;  1CKO A;  1R4Q B;  2R92 G;  1BBU A;  1Y69 U;  2WB1 B;  4HAE A;  2UUA Q;  2X52 A;  5M3M B;  3EQL C;  2OT2 A;  2KHJ A;  3BJU A;  3JAM L;  2HDL A;  1QNU A;  3TN2 A;  3SXH A;  4JYA Q;  2ZT9 C;  5IGF A;  3AMU A;  1PJU A;  2A2C A;  1JB7 A;  1X65 A;  3UIT A;  3H91 A;  2LXK A;  3TP7 A;  1YNX A;  4CJ2 C;  5CBE E;  2NVY B;  4G75 A;  3TO6 A;  3GTP B;  2A19 A;  2D5D A;  3WOE A;  1S72 A;  1C0A A;  2AMC B;  2EYL A;  4UDU C;  2VRW B;  3A5U A;  1L0Y B;  3PIP A;  1B3Q A;  4O0A A;  2F4I A;  1K7U A;  1SGD I;  4NXN L;  3NTI A;  3CCL A;  3FKI H;  4A3C H;  2EY5 A;  5IT9 L;  3ULL A;  2Z0S A;  1VQ7 A;  3VYR A;  1IL8 A;  3PO3 H;  1GUO A;  1JWS D;  1IHZ A;  4JG2 A;  4JVZ A;  1A3T A;  3LJ0 A;  1PYW D;  5IOC A;  4A3F B;  1CT1 D;  5M5W H;  1C8C A;  3RLN A;  4DAM A;  3J80 E;  4IUV A;  3NWT A;  2JA5 G;  3E0J A;  4ZUI A;  4NPS A;  2KCT A;  3K80 C;  4JI6 L;  4PMB A;  4C2M H;  2RQX A;  4HCS A;  1W6K A;  3E5S A;  3QIA A;  3PSI A;  1EEI D;  1FGU A;  3UEJ A;  3MXN B;  2YV5 A;  4C3J B;  5EGT A;  5EPK A;  3MEK A;  1R9T B;  5ELO A;  1H9S B;  4N9P A;  2UUC L;  3EVQ A;  4JI3 L;  2Y0S G;  4EQN A;  3UE1 A;  1Q8K A;  4DWL A;  4P74 A;  4APV A;  1AH9 A;  1VQI A;  1ZEQ X;  1O7Y A;  4JW0 A;  1QWY A;  1QUQ A;  2PYK A;  5A2Q L;  1IY6 A;  2KCX A;  3PUW A;  2DIP A;  2OD1 A;  4FF2 A;  3A8I E;  2OXP A;  2EXD A;  4IPD A;  3A7L A;  3BDO A;  2PI2 A;  2XN9 C;  1M8B A;  3NUC A;  4KKS A;  2WKC A;  4J6H A;  1IL2 A;  4A3B G;  3OHX C;  5HY6 A;  5ELF A;  5C3E G;  3CMA A;  3I4N G;  1Z7T A;  1SFO B;  3TRZ A;  1S4Z A;  1STA A;  2KVM A;  1E1O A;  2GSC A;  5ELB A;  1TOT A;  1ICF B;  2YTV A;  1F9Q A;  1NNX A;  2X6L A;  3BYY B;  5G3L D;  1LYL A;  1Q9B A;  4FF4 A;  3VR6 A;  1GM5 A;  1HFG A;  1HZC A;  5IOD A;  4A3L H;  1XX6 A;  2FMC A;  3A0J A;  2XSC A;  1JOQ A;  4BY1 B;  1Q81 C;  4HN7 A;  3R3O A;  2CWF A;  3V96 A;  1E3P A;  4JV5 Q;  1QCB D;  4C3H B;  3QB3 A;  1KNE A;  2N3S A;  4Y7N B;  1JOK A;  3F4M A;  5C4J H;  1PTQ A;  3S24 A;  2B63 B;  1GHK A;  1B8A A;  4DR2 Q;  1JOO A;  2LY7 A;  2K5N A;  4R8N A;  3H0G B;  3OTO Q;  4HIO A;  1EFW A;  4G76 A;  1MI2 A;  2EZV A;  3RZO H;  3TBI B;  2W0T A;  4EQP A;  4ZLT F;  3KFU A;  1KNA A;  2A8V A;  4B3M L;  2WVJ A;  4OWX