2V1CC

Crystal structure and mutational study of recor provide insight into its role in dna repair
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
234
structure length
229
Chain Sequence
b'SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINATION PROTEIN RECR
publication title Crystal Structure and Mutational Study of Recor Provide Insight Into its Mode of DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
total genus 52
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02565 RecO_C Recombination protein O C terminal
C PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2v1cC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2v1cC01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v1cC03
3KJPA 3NELA 5IP9G 1P16A 5C44G 1Q1EA 2Z6KC 4JI8L 1IBMQ 3AEVA 2YU9H 1A8VA 3G71A 4JC0A 2EIFA 4XIGS 1P8LA 4AQYL 2IY5B 2AHOB 3ULJA 3CCQA 3KDFB 1J6QA 2F4VL 1NMGA 2WFWA 1VQ9A 3GTMH 4DR7L 2VNUD 2WAQE 1VQPA 4A3GH 1OXVA 2VQEQ 1XPOA 4DR3Q 3KOJA 2NVTH 2B63H 3M4QA 1LM0A 4L5RC 2Q2IA 3OTOL 1XJVA 4GLXA 4NPSA 5FLXc 1QUQA 5IYBH 1M1KC 2VY3A 1VQ6A 1UE1A 3TRZA 4HJ7A 3PUVA 4A3LH 1X6OA 2B63G 3UE0A 5JJKA 2UUBL 4DV1L 3K80C 1KIXA 1L2FA 2YYZA 4P74A 1IBKL 4LUOA 2MFIA 4DV0L 1Q86C 3UDFA 4IFDG 1NBWA 1FJGQ 4BY7H 2OTLA 3CCMA 4JV5Q 5M5YH 5IT9c 3A5UA 1PH2A 4YWKA 1KQSA 2C35B 2IHFA 1DGSA 3RLOA 3M85A 1XMQQ 1YEZA 4P75A 1E1OA 4JI6L 3JAMc 1N9WA 2YV5A 4BY7G 2KENA 2UXCL 4QY7A 3T1HL 2GVAA 2JA7H 2UXBQ 1OXTA 4GKKL 2A1AA 2CFMA 2E8GA 4IFDI 5AJ3Q 4OWXB 4WJ4A 4YHHL 1HNWQ 3WWVA 5H1SE 4ALPA 5FJ8H 1CKOA 4RG1A 1N8RC 4WJ3M 1BBUA 2OCEA 1AE2A 4AYBG 4DR2Q 4DV6L 3PO2H 1Q8KA 1KC8C 4X62L 3GTQH 1UE7A 3HOWG 4DAMA 5JEAG 1VQBA 2JA7G 3E0EA 4GLVB 3HOXG 1Y1WH 4P71A 4B3SL 2NVQH 1JJGA 3PUXA 2DUDA 4A3IH 5GADC 4LFAL 4JI3Q 2UUCL 5FJ8G 2DGYA 1FGUA 4LUZA 1V43A 4DV5Q 4HIOA 2N78A 2ZJRA 3JC66 1RIPA 3GD7A 3EIVA 2N3SA 4LW1A 2N49A 1VQEA 5LMUL 4JI7Q 4HIMA 2CKZB 4A75A 1SRUA 2L15A 2OQ0A 1Y1WG 1PA6A 1N32L 3UDXA 1YHAA 4HJ9A 1Y14B 2XTIA 1YI2A 4B3TQ 3CCRA 4A3IG 2BA1A 4JI4L 2BH2A 2VUMG 4IPCA 3PV0A 3E9IA 3G4SA 4BBSH 2HHHL 1I94Q 5C0XI 2QA4A 2E5LL 3NEMA 1VQ4A 4B3RQ 4GNXC 1RL2A 3A74A 1FL0A 4X66L 3Q8DA 5LMNL 4OXPA 4QIWE 4IPDA 2ZM6Q 3ZJYC 4UP8A 4DR7Q 4JI5Q 2R6GA 2Z0SA 3KJOA 2F52A 1TWCH 2CWPA 1XNQL 1XNRL 2GVBA 1MKHA 2WAQG 1T9HA 3BU2A 1D8LA 4MNOA 1VQDA 2D62A 1B70B 5M3FH 1EIFA 4A3FH 2E2IH 4OX9L 1VS0A 4B3ML 1X3FA 4K0KQ 4QGUA 5LMNW 1SFOH 2R7DA 3T1YQ 3CPWA 1IYJB 4DV7L 1AH9A 1S3OA 3H0GH 3PF4A 1WCMH 5M3FG 4A3FG 3S1RH 4GOPC 2YTXA 4PG3A 1XPUA 4R1JA 4KHPQ 5BR8Q 4C3IH 2K5NA 4JI1L 3J80i 3U58A 1IBKQ 3PUWA 1N33Q 1V1QA 2R92H 2KHIA 1HNXQ 4C2MH 3H0GG 1WCMG 1HZ9A 2K5VA 2Z6KA 2LXJA 1SMXA 5FLMG 3ER0A 1Y1VH 4O2DA 1X65A 2MQHA 4IPHA 4DUZL 4FDBA 4P72A 1QZGA 3GTOH 2FXQA 3J81i 1M90C 4JI6Q 3S24A 2JQOA 2R92G 1B8AA 3G6EA 5E7NA 1Q12A 4DR5L 4NXML 1NTGA 3KF6A 3T1HQ 4A93H 2UXCQ 3RN5A 1I5FA 1KD1C 4DV4L 4UY8C 1Y1VG 2ATWA 1GKHA 5ELOA 1YVCA 4UP9A 4DR1Q 4LWCA 3AFQA 4LFBL 3RLFA 1PH1A 1NE3A 4NB3A 3BZKA 1K3RA 4DV2L 2HQLA 2YTYA 2UXDL 2RHQB 1X3GA 1LUZA 3A0JA 4MTNA 4X62Q 3I55A 1VQKA 3CD6A 4A93G 4HIKA 2MO0A 1HNZL 1GO3E 4POFA 3K8AA 1CUKA 5IY0A 4GKJL 1G6PA 4IO9A 4DK6C 2R93H 5K36G 1YJWA 2JJQA 1A0IA 2KBNA 3RZOH 1N34L 3S1MH 1CSPA 2IX0A 3AYHB 3KF6B 4HIDA 2I0QA 4EX5A 2NVYH 4A3GG 4LFCQ 5LMUQ 1I3QH 3HOUH 3H3VI 3S16H 3CCUA 1PVOA 5DLQE 1N32Q 1SN8A 4A76A 2K75A 4HJ8A 2EQSA 4LF9L 3HOYH 1TWFH 3DLLA 2AWNA 1W3SA 4YY3L 1K9MC 3CCSA 1CKNA 3H15A 3EBEA 5LMNQ 2E2HH 5IYBG 1HR0L 4Y52H 4DUYL 1BBWA 3HOUG 1I50H 2B29A 4L5SA 3GTGH 4A3JH 3W1GA 4A3LG 4PMWA 2K5HA 3GTLH 4KI0A 3M4OH 3CP0A 1OXUA 1PH5A 1WJJA 4TQUS 4TVAB 4R4CA 1QUQB 4NXNL 4JI2L 1N36L 5JJIA 1SR3A 2PI2E 1J5EL 3ERSX 1ASYA 4LF7L 4GN4B 4DR6Q 4P73A 3CQZH 1CKMA 1GM5A 3S14H 4QL5A 3L0OA 4A3JG 1JT8A 4LF4L 1E7ZA 4DV7Q 4DKAC 2KCTA 2JEBI 4X64L 4YCWA 4JBJA 1HH2P 3S1QH 3CC7A 3I7FA 1HZAA 2WB1E 2F3IA 4C3HH 1K0RA 3JAMi 3CMEA 3LGJA 3PF5A 1NY4A 3I4NH 4JCVE 1OXSC 2JE6I 5M3MH 3HKZE 3GTJH 1UEBA 2K4KA 1Z9FA 1C9OA 1UWVA 3L2PA 4JI1Q 4LF6L 2Q2UA 3CPFA 1YHQA 4KLKA 5C0XG 1BVSA 3CF5A 2HIVA 2JK8A 4X65Q 1HZBA 1OTCA 4JI0Q 4LF8L 3RR5A 1XMOQ 3GTKH 2NN6I 3OYYA 5C3EH 4GNXA 4XTCS 4DUZQ 1UE5A 2QEXA 4JYAL 3TQYA 2Y0SE 4MZ9A 3TS0A 1YITA 1JJ2A 4DV3L 1R9TH 2HT1A 3PO2G 1C0AA 4GLAC 4JOIC 1KRTA 1K8AC 1IBML 4OO1G 2A19A 1U0LA 3TS2A 1PYSB 4PZ7A 1ASZA 4BY1H 3CXCA 1W2BA 