B;  2XRQ D;  2HHH L;  1ET6 A;  2KHI A;  4OXP A;  1XBT A;  3KF8 B;  1CT0 I;  2QDB A;  2F0K A;  3GD7 A;  5D3D A;  2I5L X;  2NUC A;  4A3D G;  1Y1C A;  2EYF A;  4B9X A;  4O1P A;  4V0B A;  4AYB B;  4IJH A;  4IUN A;  4OO1 H;  2N49 A;  3CQZ B;  5LL6 S;  3EBE A;  5DAU A;  2F4V L;  1X3E A;  3CC7 A;  1NR2 A;  2CHB D;  4TRD A;  3GTQ B;  1HNW Q;  2E8G A;  2QEJ C;  3CC4 A;  2CH4 W;  2GN5 A;  2UXB Q;  3S16 H;  1SJ8 A;  1N32 Q;  1CKN B;  1E2Z A;  3JC6 6;  1TUR A;  2PZU A;  1D6E C;  2Z1C A;  1TDP A;  1RF2 D;  1N9W A;  1F9R A;  4X62 Q;  5M3F H;  4KHV A;  5H1S E;  3S2H B;  1NMG A;  4HR7 B;  4B3T Q;  2JK8 A;  1K7V A;  3QG1 A;  1NBW A;  4RGO S;  3KOJ A;  4BY7 G;  2ZTD A;  4GLX A;  1PRT B;  3S14 H;  4DV6 L;  1CFM A;  4IAL A;  5KYI A;  5IP7 H;  1WTH A;  4A3K B;  4RCO A;  1G6P A;  2FUG 1;  1AFP A;  4C1N I;  1V1P A;  3W5O A;  5COR A;  2BA0 A;  1IZ6 A;  3KUP A;  3KLR A;  3GTG B;  3CCM A;  1WTW A;  1MSH A;  2BDO A;  1D5Z C;  1BCP F;  3HOV B;  1HRJ A;  5IGG A;  3P1H A;  4LFB Q;  1D2B A;  1TWH B;  1YEZ A;  1NJI C;  4GNX B;  1X4S A;  4LF7 Q;  4L5R C;  4DV2 L;  2NZH A;  1MD2 D;  4GS3 A;  3KLW A;  4RWS C;  2KMR A;  4LF9 Q;  4A75 A;  5F2D A;  4P73 A;  4EGV A;  1VQO A;  1Y14 B;  2LKV A;  1PPF I;  3S1Q H;  2E2J B;  3M9B A;  3MVV A;  1RCV D;  1SAP A;  2IWH A;  1LV9 A;  3GTK H;  1WTQ A;  1FL0 A;  1LTB D;  2E75 C;  3NP8 A;  4R4C A;  4LFC L;  3M7N A;  3GO5 A;  4GLV B;  2KCM A;  3NEN A;  5K36 G;  4A3J H;  1CSP A;  5GAE C;  2XTR A;  2K75 A;  2K03 A;  4UHV A;  4A3E G;  2SGF I;  2IJ0 A;  3IKJ A;  1WD1 A;  1TGS I;  1W3S A;  1ML0 D;  1RHP A;  2IY5 B;  1AN1 I;  2XVS A;  2PZT A;  2IW3 A;  2PPB C;  5IYD G;  1H9J A;  3E6Z X;  2GIV A;  3HOU B;  1AE2 A;  1O78 A;  1VQ9 A;  4G57 A;  1TWC B;  4JBW A;  1IKL A;  4JBM A;  1T5E A;  1XYI A;  3KP9 A;  2KOL A;  4QUF A;  1IBK Q;  3I73 A;  3GV6 A;  4KV6 A;  2KHS A;  1TIH A;  3JAM E;  3BU2 A;  4QIW B;  1SMY C;  1IYJ B;  3VDY A;  5ELE A;  1EQV A;  4OEL B;  4HSV A;  2V1C C;  3D00 A;  1WTV A;  1B50 A;  2V1C A;  1S5F D;  3H09 A;  3RLF A;  3DWQ A;  4MTK A;  3HEJ A;  3KF6 A;  3R2I A;  3DO9 A;  1BXT A;  4PNY A;  1JQY D;  4A93 G;  4HIM A;  3A74 A;  2BOS A;  1F2L A;  2PW5 A;  5I9O A;  3K57 A;  1XNQ L;  1K8G A;  1S5C D;  1S5B D;  3L9A X;  2P22 B;  3GP7 A;  2PMZ B;  3CXC A;  5IT9 E;  2X3T A;  2Z4I A;  3JAM c;  2Z4H A;  1TBR R;  4DV4 L;  3NBH A;  5CR3 A;  4CKC A;  2CAZ B;  1DCZ A;  3RR5 A;  2B2V C;  1HZ9 A;  1W2B A;  1YNN C;  2E2D C;  2F0F A;  1B70 B;  2B2V A;  3BS1 A;  4U68 A;  2JA1 A;  3IAM 1;  3FKI B;  2K5V A;  3A56 A;  1XMO Q;  1DS2 I;  1EFI D;  3PO3 B;  4P71 A;  4RHR A; 
#chains in the Genus database with same CATH homology
 5HI7 A;  2K19 A;  3NEM A;  4JI2 L;  5GQO A;  4LF5 L;  2PQA A;  4DPG A;  2B0U C;  3I4M G;  1Y1W G;  4A76 A;  1MT1 A;  4YCV A;  2AHO B;  1V1H A;  2JEA I;  2VQE Q;  2I0Q A;  4IOA A;  2VQF L;  3E9I A;  1KHI A;  3K7U C;  4DKA C;  1QVC A;  1GVP A;  2ZRR A;  3PGZ A;  1I3Q H;  4YY3 Q;  2UXC L;  2DUD A;  2BH2 A;  2XTI A;  1D7Q A;  1Y1V H;  3WWV A;  4LF6 Q;  5HGI A;  2KKM A;  2A1A A;  2EQS A;  3KYH C;  2FNF X;  1YO7 A;  4QJF A;  4JI1 Q;  1H95 A;  3T1H Q;  1X3F A;  2OQ0 A;  1E1T A;  4DV5 L;  3F2B A;  5FUV A;  1S40 A;  5M3M G;  3HOW H;  1SLJ A;  4OX9 Q;  1XMQ Q;  3MEF A;  1Z47 A;  2ORW A;  4BA2 I;  3AQQ A;  1G29 1;  4GOP A;  3KDF A;  1PYS B;  2YTX A;  4IFD G;  4JC0 A;  1O7I A;  4DR1 Q;  4KHP Q;  2MNA A;  4DV3 Q;  4A4I A;  4DV0 L;  1X6O A;  4A3F G;  5J3B A;  1OXV A;  2E2H H;  1PH8 A;  3BZC A;  1A0I A;  1QZH A;  3I55 A;  1TUS A;  3CF5 A;  1OMT A;  3E0E A;  5GAD C;  2OWO A;  3S1N H;  4DUZ Q;  2I5H A;  2AWO A;  1N34 L;  2UZ3 A;  4YZD A;  3L2P A;  5GAH C;  4IFD I;  4A24 A;  1LM0 A;  4DR7 L;  1MJC A;  1XJV A;  4R4T A;  1XPR A;  4B3S Q;  4P72 A;  3J80 i;  3SGQ I;  3U4V A;  2NVX H;  2MO0 A;  4RMF A;  1XPU A;  2E73 A;  5IYC H;  4LUV A;  4IPC A;  4KLK A;  4DR3 L;  1X56 A;  2ASB A;  1BMO A;  1E24 A;  2D0P A;  4BXX G;  2HIX A;  4YZC A;  1FAR A;  2JA8 H;  2PI2 E;  3F2C A;  1Q12 A;  3PUZ A;  3S15 H;  3PV0 A;  1MJE A;  4BA1 I;  2UU9 L;  1P16 A;  1M90 C;  2N8N A;  1W4R A;  3CD6 A;  2NU3 I;  5LNK 1;  3IAS 1;  4BBR G;  5AJ3 L;  2GVB A;  2CCZ A;  4IFD J;  1DS3 I;  1PH1 A;  2YU9 H;  4L5Q A;  1K83 H;  3HOX H;  1R79 A;  3Q8D A;  2NN6 G;  3GTM H;  2N78 A;  1EOV A;  4AH6 A;  2JA6 H;  1IBL Q;  4AYB G;  2R92 H;  3UDF A;  4OAV B;  2UUC Q;  2L8E A;  1X3G A;  2IX0 A;  2ROW A;  3GOX A;  1L0W A;  5JEA J;  