1E3PA 2I5MX 1B7YB 5C3EG 4JI8Q 2VQEL 2CWAA 4DAYB 3KLWA 3J7A5 2RCNA 4AQYQ 5HY6A 5GROA 2F4VQ 1TWGH 1VQOA 1PH3A 3S2DH 3I4OA 4A3CH 2VQFL 4GNXB 4BY1G 3CCJA 1C7YA 1EFWA 2JEAI 4BBSG 3CC4A 4GOPA 2K14A 4OO1I 3L7ZC 3FHWA 3OTOQ 2XGTA 1Q7YC 1SE8A 2UU9L 1EYGA 2E2JH 2JA5H 3K81C 3TEHB 5C4XH 3AFPA 3F8TA 3M7NA 4A3CG 4BA1I 3RN2A 1PH9A 3PCOB 1FVIA 1GD7A 2VZAA 3K7AH 2NVXH 3U50C 2ID0A 1VQ8A 2R7ZH 1FJGL 2UUBQ 4O0AA 3M9BA 3PUYA 2VL6A 4DV1Q 4PZ8A 4IOCA 4JBKA 4R4OA 2BA0A 4YY3Q 3CMAA 2JA5G 4DV0Q 2LXKA 3J7ZC 4X6AH 4DR4L 2K52A 4GOPB 1GVPA 3GDEA 1YJ9A 4J15A 2LSSA 3W1BA 4OONA 4UP7A 3CCEA 4BXXH 1IXRA 1X3EA 1QZHA 1XTDA 4L5QA 3NENA 1NMFA 4A3EH 2R7ZG 1X55A 5M5WH 1H95A 4KHZA 4NXNQ 2NZHA 3SGIA 1YHBA 3PSIA 1J5EQ 4RMFA 4YCUA 1WI5A 3H3VH 2UXBL 1JE5A 4H02A 4LF7Q 1L1OC 3HOZH 1HNWL 5GQOA 3RLNA 5IE8A 1YJNA 1JMCA 4BXXG 2RHSB 1XPRA 1KL9A 1PYBA 4HJAA 3F1ZA 4GKKQ 1MIUA 3UDIA 4DR2L 4YHHQ 1EOVA 4C3JH 1TWHH 4IOAA 1VQ7A 1EUJA 4A3DH 1WOCA 3HOZG 2WB1G 2V1CC 3STBC 2ZJPA 5M5XH 4DV6Q 1X9NA 1U5KA 4DPGA 2WP8J 4LF6Q 3I2ZA 4R4QA 3HKZG 5IP9H 3DM3A 4DV5L 1MJEA 1PV4A 4B3SQ 2CCZA 3K7UC 4A3MH 1E22A 1SLJA 4L5TA 1L0WA 3F2DA 4LFAQ 4A3BH 4LF8Q 2UUCQ 4A3DG 5C4JH 4JYAQ 4A4IA 2OQKA 4DV3Q 1I94L 1EQRA 4UPAA 2Y0SG 3S17H 3E9HA 3CC2A 4A3MG 4B3RL 2IHEA 2BH8A 4GN3B 2ZM6L 4JI4Q 4PZ6A 4A3BG 2R93G 2HHHQ 4JI5L 1VCIA 2PQAA 3A5ZB 4R4IA 2E5LQ 4LF5L 2PMZE 2JA6H 3ULPA 2KCMA 4X66Q 1CSQA 3CAMA 2VW9A 5IWAL 1VQIA 3D31A 4EQ5A 3S2HH 1LTLA 3RNUA 4IFDJ 1Q1BA 4GS3A 2AWOA 2VQFQ 2B3GA 5GAGC 1XNQQ 1XNRQ 1IL2A 3HOYG 3I4MH 4K0KL 2D0OA 3KYHC 1VQGA 1OXXK 3S15H 3T1YL 1Q81C 2UUAL 2JA6G 2IX1A 1A63A 4OX9Q 1Q46A 4B3MQ 2UU9Q 3HFZB 2PNHA 1IZ6A 1HR0W 4HJ5A 1VQMA 1PH6A 1PH8A 2NN6G 3KFUA 1IBLL 4KHPL 1YBYA 2PQAB 5BR8L 1N33L 4YWMA 3I4MG 1CKNB 4POGA 1EWIA 3U4ZA 1Z47A 3KF8B 3PIOA 2RF4A 1KAWA 1YIJA 1JJCB 1HNXL 3BZCA 4YWLA 4JOIA 3BJUA 5ELNA 4DR4Q 1VQ5A 1HJPA 3FKIH 4GN5A 2N8NA 5HGQA 3CCLA 5IP7H 3J81j 1VQFA 5JEAJ 1QVGA 4ME3A 2ASBA 3I4NG 5C0XJ 2ZTEA 5IYDH 4IJLA 4BA2I 5M3MG 2K50A 2JA8H 1TXYA 3HOWH 2IT1A 1PHJA 2PI2A 4QJFA 3MEFA 3CW2C 4OWWB 1KHIA 3HOXH 1AE3A 2D0PA 3FKIG 4JG2A 4DR1L 3VDYA 1VQNA 2JA9A 5EAYA 4DR5Q 5IP7G 1QVCA 4NXMQ 3F2CA 1JB7A 3NBHB 5IYDG 4LUVA 4DV4Q 4JBWA 2JA8G 1VQJA 2EXDA 2Q2HA 3F2BA 5JJLA 2I5LX 3ICEA 4LFBQ 4DR3L 1PFSA 2QGQA 1S40A 4DV2Q 2MNAA 2UXDQ 2VUMH 2VS1A 3PO3H 4IJHA 2KHJA 1MJCA 1HNZQ 4APVA 1VQHA 1VQCA 4GKJQ 3D0FA 4LFCL 4Y7NH 1S72A 3FP9A 1WYDA 3UDGA 2AKWB 1N34Q 2Q2TA 1A62A 4AH6A 2ES2A 3RZDH 1WFQA 3PO3G 1I6HH 4DNIA 2A8VA 2H5XA 4OWTB 3GTPH 5GAHC 3PUZA 1D7QA 4A3KH 1YZ6A 1KXLA 1O7IA 3K0XA 2GN5A 1K8GA 3PGZA 4LF9Q 4JV5L 5IYCH 1PH7A 1L1OA 3S1NH 4LF5Q 5C4XG 4YCVA 1EIYB 4LNQA 1K83H 1QVFA 3M4PA 4QQBX 3OW2A 1HR0Q 4DUYQ 1LYLA 1YNXA 3CCVA 2OTJA 5IWAQ 3PIPA 1XMQL 3G48A 4R4TA 2ZJQA 3HOVH 1KRSA 4A3KG 1V9PA 4DR6L 3HKSA 1VQLA 3STBD 4AIMA 5IYCG 3U4VA 2OWOA 4JI2Q 1N36Q 1G291 2UUAQ 1E24A 2HIXA 3J80c 1TWAH 1X54A 1BKBA 2AMCB 5AJ3L 3AQQA 4AYBE 1PH4A 1G51A 5FLMH 1K73C 3W5OA 3HOVG 4LF4Q 1E1TA 1IBLQ 3GO5A 4A3EG 4X64Q 1L1OB 1NJIC 4IPGA 3TREA 3M3YH 4JBMA 2NZOA 2R7FA 3B6YA 3J81c 1SROA 4X65L 4BBRH 2YTVA 3KDFA 4DK3C 2CQOA 4JI3L 3UE1A 4JI0L 1XMOL 5C44H 5GAEC 3I56A 2MO1A 2ALYB 2ZTCA 5J3BA 1X56A 3EN2A 4JI7L 1VQAA 3ULLA 2I5HA 3IRBA 1UE6A 1Q82C 1HZCA 3MXNB 2ZTDA 4BBRG 4B3TL 1EQQA
chains in the Genus database with same CATH superfamily
1P16A 1Q1EA 2EYPA 3A55A 3G71A 2B0UC 4XIGS 1P8LA 1G91A 2AHOB 4KKTA 2F4VL 3CCQA 1J6QA 1VQ9A 2CWGA 1PTOB 1OXVA 4C3HB 3BDCA 4DR3Q 1QJOA 1LM0A 4L5RC 2Q2IA 1DD2A 2PYKA 1JORA 1QB5D 1V1OA 1SYEA 3QB3A 4RWSC 1SMYC 1EY9A 5HQ8A 3GTKB 4A3LH 2B63G 1AZQA 4KHVA 5ELFA 1Z7KB 1QNUA 3FPUB 1TOTA 1D1KA 2EY1A 2UUBL 3K80C 4P74A 1T5XD 1Q86C 4IFDG 1NBWA 3B4VC 3CCMA 5IT9c 1B50A 3A5UA 1PH2A 5K5PA 3U9OA 4XDXA 1CA6A 3RLOA 3M85A 1A6XA 3FPPA 4O42A 2AQ2B 4RAUC 4OL7A 1QG7A 1DONA 3IFTA 3T1HL 1HQMC 3URYA 2E8GA 4Y7NB 4OWXB 5D14A 4YHHL 1HNWQ 1PFBA 5FJ8H 1CKOA 3P20A 1BBUA 1PJUA 1WTJA 2ODDA 5CBAE 2ERWA 2A6HC 4X62L 5JEAG 3SGBI 5BN5A 2NVQH 4A3IH 4ILWA 1FGUA 1V43A 4ZRZA 2N78A 2ZJRA 3JC66 4KY6A 3HOVB 5I9PA 3TO9A 4HIMA 2L5TA 2K03A 1Y14B 1CTMA 1DJRD 3G4SA 2KMOA 1HXYD 2BCOA 2F0PA 5C0XI 1F9QA 2QA4A 1GJXA 3NEMA 2NTTA 1TUSA 2WKDA 4OXPA 2ZM6Q 4H7BA 1FGBD 4JVZA 2NWGA 4UP8A 5KNBA 4JI5Q 3K6OA 1PFMA 3M3YB 2OF1A 1D8LA 4YZ9A 5DM73 2VRWB 1HFGA 4CJ1B 2MHVA 4K0KQ 4PL5A 5LMNW 3H6MA 1SFOH 5ISRA 