5DLQ E;  4A3G G;  3BJI A;  3RNU A;  3K7A H;  1J6Q A;  4TVA B;  5M5Y H;  3G6E A;  3U50 C;  1IXR A;  2QQ0 A;  4PMW A;  1U5K A;  2NN6 I;  3OXL A;  4YWM A;  4A3K G;  5GAG C;  4AQY Q;  5JHW C;  2LEO A;  4XTC S;  2JA5 H;  1VQH A;  2E2I H;  1B7Y B;  3U4Z A;  3S1R H;  2JB1 A;  2EIF A;  3HH2 C;  3FP9 A;  2BH8 A;  2HHH Q;  4KI0 A;  1N36 L;  1YTP A;  2RF4 A;  4YWK A;  3UFF A;  3UDG A;  1EIY B;  4DV7 Q;  2E5L Q;  2AWN A;  2YFA A;  1V9P A;  5IY0 A;  4A3B H;  2F4V Q;  5C3E H;  1KD1 C;  1N33 L;  3I4N H;  2ZJR A;  3NEL A;  3PDN A;  4SGB I;  3VA9 A;  4HJ7 A;  1OVO A;  1VQF A;  2NVQ H;  3ER0 A;  3SGB I;  3CP0 A;  1CT4 I;  3LJ1 A;  3H15 A;  2E5R A;  4B3R Q;  1KRS A;  3BZK A;  2OQK A;  4AS2 A;  1XTD A;  3KY9 A;  3J80 c;  4LF8 Q;  4BBS G;  4KHZ A;  2R7Z G;  1SGQ I;  4JBK A;  3JAM i;  4A3D H;  4HJ8 A;  5E7N A;  2F3I A;  4UP9 A;  3CCE A;  3I56 A;  3E59 A;  2RCN A;  1X55 A;  4DV2 Q;  4I1T A;  5JJI A;  2CQO A;  3FKI G;  3UE0 A;  2LUY A;  5LMN L;  3S2D H;  2WFW A;  2UUB Q;  4GLA C;  4LFC Q;  4LFA L;  1VDD A;  1D8L A;  2ARP F;  4GKJ L;  2NZO A;  4DR6 L;  1K73 C;  2OVO A;  2ERW A;  5FUW A;  4J15 A;  1UE1 A;  1SR3 A;  2JE6 I;  1TWG H;  2JJQ A;  3DA4 A;  2UUA L;  4PZ6 A;  1FJG L;  1I94 Q;  1K8A C;  3PO2 G;  3IRB A;  4DNI A;  1QVG A;  2P6A C;  3D0F A;  2VZA A;  1NMF A;  2IP6 A;  2OTJ A;  3UGI A;  2SGD I;  3I2Z A;  1EUJ A;  2JA7 G;  2K9H A;  1OXS C;  1HR0 Q;  1G51 A;  4A3I G;  1X74 A;  4A3E H;  2SGE I;  2J9R A;  1HNZ L;  1SRU A;  2Q2U A;  5IYD H;  4LF4 L;  4UXJ A;  2D62 A;  1CE3 A;  3UGD A;  1UE6 A;  4MNO A;  2Q2H A;  3PCO B;  4X66 L;  3PIO A;  1WYD A;  1JJ2 A;  4DK3 C;  4PZ8 A;  2V6E A;  5LMU L;  1AE3 A;  4LF5 Q;  2D0O A;  4UPA A;  1CUK A;  2Y0S E;  3E9H A;  3HKZ G;  2ZM6 L;  4R4O A;  2L1L B;  5C0X G;  4OO1 G;  1VQG A;  4A93 H;  1PHJ A;  4R4Q A;  5IE8 A;  3OW2 A;  3CXL A;  3PUY A;  1WFQ A;  2VQF Q;  2VUM G;  4H02 A;  2K52 A;  3LJ2 A;  2GVA A;  1LR8 A;  2HQL A;  2BUS A;  3RN2 A;  4OWW B;  2ALY B;  3RZD H;  3K0X A;  2UXC Q;  1PFS A;  4GN3 B;  3U58 A;  1OXT A;  4DR2 L;  3OTO L;  1Z7K B;  5C0X I;  1QVF A;  2JAE A;  4LW1 A;  1HDL A;  1TBO A;  1P8L A;  4QQB X;  4L5T A;  5FJ8 G;  2WCY A;  4DV5 Q;  5FLM G;  4Z7H A;  3I4M H;  2NU0 I;  1PCE A;  1Y1W H;  1HH2 P;  3VE5 A;  1YJ9 A;  1M8C A;  3CPW A;  4OAU C;  3VDP A;  1CSO I;  1BBW A;  3I4O A;  1CKN A;  4RG1 A;  4K0K L;  1A8V A;  2L7X A;  4MTN A;  4DR5 L;  1KMA A;  3KDF B;  5CCL A;  4X62 L;  2JEB I;  5BR8 L;  4HFV A;  1L1O C;  4PL3 A;  4LNQ A;  2R93 G;  5IT9 c;  1WCM G;  2K50 A;  1L1O A;  4Q9V A;  2WP8 J;  2HIV A;  4NV5 A;  1HPT A;  4OVO A;  3J81 j;  2IHE A;  5C0X J;  2WAQ G;  4P75 A;  2N17 A;  3ULJ A;  2VY3 A;  2ZTC A;  4GNX C;  2QQE A;  3S1M H;  2QEX A;  3KJP A;  1CGJ I;  4GNX A;  2F6M B;  4LFB L;  5M3M H;  3HOY G;  4DR7 Q;  3F2D A;  4LF7 L;  2JYY A;  2KMP A;  5DAE A;  1SGY I;  1Y8F A;  3HOZ G;  3FBV A;  4IO9 A;  1HR0 W;  4DR3 Q;  4JI4 L;  5IP9 G;  1GD7 A;  1I50 H;  2K14 A;  3HKZ E;  4FDB A;  4NXM Q;  4YCU A;  3AFQ A;  1IBM L;  5IWA Q;  4A3F H;  1CHO I;  4A3M G;  3L7Z C;  5FUX A;  4JI0 L;  2HT1 A;  2V53 A;  1LR9 A;  2WB1 G;  1NUB A;  3GDE A;  1JT8 A;  1TBQ R;  3CW2 C;  1R9T H;  1YZ6 A;  4L5S A;  3SDJ A;  1K3R A;  4GOP C;  3TEH B;  1OYV I;  1KRT A;  2I5M X;  4GKK L;  1VCI A;  3RN5 A;  1XNR Q;  1HZA A;  4UXI A;  1ASZ A;  3AFP A;  1NY4 A;  1VQB A;  4DUY Q;  3T1Y Q;  3ZJY C;  2NVT H;  1J5E L;  1RL2 A;  4C3I H;  1OXU A;  4C3H H;  1Y1V G;  1YI2 A;  2B29 A;  4JI8 Q;  4DV1 L;  4X65 Q;  2YFB A;  4JOI A;  2RHS B;  2ENN A;  1YVC A;  4GI3 C;  2MFI A;  4LWC A;  4BBR H;  3P23 A;  1YJN A;  3HFZ B;  2VQE L;  1UUC A;  2OCE A;  4PL5 A;  4NB3 A;  1YHQ A;  1E7Z A;  4HID A;  1N36 Q;  4BY1 G;  1Q46 A;  4A3G H;  2ZJP A;  1WJJ A;  3M4P A;  4NXN Q;  1Y1B A;  3OYY A;  4GN5 A;  2B63 G;  3H0G G;  3AEV A;  1N33 Q;  2NU4 I;  1VQL A;  1VQP A;  3H3V I;  3W1B A;  1PH9 A;  1HNX L;  1PV4 A;  2F3C I;  4DR4 L;  4A3K H;  4JI6 Q;  4YHH L;  2UXD L;  2SGP I;  5C4X G;  4OX9 L;  2ATW A;  1XMQ L;  5EX0 A;  4HJ5 A;  4HIK A;  5ELN A;  4JI3 Q;  1KC8 C;  4UXH A;  5C44 G;  1TWH H;  4X64 L;  5IYC G;  3D31 A;  3F1Z A;  4YWL A;  2F52 A;  1QUQ B;  3UGL A;  1GO3 E;  2N1A B;  4IJL A;  2E2J H;  2JA8 G;  1M1K C;  2ELI A;  1SGR I;  1LUZ A;  1N8R C;  5HQ8 A;  3OL0 A;  1YHB A;  1BVS A;  1VQN A;  4IPG A;  3HOV G;  1S3O A;  4LUO A;  1JJC B;  1UE7 A;  2ORV A;  4LFA Q;  3LGJ A;  1BKB A;  4LUZ A;  2QQC A;  1EIF A;  4HJA A;  