1C8CA 2QSBA 3KLSX 3T1YQ 3PF4A 3DHQA 5M3FG 4NP5A 3QJYA 3V96A 3TZUA 4IUVA 1BUVT 3A8JE 4R1JA 2PNRC 4C3IH 2K5NA 4JI1L 1N33Q 1WTVA 2KHIA 2RCFA 3J81L 1O7ZA 1X32A 1B1ZA 4G57A 1HNXQ 1X3PA 4CKBA 4ZK9B 3ND8A 1ESFA 5FLMG 2B2UC 4U6RA 2NVTB 2B63B 3NXWA 4UHVA 1M90C 3Q23A 3S24A 1O80A 3G6EA 5CR3A 1EEID 3OXLA 1O7LA 2K6AA 4K2KA 3T1HQ 1HTLD 3GOXA 1S5BD 4DV4L 1Y1VG 2EYHA 2F0DA 2F03A 2PPBC 4UP9A 5EPKA 4NB3A 2YTYA 4GXTA 1RKNA 2EJFC 4ZKCB 1X3GA 4MTNA 4X62Q 2QCPX 2UXDL 1VQKA 2MO0A 1ENFA 1GO3E 1YNJC 3VR6A 1TT2A 4N9TA 3SVMA 5K36G 1A0IA 4AS3A 1PPFI 4EX5A 5LL6S 2A68C 3HOUH 3S16H 5KRUA 4M1UB 1GUNA 1SN8A 3DMUA 4E1PA 1W3SA 2LB7A 3VYRA 3Q22A 1K9MC 1EYDA 2E2HH 4Y52H 1HR0L 1R4QB 3LJ1A 1I50H 2B29A 1IY5A 3GTQB 4A3LG 2L8EA 2K5HA 1WJJA 4JPBW 4I65A 1QUQB 2SGFI 3JAML 4ZAIA 1E2ZA 1GM5A 4CDEC 3L0OA 4LF4L 3TZDA 4ME5A 2IX3A 4YCWA 2A6EC 3S1QH 1WD0A 1CFMA 3AU7A 3I4NH 4A24A 2N88A 3LGJA 1NY4A 5FUVA 1OXSC 1ZKOA 2JE6I 5C6AA 5M3MH 3SXHA 2EJMA 1C9OA 1UWVA 2PMZB 1W4RA 4JI1Q 2Q2UA 5C4ZA 3CPFA 5D65A 4OO1H 5C0XG 3D4WA 2HIVA 1OTCA 3OYYA 4RGOS 2EYMA 4JYAL 5M3FB 2PO4A 3TQYA 3OSOA 4DV3L 1R9TH 4E1RA 1KRTA 1K8AC 4JW0A 2AUJD 3TS2A 4IURA 4Z7GA 1HPCA 1E3PA 2EXZA 5DEHA 2L0CA 1P9GA 4QUCA 2CWAA 2Z8LA 2RCNA 4KMUC 3ZYYX 4AQYQ 1HUNA 2B8FA 3HG9A 5I2YA 1VQOA 2A20A 4A3CH 2UZ3A 2VQFL 2JEAI 5E4WC 2DKVA 1GUOA 1TS5A 4OO1I 1Q90A 7WGAA 3L7ZC 4C2MB 1PTOF 5JJZA 2EVBA 3OMCA 1Q7YC 1SE8A 3KK7A 1Y1VB 2UU9L 2NYZD 4RFBA 5CV8A 2GIVA 5IGGA 3PCOB 3UITA 3U50C 1NNXA 2B2UA 2F0SA 1FJGL 1F9SA 1U4RA 1L0XB 3SEBA 4DV1Q 4KN4C 2BA0A 3A54A 1HA5A 1TVXA 3J7ZC 3VYTA 3VR2A 1KDAA 3GDEA 2LSSA 1RDPD 4OONA 3KUPA 4UP7A 5FOBB 3CCEA 1IXRA 2V6EA 1FD7D 3I72A 4HEA1 1H95A 5M5WH 2UXBL 1YHBA 4C3IG 3H3VH 1L1OC 5GQOA 5IE8A 3R5BA 1CHQD 2CH4A 4R8NA 1EOVA 1VQ7A 2HCIA 5IIFA 3MVVA 2LMCB 1E2VA 5A35A 5JHWC 2V1CC 3STBC 1H9SA 3I2ZA 2FU2A 3KBXA 2XVSA 2A69C 3I91A 3K7UC 1CHPD 3TP8A 3M4OB 2CWHA 2B2TC 2F0VA 3M4YA 5C4JH 2N52A 4JYAQ 4A4IA 4RHRA 3PIO3 1QILA 5JAVA 4DV3Q 4DXGA 2ZT9C 5J8FA 2ICIA 3E9HA 2L11A 3FVQA 1PRTC 3D00A 2WACA 2NU2I 4GN3B 2BDNA 4DU9A 2FJ2A 2SGPI 4R4IA 2E5LQ 2JA6H 3R5DA 2KCMA 1BF4A 4HEDA 2VW9A 3I90A 3S2HH 4EQ5A 4ZQ3A 4GS3A 2VQFQ 2B3GA 5GAGC 1XNQQ 1XNRQ 1TKWB 3BVZA 4N8X1 2IX1A 1L0YB 1K3BC 1IYUA 1XTCD 4OX9Q 1B2TA 2UU9Q 2ENNA 1HR0W 1HQRD 3C2PA 5IT9E 2KCNA 1AEXA 1YBYA 2PQAB 4PMCA 1PTOH 5BR8L 3A7LA 3OWFA 2JN4A 5COYA 1Z47A 3VA5A 2RF4A 3SDZA 1JJCB 2M2LA 4FP5D 5KNDA 1R0RI 2N8NA 2XTRA 3CCLA 2MUYA 3TP5A 3I4NG 1D1IA 1EIHA 4IJLA 5M3MG 2K50A 1TXYA 2IT1A 1PHJA 4WRDA 2RIJA 3UFFA 1SNMA 1MT1A 4FKDA 3E5SA 2KMRA 4KV6A 3HGBA 1VQNA 3MXUA 1NCVA 3F2CA 5EBCA 5KEEA 2E75C 2J0TD 2JA8G 1F2YA 1SNPA 1TY2A 4R9WA 2SDFA 2L9HA 2I5LX 3ICEA 2QGQA 2MNAA 1TURA 2VS1A 4C3IB 2KHJA 2XNAC 4U68A 2KMPA 1HNZQ 1K7TA 4GKJQ 1EQTA 1LTAD 4Y7NH 3B55A 1WYDA 2WKCA 1N34Q 2ES2A 3PO3G 2VB2X 2A8VA 2H5XA 1D6EC 3E59A 1I4QA 4UXHA 3PUZA 2KECA 1KXLA 1O7IA 3FC3A 3PGZA 4LF9Q 1GHKA 1L1OA 3QOJA 3SR1A 3OW2A 1B3AA 3P23A 4DUYQ 1YNXA 1ET6A 4L9MA 4SGBI 3HOVH 1KRSA 1Y8PB 1VQLA 2OWOA 1N36Q 1G291 2V1CA 3DWAA 1EZ6A 2AMCB 1DOMA 1LR8A 1VDZA 1XWEA 1EY7A 4S3SA 3T53B 4X64Q 1WTPA 3WOFA 1NJIC 4IPGA 5I9OA 2E73A 3M3YH 3FVVA 1YNND 2R7FA 3J81c 1LT3D 2F0TA 1SE3A 2K01A 2YTVA 4JI0L 1F2MA 2K05A 1LTBD 2A74C 1STEA 3QAHA 4IN3A 1K8OA 1I50B 2K32A 5HURA 3AMUA 2F0MA 3MXNB 2ZTDA 2O5IC 1SGPI 4B3TL 1EQQA 3NELA 3VDUA 2Z6KC 1ONLA 5FO9B 4JC0A 3DXJC 3WOEA 3ULJA 3KDFB 3GTMH 4DR7L 2VNUD 3S1QB 2VQEQ 3G7LA 3I4NB 5FLXE 4ZKBB 2Q8IB 2NVTH 5M3MB 2B63H 1AZPA 2AQ1B 3QO2A 1XJVA 1TDPA 1STAA 3HP3A 2ZXOA 1QUQA 3MZ5A 4IFDH 1M1KC 2P22B 1UE1A 4EQNA 3TRZA 4HJ7A 1TS4A 1SEBD 2Q8TA 3BS1A 2JA8B 4DAVA 5T1IA 3LJ0A 2YYZA 2ETDA 1IBKL 1Y1CA 1G2SA 4LUOA 1D5ZC 2E5RA 1NUCA 3UGLA 5E4XA 5JVG3 1BCPD 3T56B 5BN3A 1UHAA 4YWKA 3K5LA 1GOZA 5ELCA 2C35B 1Z7TA 2JW6A 1YEZA 4JI6L 3PO3B 2XRQD 3JAMc 3JSBA 1LO5D 3SEKC 2Z1CA 3FSXA 1I6VC 3D3RA 5JEAH 1CQFA 3UEYA 1OXTA 4GKKL 4IFDI 4WJ4A 1SYCA 2EYJA 2F4IA 2M9VA 3BDOA 1LTRD 2OCEA 1AE2A 2AQ3B 1I6HB 3TSSA 4DR2Q 4DV6L 3PO2H 1Q8KA 1KC8C 3GTQH 1UE7A 1V8QA 2JA7G 1UVGA 3E0EA 4B3SL 3Q24A 5EKLA 1JJGA 2DUDA 5GADC 4LFAL 1NAPA 4LUZA 2JBWA 3EIVA 3H91A 2LEOA 2IJ0A 1VQEA 2CKZB 1SRUA 1Y1WG 4HGUA 1N32L 3UDXA 1HRJA 3CHBD 1YI2A 4B3TQ 2BA1A 5A2QL 2YUUA 4IPCA 1JC7A 1GUSA 1TWAB 4XYOA 3OIQA 5G3LD 2B2WC 4B3RQ 4GNXC 2ENZA 4X66L 5LMNL 2PZTA 4QIWE 1B3QA 3NBIA 1ULNA 