1JJG A;  1CT2 I;  4B3M Q;  2R6G A;  4JI5 L;  2N71 A;  1GKH A;  3PUV A;  1KL9 A;  4BBS H;  2JA9 A;  4PZ7 A;  2R7Z H;  1FJG Q;  3PUX A;  1UVG A;  4PG3 A;  4O2D A;  3L0O A;  2ID0 A;  3GTO H;  5EX3 A;  4QL5 A;  2KBN A;  3HOU G;  2MO1 A;  1VQ5 A;  3CCV A;  5IYB G;  4WJ3 M;  2XRC A;  3ULP A;  1SGE I;  3QTL D;  1OMU A;  1K0R A;  2QQD A;  4DV6 Q;  1CGI I;  3AYH B;  3J81 c;  4UP8 A;  1PH2 A;  1HNZ Q;  1ASY A;  3J7A 5;  2KMQ A;  1E22 A;  1IBL L;  2R7F A;  4LF4 Q;  3I9V 1;  4X6A H;  4X66 Q;  2VW9 A;  4Y52 H;  3K8A A;  4AYB E;  5LMU Q;  1Q82 C;  4POF A;  2B3G A;  2IHF A;  3J7Z C;  1VQ8 A;  3PO2 H;  2ZM6 Q;  4A3C G;  1VQC A;  3GTL H;  2L15 A;  3PO3 G;  4PL4 A;  1KIX A;  1PH7 A;  2XGT A;  1XPO A;  1FYB A;  1Z9F A;  4JI7 L;  3FHW A;  1DGS A;  2JZM A;  4IPH A;  4ALP A;  4AQY L;  2K4K A;  2GKT I;  4BY7 H;  2JA7 H;  3GTJ H;  4A3I H;  1EWI A;  1Q1E A;  2Q2T A;  4JBJ A;  1R0R I;  4JYA L;  3EN2 A;  4AS3 A;  2B8T A;  3DA3 A;  4WJ4 A;  1KQS A;  1YIT A;  5FLX c;  1V1Q A;  2IT1 A;  3AJF A;  3JSB A;  4GXT A;  4DV7 L;  3K81 C;  2GVI A;  1OXX K;  2E5L L;  1XNQ Q;  3KF6 B;  3DM3 A;  1PH6 A;  1X9N A;  2YTY A;  4A3L G;  5LMN W;  4DV4 Q;  3OXG A;  4K0K Q;  1I6H H;  2XTQ A;  2K5H A;  3M3Y H;  4UY8 C;  2VUM H;  1VQD A;  4DR5 Q;  1A63 A;  3NBH B;  3CCJ A;  1UVF A;  1TWF H;  4FKD A;  1Q7Y C;  3G71 A;  1PH5 A;  3M4Q A;  5BR8 Q;  2C35 B;  1TWA H;  2MQH A;  4B3R L;  4JI2 Q;  4U6R A;  4QIW E;  1L1O B;  4LF8 L;  2QGQ A;  3M4O H;  2PQA B;  3CCS A;  3UEY A;  5FJ8 H;  2F66 B;  2LXJ A;  4O1O A;  3L0I A;  5FLM H;  4TQU S;  3A5Z B;  1YJW A;  3W1G A;  3G48 A;  4IOC A;  2PMZ E;  1JE5 A;  1KAW A;  1UWV A;  5M3F G;  3RU0 A;  4OON A;  2YQP A;  4JV5 L;  1N13 A;  4JI4 Q;  1SRO A;  2UUB L;  3QWP A;  1BUS A;  4OWT B;  2JXD A;  4OO1 I;  2ZJQ A;  5IP7 G;  2R93 H;  2Q2I A;  1WCM H;  4HEA 1;  1IBM Q;  4YCW A;  1SGN I;  1Q1B A;  1SE8 A;  2JB2 A;  4JI0 Q;  4YZ9 A;  2MJF B;  2QPO A;  2NU2 I;  1U0L A;  1A62 A;  1K9M C;  2IX1 A;  3TRE A;  1SN8 A;  2CFM A;  3TQY A;  1KBF A;  3KJO A;  1I94 L;  3PF4 A;  1VQJ A;  3SGI A;  3CC2 A;  1HNW L;  3HOY H;  2UXB L;  1N32 L;  3G4S A;  3VDU A;  3S17 H;  4GKK Q;  4GOP B;  3HOZ H;  4B3T L;  4A3J G;  4B6D A;  5EAY A;  