4OVOA 1CGJI 4CDFC 4DR7Q 2Z0SA 2YFAA 3KJOA 1TWCH 3IKJA 1T9HA 5M3FH 3NQIA 2D62A 1EIFA 2O2LD 2EE1A 1ENAA 1E0BA 4O1PA 1X3FA 1RD9D 5IOCA 2R7DA 2F66B 1LTID 1IYJB 4DV7L 1AH9A 3BYTB 3J80L 3EVQA 3K5OA 1MBYA 4RGTA 4A3FG 1M8CA 1IW4A 1O78A 1RTOA 1V1PB 1IBKQ 5DAUA 3RUZA 4C2MH 1WCMG 1Y8FA 3MA2B 2ORWA 5CC4A 2Z6KA 1ET9A 1SMXA 4UXIA 1Y1VH 3L9AX 4O2DA 2DY8A 4DUZL 4IPHA 1SE4A 1QZGA 2RQXA 3J81i 4JI6Q 5F2DA 4G7ZC 3HZXA 2R92G 1PLFA 1PZKD 5E7NA 1Q12A 4DR5L 1NTGA 3KF6A 2L12A 4UY8C 1DXMA 2KUMA 1JWUD 2K1BA 5K36H 2NB0A 1STBA 1SMYD 4X3SA 2EYLA 1PH1A 1NE3A 3BZKA 2N1AB 2RHQB 3SK6A 1LUZA 4A93G 3CD6A 4KJNA 4POFA 3R2TA 5M5YB 1G6PA 4IO9A 1ILQA 1HHVA 2Y0MA 4TKOB 2KBNA 4DFAA 2Z6BA 2GA4B 1Q8IA 4K8IA 2P5ZX 1VF7A 3CCUA 4XYQA 1N32Q 1HJAI 1NR2A 2JA7B 1Y1BA 2EQSA 4H13C 1AW7A 2AWNA 1ZYRC 1QOHA 2JXMB 2WCYA 4LMQD 2DJGC 3CCSA 3H15A 3EBEA 5LMNQ 1IHZA 3GTGH 3W1GA 3M4OH 1MJ9A 4KI0A 2A6HD 2EPBA 2OT2A 1Y1WB 2SGDI 3R3OA 4OEMB 5JJIA 1CHOI 2QZGA 4K6LA 3SK8A 3CQZH 1NSNS 1CKMA 3NWTA 3R5AA 5EPLA 4QL5A 1E7ZA 5C0XH 4DV7Q 2ZW3A 1OVOA 3H94A 3CC7A 1LTSD 3I7FA 2WB1E 3JAMi 1K0RA 4CKCA 3PF5A 3UOEA 4I7AA 2MJ8A 3EFXD 2FMCA 2K4KA 1Z9FA 3X3MA 4KLKA 2JZMA 1STHA 3GQBA 2B8GA 1SGNI 1FNVA 1EZ8A 5LL6X 2B2WA 1XMOQ 3J7AV 4GNXA 4X3UA 4XTCS 4DUZQ 1BXTA 1UE5A 1LT5D 2QEXA 4A3FB 2HT1A 3PO2G 2AUKA 1C0AA 1A2TA 4GLAC 2BUSA 4C56C 1IBML 2PQ8A 1PYSB 4PZ7A 3KP9A 2EY2A 1A2UA 2Z4HA 2EOTA 2CJSC 1IW7C 1WCMB 4G76A 2DB6A 4DAYB 3KLWA 3J7A5 4RCOA 3SDJA 2F4VQ 2PQEA 3O13A 1EFWA 2L55A 4K8JA 4BY1G 1SDFA 2R92B 4L63B 1EY4A 4FF2A 3H3VC 1M4VA 3C3LA 1QWYA 4KY5A 2RBMA 1SNDA 3K81C 3AFPA 1QNKA 5J1ZA 1DS3I 2KMQA 4ZYSA 1GD7A 2VZAA 4KD3A 1ENCA 1VMCA 2ID0A 1VQ8A 3S9WA 4A93B 4YZCA 2BE5C 4K5XA 4OELB 2UUBQ 1PFNA 4DWLA 2J7ZA 1ML0D 2WVJA 4DR4L 4GOPB 1GVPA 1MSHA 1YJ9A 4J15A 3BJIA 3W1BA 3SK4A 2FHTA 3GTMB 1QZHA 4L5QA 1NMFA 4HN7A 3KLRA 3SHLA 2NZHA 3MEHA 3PSIA 1WI5A 2R93B 1F2LA 1YNJD 4H02A 1G6ZA 1JMCA 1ILPA 1YJNA 5KGUA 1PYBA 3J81E 1XPRA 3MHBA 3UDIA 4YHHQ 4IOAA 1EUJA 1H9MA 1H0ZA 3DEOA 2WB1G 2LS01 1X9NA 2DNEA 3I4LA 5IGEA 2OZUA 3DM3A 4DV5L 2XWBB 3GTLB 3DEPA 2B39A 1Q9BA 4QMGA 3NP8A 5JVH3 1I94L 2KKMA 1PTOC 4UPAA 3S17H 3CC2A 4P2CB 4A3MG 1XX6A 3K58A 4HSVA 3S14B 5C5LA 1T5EA 1G8ZD 1WVLA 4PZ6A 2CWFA 4YIJA 4NMZA 4LF5L 3ULPA 4HCEA 2A6ED 5CV9A 1VQIA 3GTJB 2EY5A 4DN4M 3PO2B 1Q1BA 2AWOA 4N9PA 3CRLC 1OXXK 1CSOI 1AP0A 4DNCA 2PNHA 4HJ5A 1PH8A 1IBLL 2OVOA 4KHPL 1CKNB 3F4MA 2GVIA 2YQPA 4BY1B 3MXGA 2F0NA 1D5MC 1DOLA 2DY7A 4ZUIA 1MHWC 4DR4Q 1HJPA 1IKMA 3I9V1 1TS3A 1KAAA 1VQFA 3J81j 3S2DB 5DAEA 5C0XJ 1DOKA 1TWCB 4BA2I 1SYGA 3VR5A 2JA8H 3HOWH 2PI2A 3V05A 4OWWB 1B44D 4LK1C 2D5DA 1KLUD 5CCLA 3FKIG 4JG2A 4DR1L 3VDYA 2E2JB 2QQ0A 5C4XB 1B4OA 1TBOA 2NU1I 4Q5VA 4DV4Q 1LLRD 2NVXB 5KYIA 2EXDA 1ZXTA 2Q2HA 4IUQA 4H0LC 2ICEC 2K28A 2UXDQ 2BL7A 3PO3H 1JR0D 3VDPA 4LFCL 2PCFB 2AKWB 2Q2TA 4OAVB 4CHTB 2M5XA 5ELEA 1I6HH 4QCLA 2WB1B 2K33A 3K0XA 5C3WA 1K8GA 3BVGA 4Q0FA 1PH7A 4LF5Q 1QVFA 2F0HA 3L3OC 3M4PA 5J8CA 1HR0Q 5CGKA 3PIPA 4WJWA 3G48A 4R4TA 4F87A 1CI3M 3OWEB 1K28A 1U4LA 4DR6L 3STBD 1A3VA 5IYCG 2IPKD 3U4VA 4G7HC 4A3MB 2V4DA 4L6TB 5CCMA 1EWHA 1E24A 2HIXA 3J80c 1TWAH 3LWEA 1BKBA 5AJ3L 1U4PA 2B2VC 1KBEA 4AYBE 1G51A 4ABNA 1K73C 2K7VA 3AJFA 4LF4Q 1E1TA 1SJ8A 1IBLQ 1P9ZA 4B08A 3TREA 2NZOA 2KEDA 4X65L 1PRTD 4JI3L 5BN4A 1JQOA 1FNUA 5ELBA 2O4XA 4IZ8A 4B9WA 3I56A 1B9MA 3FSYA 1SYBA 3GTGB 4UDUC 4X3KA 1VQAA 3E0JA 1JOQA 1PZID 3IRBA 1UE6A 3D4DA 3S15B 3KJPA 2SNMA 5TSSA 3AEVA 1GUTA 4TRDA 4JI8L 3CQZB 1A8VA 1Z6HA 1EYCA 1PDQA 1CQVA 2WFWA 2WAQE 2OU2A 2FFKB 3R93A 4CKEA 1XPOA 3LX0A 4G7OC 3KOJA 4FF4A 2K04A 3M4QA 3OTOL 4ZCKA 1SGYI 2RA4A 1FAQA 3GV6A 3NQTA 3FKIB 2VY3A 1EWCA 1S5CD 1TBQR 1Y69U 3PUVA 1X6OA 5ELDA 5JJKA 2QGMA 4OIJA 4NW2A 1L2FA 2FNFX 4DV0L 1S5FD 3UDFA 2YFBA 1X3QA 1FJGQ 3P1HA 5M5YH 3QWNA 4XQNA 2HGKA 1R4PB 1KQSA 1DGSA 4P75A 2KA7A 1E1OA 2F3WA 2SNSA 2YV5A 4BY7G 1CT2I 2UXCL 1S5DD 2JA7H 2UXBQ 1WTOA 5AJ3Q 1FY7A 2OD1A 4ALPA 2JA1A 2HCCA 1N8RC 4HMIA 3C1EA 3RZDB 4AYBG 4RKLA 3HOWG 3PMFA 1IY6A 2ARPF 4CDDC 9WGAA 1BCPB 1Y1WH 1HUMA 3PUXA 3FEWX 4JI3Q 3S1NB 2UUCL 5FK9C 1K83B 2ELIA 1SYFA 1LR7A 1RIPA 2SEBD 2N3SA 4LW1A 3I70A 5LMUL 4A75A 5EJWA 2OQ0A 1YHAA 2XTIA 5C3XA 4JI4L 1MGSA 2RLDA 3PV0A 3E9IA 2BDOA 2HHHL 2IL8A 3A74A 3L0IA 1FL0A 3Q8DA 2L1BA 2QKIC 3ZJYC 1TGSI 1VMPA 2R6GA 1LABA 2F52A 2B2VA 2CWPA 2CVRA 1MKHA 2WAQG 3BU2A 