5IP9 H;  4DV0 Q;  1LTL A;  1KXL A;  1T9H A;  1YHA A;  1HR0 L;  5FUY A;  1UE5 A;  1IW4 A;  1XA6 A;  3FC3 A;  3M85 A;  4DK6 C;  1J5E Q;  4A3M H;  2RIO A;  1N34 Q;  1HJP A;  5CCM A;  4DV1 Q;  1Q86 C;  3CPF A;  2QA4 A;  2KMO A;  4POG A;  2YYZ A;  3ERS X;  1YBY A;  2ENZ A;  4NV2 A;  4HJ9 A;  2NVY H;  3GTP H;  4UP7 A;  4LF9 L;  3PF5 A;  2CKZ B;  2BA1 A;  2XMX A;  3HKS A;  1SGP I;  1EYG A;  3DLL A;  1RFH A;  1YIJ A;  4R1J A;  2CWP A;  4HGU A;  2KEN A;  1MKH A;  1VQK A;  3CCQ A;  1PVO A;  1HZB A;  1WOC A;  3B4V C;  4GN4 B;  2H5X A;  1TXY A;  1NTG A;  1H0Z A;  1EQR A;  3CCU A;  1IY5 A;  2UU9 Q;  1IBK L;  3F8T A;  4C3J H;  5AJ3 Q;  2JB3 A;  2VNU D;  5JJL A;  1I5F A;  1HNX Q;  2A20 A;  5JJK A;  4DR4 Q;  4EX5 A;  3SEK C;  1VQM A;  1LR7 A;  1FVI A;  4YHH Q;  2OTL A;  2UXD Q;  1MIU A;  1PTR A;  3CCR A;  3STB C;  2N52 A;  5HGQ A;  3CME A;  3H3V H;  1JMC A;  4E1P A;  1TBN A;  1SFO H;  3OVO A;  4X64 Q;  1PA6 A;  4BXX H;  1NE3 A;  3ICE A;  4DAY B;  1V1I A;  2A2D A;  2DGY A;  4BY1 H;  3TJQ A;  1XMO L;  2M5X A;  4XIG S;  4R4I A;  4Y7N H;  2RHQ B;  1OTC A;  4JOI C;  2B63 H;  2CWA A;  3H0G H;  1KBE A;  3J81 i;  2YUU A;  2J87 A;  3HOW G;  5JEA G;  1PH3 A;  1WI5 A;  3EIV A;  2WAQ E;  3UDX A;  4E1R A;  3TS0 A;  3CAM A;  5C4X H;  1VQE A;  2JQO A;  3CQZ H;  2JW6 A;  5C44 H;  1UEB A;  3GTQ H;  4L9M A;  1PH4 A;  4JI5 Q;  3E2I A;  1SMX A;  1L2F A;  4YY3 L;  2VL6 A;  1CSQ A;  4AIM A;  1VQ4 A;  3S2H H;  4NXM L;  4Z7G A;  1HJA I;  4LF6 L;  1VQ6 A;  3UDI A;  5IWA L;  2SGQ I;  4JI1 L;  1CKM A;  2ES2 A;  3T1H L;  3RLO A;  1FAQ A;  2Z6K C;  2ODD A;  3I7F A;  2Z6K A;  3GTG H;  2AKW B;  3HOV H;  3STB D;  2VS1 A;  2WB1 E;  4EQ5 A;  3OXF A;  1EQQ A;  4DR1 L;  1VS0 A;  1XNR L;  4KHP L;  4MZ9 A;  2LSS A;  2CJS C;  4DV3 L;  2R7D A;  4ME3 A;  5GRO A;  4DUY L;  1VQA A;  3T1Y L;  1YU6 C;  2DB6 A;  1QZG A;  4QGU A;  1RIP A;  1PYB A;  2FXQ A;  4DUZ L;  3HOU H;  2NU1 I;  4JI8 L;  5LMN Q;  1TWC H;  4QY7 A;  4X65 L;  5IYB H;  3B6Y A;  2GKR I;  2PNH A;  1V43 A;  2GKV A;  4JI7 Q;  5M5X H;  3HOX G;  1X54 A;  1C7Y A;  4B3S L;  4GKJ Q;  4JCV E;  3TS2 A;  4DR6 Q;  2ZTE A;  2JA6 G;  1C9O A;  1CKO A;  2R92 G;  1BBU A;  2UUA Q;  2KHJ A;  3BJU