4MNOA 2JYOA 4K2LA 4A3FH 2E2IH 2K5QA 1VS0A 4B3ML 5DNFA 3NTIA 4QGUA 4PL4A 4DF7A 2NU4I 2QQEA 3CPWA 2CW0C 4DGZA 2HDMA 1WCMH 1XPUA 1PXUA 4FVMA 5BR8Q 1EQVA 3J80i 3S17B 3PUWA 2YU9B 3FRPB 1NR4A 4OIKA 2R92H 3H0GG 2RC4A 3Q0AA 1HZ9A 2K5VA 1UAPA 2J87A 3ER0A 2WGCA 1HEVA 1JB3A 1OMUA 4NV5A 1B8AA 1DZ1A 1XX8A 2KOLA 3A8IE 2G9DA 4NXML 4A93H 2UXCQ 1BNZA 2X6LA 3QOLA 3GV3A 1EY5A 2ENBA 3NWSA 2ATWA 1GKHA 1YVCA 4KD4A 4LWCA 3AFQA 4LFBL 2P6AC 2X69A 5LHY1 1WTRA 2Z9HA 1K3RA 3NTHA 2HQLA 4DV2L 1SNOA 4GZYC 3I55A 1D5XC 1GUGA 5FUWA 4HIKA 1STNA 3T51B 1Y8NB 4BY7B 1BMOA 1U4MA 2R93H 2A5HA 1YJWA 4RGMA 3TOAA 2JJQA 3LJ2A 4EQOA 3RZOH 5FUXA 1CSPA 5FLXL 3J7AF 2GKVA 2H1EA 3MC0B 2H4OA 4PMBA 5LMUQ 2ROWA 4AYBB 1MJBA 4E6IA 4U673 5DLQE 1SGDI 3HOWB 5EKIA 5JPNC 2LKVA 4YY3L 2PZWA 3IL8A 1CKNA 2ZRRA 2NBFA 1KNAA 4PMWA 4NKLA 3GTLH 1PH5A 2HDLA 1EYAA 1I4GA 4TVAB 1RFHA 2F0EA 4JI2L 2Z4IA 1SR3A 1ASYA 1EOTA 3ERSX 3J7YW 3VR4A 4V190 4RH6A 2QQDA 1X4SA 3OW7A 3QIAA 3S14H 2CAZB 3QG1A 4A3JG 4HTHA 2JEBI 3LWUA 3EA6A 1HZAA 2PW5A 4JCVE 3G6JB 3GTJH 1UEBA 2WAQB 4F88A 5IGFA 2FUG1 1FARA 1UEAB 3CF5A 2KCCA 3P7JA 4JI0Q 4BWGB 4WORA 5KIXA 2F0OA 3IAM1 2R61A 1LTGD 1O7YA 2Y0SE 4MZ9A 3TS0A 1YITA 1ULMA 3Q6SA 1H9KA 3DWPA 3VYSA 2A19A 3TP7A 3UI2A 4C1NK 4BY1H 3CXCA 1JOOA 2JAEA 1W2BA 4GI3C 2G9HD 5C3EG 3H0GB 2EYFA 3EROA 3S1RB 4FF3A 5HY6A 1TWGH 3S2DH 1C7YA 1B53A 5A2QE 2E76C 2XRCA 4MTKA 1STYA 3FNBA 2E2JH 1PYWD 5C4XH 5CV4A 3F8TA 3H09A 3W2DA 2F3CI 2WINB 3RN2A 1PH9A 2XMXA 3HEJA 1FVIA 2NVXH 1K7VA 2LY7A 3M9BA 4IOCA 2EYOA 2VL6A 4PZ8A 4YY3Q 2JA5G 3CMAA 1JE4A 2LXKA 3TDQA 4X6AH 1MD2D 2RDHA 2D9UA 1HFNA 2K52A 1S20A 1PZJD 3J80E 1X3EA 2CQAA 3OPOA 3NENA 4A3EH 2R7ZG 1ESRA 5KYLA 1WD1A 4YCUA 1HNWL 1RTNA 3S1MB 4BXXG 3TJQA 4J8QA 5HGTA 1KL9A 3F1ZA 3DO9A 1EFID 1MIUA 4GKKQ 4Q9VA 2RSNA 4DAPA 5J39A 3OL0A 4TSSA 3VR3A 1IYVA 4CJ0B 3HOZG 1TWFB 1EEFD 2JP1A 5HGIA 5M5XH 4DV6Q 5E1FA 2WP8J 4WFN3 4R4QA 5IP9H 1MJEA 2MGSA 4B3SQ 5CORA 4A3MH 1E22A 2MP1A 1SLJA 4C3JG 5E3RA 1IL8A 4A3JB 4LFAQ 4K5VA 2IWHA 2B2YC 2GKRI 1BCPF 1SJED 4A3DG 2K9HA 2N17A 3K5NA 1CE3A 3NPPA 1TS2A 1JWSD 2Y0SG 2J9RA 2BH8A 1KNEA 2ZM6L 4A3BG 5C4HA 2R93G 1H9SB 3E6ZX 2F1MA 1VCIA 3EJIA 4JI5L 1F9PA 2JSOA 2PQAA 3QWPA 2PMZE 1LT6D 4X66Q 3SGQI 1CSQA 2CHBD 3CAMA 3GP7A 5IWAL 3D31A 2J4XA 4IFDJ 1FYCA 4H44C 4K0KL 1M8AA 1OO9B 3KYHC 1VQGA 5FO7B 3S15H 3I73A 3T1YL 1Q81C 2UUAL 2HUGA 2R3ZA 3MXPA 5C3EB 5CMDA 1PH6A 3CKIB 1HCZA 3KFUA 3UGDA 1AFPA 4IALA 3I4MG 1N33L 4YWMA 1OYVI 2D2CC 1PTRA 4POGA 1EWIA 1PCEA 5EQ0A 3KF8B 1HNXL 1KAWA 1YIJA 3BZCA 4MPIA 3BJUA 2VB3X 5T1GA 2F0IA 3N6RA 5ELNA 5G3LF 4R8IA 5FKAC 2RVLA 5IGCA 3TN2A 1IW7D 3FKIH 4GN5A 5HGQA 1SBBB 1Q3LA 5JEAJ 5CV5A 1Y8OB 1YTPA 2V53A 3TOBA 4HSPA 4PV1C 3D8GA 1NUBA 1XYIA 3MEFA 3CW2C 4FXGC 2E2IB 1KHIA 3HOXH 3UEJA 1AE3A 2A73B 3DA3A 3FMCA 3M7GA 2JA5B 3CU7A 5NUCA 4DR5Q 5IP7G 1QVCA 1XXGA 1JB7A 1XBTA 3NBHB 2KHSA 3PIP3 5IYDG 4HFVA 4XXEA 3K7AB 1VQJA 3F2BA 2R7ZB 2RDFA 3DUZA 2N71A 4DK0A 1EL0A 2VUMH 2BE5D 2QF7A 1MJCA 3KBGA 4KKSA 2RDGA 3BYYB 1KBFA 1H9JA 2L1LB 1QE6A 1VQHA 5HI7A 1K8MA 1VQCA 3D0FA 1S72A 3FP9A 4Z9CB 3UDGA 1E2WA 2F0JA 1ZEQX 1TU2B 1A62A 4AH6A 2F0LA 3RZDH 4DNIA 3FBVA 3HOZB 4OWTB 1DS2I 1D7QA 4HAEA 4M8AA 2QDBA 2GN5A 4JV5L 1GXDC 4AS2A 1SNCA 5IYCH 3OXFA 1SNQA 4DNTB 4C3JB 3S1NH 1TWHB 5IGDA 5C4XG 1XA6A 1EIYB 4LNQA 1K83H 3NE5B 4QQBX 1KDCA 2I46A 3OOCA 4A3DB 2OTJA 5IWAQ 1XMQL 2ZJQA 4A3KG 3R2IA 5E3PA 4FF1A 4AIMA 2Y0SB 1TIID 2HQEA 4DK1A 2UUAQ 4A3BB 1X54A 4YZDA 2IW3A 1PH4A 3RZOB 3MXNA 3W5OA 2QPOA 1TQOA 4A3EG 5EPJA 2XIWA 1L1OB 1BDOA 3DWQA 2B2YA 1BR9A 1VF5C 4L8JA 4QIWB 2A68D 4JBMA 3K0YA 3B6YA 1PTOD 5L37A 1SROA 3KDFA 5AFWA 2F3VA 3BZDB 1JQYD 2ALYB 3N52A 5J3BA 1X56A 4JI7L 3ULLA 2I5HA 1RHPA 3I4MB 2TMPA 1SXTA 4BBRG 2FMMA 5IP9G 3OMGA 2XSCA 4NDXA 5C44G 1IBMQ 1JICA 2YU9H 4BS9A 2EIFA 2IY5B 5C5MA 4AQYL 4N8FA 1WTQA 4FYDA 3IFDA 1NMGA 1LTTD 1VQPA 4A3GH 1V1HA 1PRTB 5IGBA 1C4QA 1SSOA 3AB9A 1SGQI 3DA4A 4IUUA 3LNNA 4XQQA 4K5WA 2SGEI 5FUYA 4GLXA 3NUCA 4NPSA 5FLXc 4WP4A 1F9RA 5IYBH 1VQ6A 2IP6A 1KTKA 5CBEE 3P75A 2XTQA 3UE0A 1HA6A 1QCBD 1I4HA 4CDCC 1EY0A 5CV7A 1K7UA 4EQPA 2MJFB 4DV1L 1KIXA 4CGYB 4FXKC 2XWJB 1DCZA 4IUTA 2NTSA 2MFIA 2NUCA 3A56A 3RMHA 4DXFA 3K59A 4BY7H 1I4RA 2OTLA 3PQIA 4JV5Q 2FINB 1CT0I 3T4AC 3JAME 2IHFA 2NU0I 3WDNA 4V0BA 1XMQQ 1TWGB 1A3UA 2GKTI 1N9WA 2K19A 1CT1D 2KENA 2JB2A 1I4XA 4QY7A 