A;  4JYA Q;  1PJU A;  2A2C A;  1JB7 A;  1X65 A;  3UIT A;  2LXK A;  1YNX A;  4G75 A;  2A19 A;  1S72 A;  1C0A A;  2AMC B;  2VRW B;  3A5U A;  3PIP A;  4O0A A;  1SGD I;  4NXN L;  3CCL A;  3FKI H;  4A3C H;  3ULL A;  2Z0S A;  1VQ7 A;  3PO3 H;  4JG2 A;  3LJ0 A;  5M5W H;  3RLN A;  4DAM A;  2JA5 G;  4NPS A;  2KCT A;  3K80 C;  4JI6 L;  4C2M H;  3PSI A;  1FGU A;  3UEJ A;  3MXN B;  2YV5 A;  3MEK A;  5ELO A;  2UUC L;  4JI3 L;  2Y0S G;  1AH9 A;  3UE1 A;  1Q8K A;  4DWL A;  4P74 A;  4APV A;  1VQI A;  1QUQ A;  1IY6 A;  2KCX A;  3PUW A;  2DIP A;  2OD1 A;  2EXD A;  4IPD A;  2PI2 A;  1M8B A;  1IL2 A;  4A3B G;  5HY6 A;  5C3E G;  3CMA A;  3I4N G;  3TRZ A;  1E1O A;  1TOT A;  2YTV A;  1LYL A;  1GM5 A;  1HZC A;  4A3L H;  1XX6 A;  3A0J A;  1Q81 C;  1E3P A;  4JV5 Q;  2N3S A;  3F4M A;  5C4J H;  1PTQ A;  3S24 A;  1B8A A;  4DR2 Q;  3OTO Q;  2K5N A;  1EFW A;  3RZO H;  4HIO A;  4G76 A;  2W0T A;  3KFU A;  2WVJ A;  2A8V A;  4B3M L;  4OWX B;  2HHH L;  2KHI A;  4OXP A;  1XBT A;  3KF8 B;  1CT0 I;  3GD7 A;  2I5L X;  4A3D G;  1Y1C A;  4O1P A;  4IJH A;  2N49 A;  3EBE A;  2F4V L;  1X3E A;  3CC7 A;  1HNW Q;  2E8G A;  3CC4 A;  2GN5 A;  2UXB Q;  3S16 H;  1SJ8 A;  1N32 Q;  1CKN B;  3JC6 6;  1TUR A;  1N9W A;  4X62 Q;  5M3F H;  5H1S E;  1NMG A;  4B3T Q;  2JK8 A;  1NBW A;  3KOJ A;  4BY7 G;  2ZTD A;  4GLX A;  3S14 H;  4DV6 L;  1G6P A;  5IP7 H;  2FUG 1;  3W5O A;  2BA0 A;  1IZ6 A;  3CCM A;  4LFB Q;  1YEZ A;  1NJI C;  4GNX B;  1X4S A;  4LF7 Q;  4L5R C;  4DV2 L;  2NZH A;  4GS3 A;  3KLW A;  2KMR A;  4LF9 Q;  4A75 A;  4P73 A;  1VQO A;  1Y14 B;  1PPF I;  3S1Q H;  3M9B A;  3GTK H;  1FL0 A;  4LFC L;  4R4C A;  3M7N A;  3GO5 A;  4GLV B;  2KCM A;  3NEN A;  5K36 G;  4A3J H;  1CSP A;  5GAE C;  2XTR A;  2K75 A;  4A3E G;  2SGF I;  1TGS I;  1W3S A;  2IY5 B;  1AN1 I;  5IYD G;  1AE2 A;  1VQ9 A;  4JBW A;  4JBM A;  3KP9 A;  1IBK Q;  1TIH A;  3BU2 A;  1IYJ B;  3VDY A;  2V1C C;  3D00 A;  2V1C A;  3RLF A;  3KF6 A;  3DO9 A;  4A93 G;  4HIM A;  3A74 A;  1XNQ L;  1K8G A;  2P22 B;  3CXC A;  3JAM c;  1TBR R;  4DV4 L;  2CAZ B;  3RR5 A;  1HZ9 A;  1W2B A;  1B70 B;  2JA1 A;  3IAM 1;  2K5V A;  1XMO Q;  1DS2 I;  4P71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...