2GVAA 3RU0A 2A1AA 2CFMA 1V1IA 3FDTA 3WWVA 5H1SE 2B8TA 4RG1A 4WJ3M 2MPMA 3GTPB 4DAMA 1VQBA 4A3KB 4GLVB 3HOXG 4P71A 4JK1C 1MSGA 1B9NA 5FJ8G 2DGYA 2RIOA 3MEKA 4DV5Q 4HIOA 2N55A 3HH2C 3OHXC 3I3CA 1EY8A 3GD7A 4HR7B 1GHJA 5E3QA 4RKBA 2N49A 4JI7Q 2F0GA 2KJXA 4A3EB 2L15A 4PQXA 1PA6A 4HJ9A 3TP6A 2VUMG 3CCRA 4A3IG 2F0FA 2BH2A 4BBSH 1I94Q 2E5LL 1VQ4A 1RL2A 4IPDA 4KTAA 1V1PA 3BDLA 3K57A 2RKSA 5IODA 1XNQL 1XNRL 2GVBA 3VA7A 1VQDA 2KQ3A 1B70B 3V2TA 4BBRB 5M5XB 4FXDA 4ULLA 2NZ1D 4OX9L 1W6KA 4RA8A 5C44B 4FO2A 3TO7A 2A69D 1S3OA 3H0GH 5EBDA 1N13A 3S1RH 2JB3A 4C1NI 4GOPC 3VA9A 2YTXA 4PG3A 1MI2A 2M00A 4KHPQ 3U58A 3MAQA 1DYQA 3K5MA 3E3XA 1II3A 1V1QA 5CYUA 1LV9A 2DJFC 5D3DA 2LXJA 1ULKA 1SJHD 1A3TA 4UXJA 3D4RA 1X65A 2MQHA 3UGIA 4FDBA 4P72A 3GTOH 4I7ZC 2FXQA 1U9RA 2JXDA 2JQOA 4CBVA 1CA5A 4IUPA 2OEOA 2TSSA 3RN5A 1I5FA 1KD1C 1WTWA 1WKXA 4LAAA 5ELOA 4DR1Q 1CZWA 3RLFA 4KN7C 3A0JA 4XQJA 2BL8A 1HNZL 1J9OA 3K8AA 1CUKA 1F77A 5IY0A 1AN8A 2PW7A 1ICFB 4QB4A 4GKJL 2EY6A 1OMTA 4DK6C 5I4DA 3EQLC 1HPTA 1N34L 3S1MH 2IX0A 4HIDA 3AYHB 3ITPA 3KF6B 2I0QA 4FNFA 4ZLTF 2NVYH 4A3GG 4LFCQ 1I3QH 2WV6D 3H3VI 2A2CA 2F0UA 4MIUA 1EY6A 1PVOA 2KVMA 2E2DC 4A76A 2K75A 4KJOA 3NHHA 4HJ8A 4LF9L 3HOYH 1TWFH 3A7AB 3E2IA 3R5CA 3DLLA 3HOXB 1UNSA 1HTPA 1Z2IA 5IYBG 4I1TA 5EKKA 1BBWA 4DUYL 3KF8A 3HOUG 4L5SA 2DNCA 3KLSA 4A3JH 5IT9L 2NN6H 1KLGD 1BO0A 1WTHA 3CP0A 2F0KA 1WGTA 1OXUA 4TQUS 4QUFA 5JOBA 4R4CA 4NXNL 2NVQB 1N36L 2PI2E 1J5EL 2OXPA 2VUMB 1TY0A 4A3IB 4LF7L 5CV6A 4GN4B 3OIPA 4B9XA 4DR6Q 4P73A 5LNK1 4MN3A 2L4NA 1JT8A 1RJTA 4DKAC 2KCTA 3NSWA 4X64L 3IAS1 4JBJA 1HH2P 4MHEA 5I6YA 4C3HH 2F3IA 4PNYA 4F8MA 3CMEA 1EU4A 3NBHA 3HKZE 1BQQT 3L2PA 4LF6L 1IKLA 1YHQA 1CZGA 4NV2A 4DAYA 1BVSA 2JK8A 4X65Q 3ERQA 2W0TA 1HZBA 2ZXRA 4LF8L 3RR5A 2E74C 3GTKH 2NN6I 5C3EH 1C48A 1JJ2A 3D6CA 4Z7HA 3R8BA 2K5DA 4JOIC 4OO1G 4HMJA 1WTXA 1U0LA 2HD3A 4UAIA 1SFOB 3VE5A 1ASZA 3U9SA 2QW7A 2BOSA 2I5MX 1B7YB 2EJGC 4JI8Q 1JWMD 2EDGA 4EGVA 2VQEL 2CW0D 3MFGA 2FEFA 5GROA 2XRSD 1EU3A 1PH3A 3I4OA 2C5CA 4GNXB 3CCJA 4B6DA 4BBSG 3CC4A 4GOPA 2K14A 1UUCA 3FHWA 3OTOQ 1PRTF 2XGTA 1CGII 1EYGA 2JA5H 4XT1B 3TEHB 3M7NA 4A3CG 4BA1I 1FNWA 5J22A 3A8KE 3OVOA 3K7AH 5M9OA 5FO8B 2R7ZH 1EIGA 1LR9A 4O0AA 3PUYA 2X52A 4JBKA 4R4OA 3C1FA 2C9OA 4DV0Q 1BOSA 3SE0A 4LJZC 1PTQA 4BXXH 1A15A 5I6WA 5EX3A 1KDBA 1XTDA 4A3GB 5KNCA 1X55A 4KHZA 4NXNQ 4QF4A 3SGIA 1J5EQ 4KK7A 4RMFA 1JE5A 4LF7Q 1JCKB 4OHJA 3HOZH 1HDLA 1ICWA 3RLNA 2LFNA 2RHSB 4HJAA 2VXWA 2F0WA 5I2XA 2ORVA 3PDNA 3HOUB 4DR2L 1SGEI 3TBIB 3S16B 4C3JH 1TWHH 2B2TA 2LUYA 5E3FA 2SGQI 4A3DH 1WOCA 2ZJPA 1U5KA 1FR3A 4DPGA 4LF6Q 3HKZG 1LACA 3NK9A 2E2HB 1PV4A 2CCZA 4IQZA 4CJ2C 4L5TA 1K0SA 1SE2A 1L0WA 1SAPA 3F2DA 1AN1I 4RHSA 4A3BH 1H9RA 2UUCQ 4LF8Q 3VYUA 2O5JC 1KMAA 2DIPA 2OQKA 4PL3A 4OGQC 1GUWA 3OXGA 1EQRA 1YNNC 1PMRA 4B3RL 2IHEA 4EVOA 4JI4Q 3T16A 1LT4D 2HHHQ 1SGRI 2G5DA 3T13A 3A5ZB 3W3AA 3HS0C 1MJAA 3X3NA 2Q8RE 1VDDA 1LTLA 3RNUA 1JOKA 3QTLD 2DN8A 2KCXA 2JYYA 1IL2A 3HOYG 4ODGA 3I4MH 2D0OA 1W6JA 2A2DA 1RF2D 2JA6G 1A63A 2WIIB 1Q46A 4B3MQ 3HFZB 1TBRR 3CRKC 1IZ6A 3KY9A 1VQMA 2NN6G 2RSOA 1R9TB 2QILA 2F0QA 2ZXPA 1I4PA 1G2TA 5JPMC 1CT4I 1R79A 3MTSA 2K5WA 3U4ZA 3MWYW 3PIOA 4BBSB 4YWLA 1SYDA 3C46A 1TIHA 4JOIA 4HCSA 3IAYA 2X3TA 1VQ5A 1X74A 2RADA 4RCNA 1CM9A 1TBNA 3QR8A 5IP7H 4C3HG 2ASBA 1QVGA 4ME3A 3F2UA 4X3TA 5IYDH 2ZTEA 4F7XA 4QJFA 1CK1A 1J8IA 3SK5A 1NXUA 2D0PA 3RD4A 4XT3B 3TO6A 1F2ZA 2JA9A 3NTKA 5EAYA 4NXMQ 1BCPC 1D2BA 1WGCA 4LUVA 4JBWA 1RODA 1UUPA 5JJLA 3I8ZA 4LFBQ 4DR3L 1PFSA 1S40A 4DV2Q 2QEJC 4K6DA 4IJHA 5EGTA 4OAUC 4KY7A 4APVA 3ND9A 1FYBA 4G4KA 2KEEA 1DM0B 2PZUA 5M5WB 2L7XA 1S5ED 3CXLA 1WFQA 3GTOB 2UVOA 5EX0A 3GTPH 4DNRB 3D6WA 5GAHC 2NU3I 4A3KH 1YZ6A 1UVFA 3HKZB 4ID6A 2QDLA 4ZUJA 4J1MA 2F6MB 4YCVA 1YU6C 4AMLA 1LYLA 3MFYA 3CCVA 1KABA 4O1NA 1V9PA 3HKSA 1BBXC 4JI2Q 3HRZC 1YO7A 2CH4W 1BUSA 3AQQA 3ONAB 4K14A 3BG3A 5C4JB 5FLMH 4DA2A 2QQCA 3HOVG 2NVYB 4KKUA 1STGA 4RGNA 3GO5A 4G75A 1I3QB 3TMEA 3BVMA 2JB1A 4BBRH 3HOYB 5DM63 4DK3C 2CQOA 1TR5A 3UE1A 2SOBA 1XMOL 2JA6B 5C44H 5GAEC 1ZYRD 2MO1A 2I07B 4IUNA 2GSCA 4J6HA 3S2HB 2ZTCA 2EZVA 1S4ZA 3EN2A 2XN9C 5D3IB 4O1OA 1RCVD 1Q82C 1HZCA 3DM1A 1M8BA 2X6GA
chains in the Genus database with same CATH topology
1P16A 1Q1EA 3G71A 2B0UC 4XIGS 1P8LA 2AHOB 2F4VL 3CCQA 1J6QA 1VQ9A 1OXVA 4DR3Q 1LM0A 4L5RC 2Q2IA 5HQ8A 4A3LH 2B63G 1Z7KB 1TOTA 2UUBL 3K80C 4P74A 1Q86C 4IFDG 1NBWA 3B4VC 3CCMA 5IT9c 3A5UA 1PH2A 3RLOA 3M85A 3T1HL 2E8GA 4OWXB 4YHHL 1HNWQ 5FJ8H 1CKOA 1BBUA 1PJUA 2ODDA 2ERWA 4X62L 5JEAG 3SGBI 2NVQH 4A3IH 1FGUA 1V43A 2N78A 2ZJRA 3JC66 4HIMA 1Y14B 3G4SA 2KMOA 5C0XI 2QA4A 1TUSA 3NEMA 4OXPA 2ZM6Q 4UP8A 4JI5Q 1D8LA 4YZ9A 2VRWB 4K0KQ 4PL5A 5LMNW 1SFOH 3T1YQ 3PF4A 5M3FG 4R1JA 4C3IH 2K5NA 4JI1L 1N33Q 2KHIA 1HNXQ 5FLMG 4U6RA 1M90C 3S24A 3G6EA 3OXLA 3T1HQ 3GOXA 4DV4L 1Y1VG 4UP9A 4NB3A 2YTYA 4GXTA 2UXDL 1X3GA 4MTNA 4X62Q 1VQKA 2MO0A 1GO3E 5K36G 1A0IA 4AS3A 1PPFI 4EX5A 3HOUH 3S16H 1SN8A 4E1PA 1W3SA 1K9MC 2E2HH 4Y52H 1HR0L 3LJ1A 1I50H 2B29A 1IY5A 4A3LG 2L8EA 2K5HA 1WJJA 1QUQB 2SGFI 1GM5A 3L0OA 4LF4L 4YCWA 3S1QH 3I4NH 4A24A 3LGJA 5FUVA 1NY4A 1OXSC 2JE6I 5M3MH 1C9OA 1UWVA 1W4RA 4JI1Q 2Q2UA 3CPFA 5C0XG 2HIVA 1OTCA 3OYYA 4JYAL 3TQYA 4DV3L 1R9TH 4E1RA 1KRTA 1K8AC 3TS2A 4Z7GA 1E3PA 2CWAA 2RCNA 4AQYQ 1VQOA 2A20A 4A3CH 2UZ3A 2VQFL 2JEAI 4OO1I 3L7ZC 1Q7YC 1SE8A 2UU9L 3PCOB 3UITA 3U50C 1FJGL 4DV1Q 2BA0A 3J7ZC 3GDEA 2LSSA 4OONA 4UP7A 3CCEA 1IXRA 2V6EA 4HEA1 1H95A 5M5WH 2UXBL 1YHBA 3H3VH 1L1OC 5GQOA 5IE8A 1EOVA 1VQ7A 5JHWC 2V1CC 3STBC 3I2ZA 3K7UC 5C4JH 2N52A 4JYAQ 4A4IA 4DV3Q 3E9HA 3D00A 2NU2I 4GN3B 2SGPI 4R4IA 2E5LQ 2JA6H 2KCMA 2VW9A 3S2HH 4EQ5A 4GS3A 2VQFQ 2B3GA 5GAGC 1XNQQ 1XNRQ 2IX1A 4OX9Q 2UU9Q 2ENNA 1HR0W 1YBYA 2PQAB 5BR8L 1Z47A 2RF4A 1JJCB 1R0RI 2N8NA 2XTRA 3CCLA 3I4NG 4IJLA 5M3MG 2K50A 1TXYA 2IT1A 1PHJA 3UFFA 1MT1A 4FKDA 2KMRA 1VQNA 3F2CA 2JA8G 2I5LX 3ICEA 2QGQA 2MNAA 1TURA 2VS1A 2KHJA 2KMPA 1HNZQ 4GKJQ 4Y7NH 1WYDA 1N34Q 2ES2A 3PO3G 2A8VA 2H5XA 3E59A 4UXHA 3PUZA 1KXLA 1O7IA 3FC3A 3PGZA 4LF9Q 1L1OA 3OW2A 3P23A 4DUYQ 1YNXA 4L9MA 4SGBI 3HOVH 1KRSA 1VQLA 2OWOA 1N36Q 1G291 2V1CA 2AMCB 1LR8A 4X64Q 1NJIC 4IPGA 2E73A 3M3YH 2R7FA 3J81c 2YTVA 4JI0L 3MXNB 2ZTDA 1SGPI 4B3TL 1EQQA 3NELA 3VDUA 2Z6KC 4JC0A 3ULJA 3KDFB 3GTMH 4DR7L 2VNUD 2VQEQ 2NVTH 2B63H 1XJVA 1QUQA 1M1KC 2P22B 1UE1A 3TRZA 4HJ7A 3LJ0A 2YYZA 1IBKL 1Y1CA 4LUOA 2E5RA 3UGLA 4YWKA 2C35B 2JW6A 1YEZA 4JI6L 3JAMc 3JSBA 3SEKC 3UEYA 1OXTA 4GKKL 4IFDI 4WJ4A 2OCEA 1AE2A 4DR2Q 4DV6L 3PO2H 1Q8KA 1KC8C 3GTQH 1UE7A 2JA7G 1UVGA 3E0EA 4B3SL 1JJGA 2DUDA 5GADC 4LFAL 4LUZA 3EIVA 2LEOA 1VQEA 2CKZB 1SRUA 1Y1WG 4HGUA 1N32L 3UDXA 1YI2A 4B3TQ 2BA1A 2YUUA 4IPCA 4B3RQ 4GNXC 2ENZA 4X66L 5LMNL 4QIWE 4OVOA 1CGJI 4DR7Q 2Z0SA 2YFAA 3KJOA 1TWCH 1T9HA 5M3FH 2D62A 1EIFA 4O1PA 1X3FA 2R7DA 2F66B 1IYJB 4DV7L 1AH9A 4A3FG 1M8CA 1IW4A 1IBKQ 4C2MH 1WCMG 1Y8FA 2ORWA 2Z6KA 1SMXA 4UXIA 1Y1VH 4O2DA 4DUZL 4IPHA 1QZGA 3J81i 4JI6Q 2R92G 5E7NA 1Q12A 4DR5L 1NTGA 3KF6A 4UY8C 1PH1A 1NE3A 3BZKA 2N1AB 2RHQB 1LUZA 4A93G 3CD6A 4POFA 1G6PA 4IO9A 2KBNA 3CCUA 1N32Q 1HJAI 1Y1BA 2EQSA 2AWNA 2WCYA 3CCSA 3H15A 3EBEA 5LMNQ 3GTGH 3W1GA 3M4OH 4KI0A 2SGDI 5JJIA 1CHOI 3CQZH 1CKMA 4QL5A 1E7ZA 4DV7Q 1OVOA 3CC7A 3I7FA 2WB1E 3JAMi 1K0RA 3PF5A 2K4KA 1Z9FA 4KLKA 2JZMA 1SGNI 1XMOQ 4GNXA 4XTCS 4DUZQ 1UE5A 2QEXA 3PO2G 2HT1A 1C0AA 4GLAC 2BUSA 1IBML 1PYSB 4PZ7A 3KP9A 2CJSC 4G76A 2DB6A 4DAYB 3KLWA 3J7A5 3SDJA 2F4VQ 1EFWA 4BY1G 3K81C 3AFPA 1DS3I 2KMQA 1GD7A 2VZAA 2ID0A 1VQ8A 4YZCA 2UUBQ 4DWLA 2WVJA 4DR4L 4GOPB 1GVPA 1YJ9A 4J15A 3BJIA 3W1BA 1QZHA 4L5QA 1NMFA 2NZHA 3PSIA 1WI5A 4H02A 1JMCA 1YJNA 1XPRA 1PYBA 3UDIA 4YHHQ 4IOAA 1EUJA 1H0ZA 2WB1G 1X9NA 3DM3A 4DV5L 1I94L 2KKMA 4UPAA 3S17H 3CC2A 4A3MG 1XX6A 4PZ6A 4LF5L 3ULPA 1VQIA 1Q1BA 2AWOA 1OXXK 1CSOI 2PNHA 4HJ5A 1PH8A 1IBLL 2OVOA 4KHPL 1CKNB 3F4MA 2GVIA 2YQPA 4DR4Q 1HJPA 3I9V1 3J81j 1VQFA 5DAEA 5C0XJ 4BA2I 2JA8H 3HOWH 2PI2A 4OWWB 5CCLA 3FKIG 4JG2A 4DR1L 3VDYA 2QQ0A 1TBOA 2NU1I 4DV4Q 2EXDA 2Q2HA 2UXDQ 3PO3H 3VDPA 4LFCL 2AKWB 2Q2TA 4OAVB 2M5XA 1I6HH 3K0XA 1K8GA 1PH7A 4LF5Q 1QVFA 3M4PA 1HR0Q 3PIPA 3G48A 4R4TA 4DR6L 3STBD 5IYCG 3U4VA 5CCMA 1E24A 2HIXA 3J80c 1TWAH 1BKBA 5AJ3L 1KBEA 4AYBE 1G51A 1K73C 3AJFA 4LF4Q 1E1TA 1SJ8A 1IBLQ 3TREA 2NZOA 4X65L 4JI3L 3I56A 1VQAA 3IRBA 1UE6A 3KJPA 3AEVA 4JI8L 1A8VA 2WFWA 2WAQE 1XPOA 3KOJA 3M4QA 3OTOL 1SGYI 1FAQA 2VY3A 1TBQR 3PUVA 1X6OA 5JJKA 1L2FA 2FNFX 4DV0L 3UDFA 2YFBA 1FJGQ 5M5YH 1KQSA 1DGSA 4P75A 1E1OA 2YV5A 4BY7G 1CT2I 2UXCL 2JA7H 2UXBQ 5AJ3Q 2OD1A 4ALPA 2JA1A 1N8RC 4AYBG 3HOWG 1IY6A 2ARPF 1Y1WH 3PUXA 4JI3Q 2UUCL 2ELIA 1LR7A 1RIPA 2N3SA 4LW1A 5LMUL 4A75A 2OQ0A 1YHAA 2XTIA 4JI4L 3PV0A 3E9IA 2HHHL 3A74A 3L0IA 1FL0A 3Q8DA 3ZJYC 1TGSI 2R6GA 2F52A 2CWPA 1MKHA 2WAQG 3BU2A 4MNOA 4A3FH 2E2IH 1VS0A 4B3ML 4QGUA 4PL4A 2NU4I 2QQEA 3CPWA 1WCMH 1XPUA 5BR8Q 3J80i 3PUWA 2R92H 3H0GG 1HZ9A 2K5VA 2J87A 3ER0A 1OMUA 4NV5A 1B8AA 4A93H 2UXCQ 4NXML 2ATWA 1GKHA 1YVCA 4LWCA 3AFQA 4LFBL 2P6AC 1K3RA 4DV2L 2HQLA 3I55A 5FUWA 4HIKA 1BMOA 2R93H 1YJWA 2JJQA 3LJ2A 5FUXA 3RZOH 1CSPA 2GKVA 5LMUQ 2ROWA 1SGDI 5DLQE 4YY3L 1CKNA 2ZRRA 4PMWA 3GTLH 1PH5A 4TVAB 1RFHA 4JI2L 1SR3A 1ASYA 3ERSX 2QQDA 1X4SA 3S14H 2CAZB 4A3JG 2JEBI 1HZAA 4JCVE 3GTJH 1UEBA 2FUG1 1FARA 3CF5A 4JI0Q 3IAM1 2Y0SE 4MZ9A 3TS0A 1YITA 2A19A 4BY1H 3CXCA 2JAEA 1W2BA 4GI3C 5C3EG 5HY6A 1TWGH 3S2DH 1C7YA 2XRCA 2E2JH 5C4XH 3F8TA 2F3CI 3RN2A 1PH9A 2XMXA 1FVIA 2NVXH 3M9BA 4IOCA 2VL6A 4PZ8A 4YY3Q 2JA5G 3CMAA 2LXKA 4X6AH 2K52A 1X3EA 3NENA 4A3EH 2R7ZG 4YCUA 1HNWL 4BXXG 3TJQA 1KL9A 3F1ZA 3DO9A 4GKKQ 1MIUA 4Q9VA 3OL0A 3HOZG 5HGIA 5M5XH 4DV6Q 2WP8J 4R4QA 5IP9H 1MJEA 4B3SQ 4A3MH 1E22A 1SLJA 4LFAQ 2GKRI 4A3DG 2K9HA 2N17A 1CE3A 2Y0SG 2J9RA 2BH8A 2ZM6L 4A3BG 2R93G 4JI5L 1VCIA 3QWPA 2PQAA 2PMZE 3SGQI 4X66Q 1CSQA 3CAMA 5IWAL 3D31A 4IFDJ 4K0KL 3KYHC 1VQGA 3S15H 3T1YL 1Q81C 2UUAL 1PH6A 3KFUA 3UGDA 3I4MG 1N33L 4YWMA 1OYVI 1PTRA 4POGA 1EWIA 1PCEA 3KF8B 1HNXL 1KAWA 1YIJA 3BZCA 3BJUA 5ELNA 3FKIH 4GN5A 5HGQA 5JEAJ 1YTPA 2V53A 1NUBA 3MEFA 3CW2C 1KHIA 3HOXH 3UEJA 1AE3A 3DA3A 4DR5Q 5IP7G 1QVCA 1JB7A 1XBTA 3NBHB 5IYDG 4HFVA 1VQJA 3F2BA 2N71A 2VUMH 1MJCA 1KBFA 2L1LB 1VQHA 5HI7A 1VQCA 3D0FA 1S72A 3FP9A 3UDGA 1A62A 4AH6A 3RZDH 4DNIA 3FBVA 4OWTB 1DS2I 1D7QA 2GN5A 4JV5L 4AS2A 5IYCH 3OXFA 3S1NH 1XA6A 5C4XG 1EIYB 4LNQA 1K83H 4QQBX 2OTJA 5IWAQ 1XMQL 2ZJQA 4A3KG 4AIMA 2UUAQ 1X54A 4YZDA 1PH4A 3W5OA 2QPOA 4A3EG 1L1OB 4JBMA 3B6YA 1SROA 3KDFA 2ALYB 5J3BA 1X56A 4JI7L 3ULLA 2I5HA 4BBRG 5IP9G 5C44G 1IBMQ 2YU9H 2EIFA 2IY5B 4AQYL 1NMGA 1VQPA 4A3GH 1V1HA 1SGQI 3DA4A 2SGEI 5FUYA 4GLXA 4NPSA 5FLXc 5IYBH 1VQ6A 2IP6A 2XTQA 3UE0A 2MJFB 4DV1L 1KIXA 2MFIA 4BY7H 2OTLA 4JV5Q 1CT0I 2IHFA 2NU0I 1XMQQ 2GKTI 1N9WA 2K19A 2KENA 2JB2A 4QY7A 3RU0A 2GVAA 2A1AA 2CFMA 1V1IA 3WWVA 5H1SE 2B8TA 4RG1A 4WJ3M 4DAMA 1VQBA 4GLVB 3HOXG 4P71A 5FJ8G 2DGYA 2RIOA 3MEKA 4DV5Q 4HIOA 3HH2C 3GD7A 2N49A 4JI7Q 2L15A 1PA6A 4HJ9A 2VUMG 3CCRA 4A3IG 2BH2A 4BBSH 1I94Q 2E5LL 1VQ4A 1RL2A 4IPDA 1XNQL 1XNRL 2GVBA 1VQDA 1B70B 4OX9L 1S3OA 3H0GH 1N13A 3S1RH 2JB3A 4GOPC 3VA9A 2YTXA 4PG3A 4KHPQ 3U58A 1V1QA 2LXJA 4UXJA 1X65A 2MQHA 3UGIA 4FDBA 4P72A 3GTOH 2FXQA 2JXDA 2JQOA 3RN5A 1I5FA 1KD1C 5ELOA 4DR1Q 3RLFA 3A0JA 1HNZL 3K8AA 1CUKA 5IY0A 4GKJL 1OMTA 4DK6C 1HPTA 1N34L 3S1MH 2IX0A 4HIDA 3AYHB 3KF6B 2I0QA 2NVYH 4A3GG 4LFCQ 1I3QH 3H3VI 2A2CA 1PVOA 4A76A 2K75A 4HJ8A 4LF9L 3HOYH 1TWFH 3E2IA 3DLLA 5IYBG 4I1TA 4DUYL 1BBWA 3HOUG 4L5SA 4A3JH 3CP0A 1OXUA 4TQUS 4R4CA 4NXNL 1N36L 2PI2E 1J5EL 4LF7L 4GN4B 4DR6Q 4P73A 5LNK1 1JT8A 4DKAC 2KCTA 4X64L 3IAS1 4JBJA 1HH2P 4C3HH 2F3IA 3CMEA 3HKZE 3L2PA 4LF6L 1YHQA 4NV2A 1BVSA 2JK8A 4X65Q 2W0TA 1HZBA 4LF8L 3RR5A 3GTKH 2NN6I 5C3EH 1JJ2A 4Z7HA 4JOIC 4OO1G 1U0LA 3VE5A 1ASZA 2I5MX 1B7YB 4JI8Q 2VQEL 5GROA 1PH3A 3I4OA 4GNXB 3CCJA 4B6DA 4BBSG 3CC4A 4GOPA 2K14A 1UUCA 3FHWA 3OTOQ 2XGTA 1CGII 1EYGA 2JA5H 3TEHB 3M7NA 4A3CG 4BA1I 3OVOA 3K7AH 2R7ZH 1LR9A 4O0AA 3PUYA 4JBKA 4R4OA 4DV0Q 1PTQA 4BXXH 5EX3A 1XTDA 1X55A 4KHZA 4NXNQ 3SGIA 1J5EQ 4RMFA 1JE5A 4LF7Q 3HOZH 1HDLA 3RLNA 2RHSB 4HJAA 2ORVA 3PDNA 4DR2L 1SGEI 4C3JH 1TWHH 2LUYA 2SGQI 4A3DH 1WOCA 2ZJPA 1U5KA 4DPGA 4LF6Q 3HKZG 1PV4A 2CCZA 4L5TA 1L0WA 3F2DA 1AN1I 4A3BH 4LF8Q 2UUCQ 1KMAA 2DIPA 2OQKA 4PL3A 3OXGA 1EQRA 4B3RL 2IHEA 4JI4Q 2HHHQ 1SGRI 3A5ZB 1VDDA 1LTLA 3RNUA 3QTLD 2KCXA 2JYYA 1IL2A 3HOYG 3I4MH 2D0OA 2A2DA 2JA6G 1A63A 1Q46A 4B3MQ 3HFZB 1TBRR 1IZ6A 3KY9A 1VQMA 2NN6G 1CT4I 1R79A 3U4ZA 3PIOA 4YWLA 1TIHA 4JOIA 1VQ5A 1X74A 1TBNA 5IP7H 2ASBA 1QVGA 4ME3A 5IYDH 2ZTEA 4QJFA 2D0PA 2JA9A 5EAYA 4NXMQ 4LUVA 4JBWA 5JJLA 4LFBQ 4DR3L 1PFSA 1S40A 4DV2Q 4IJHA 4OAUC 4APVA 1FYBA 2L7XA 3CXLA 1WFQA 5EX0A 3GTPH 5GAHC 2NU3I 4A3KH 1YZ6A 1UVFA 2F6MB 4YCVA 1YU6C 1LYLA 3CCVA 1V9PA 3HKSA 4JI2Q 1YO7A 1BUSA 3AQQA 5FLMH 2QQCA 3HOVG 3GO5A 4G75A 2JB1A 4BBRH 4DK3C 2CQOA 3UE1A 1XMOL 5C44H 5GAEC 2MO1A 2ZTCA 3EN2A 4O1OA 1Q82C 1HZCA 1M8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJP A;  3NEL A;  5IP9 G;  1P16 A;  5C44 G;  1Q1E A;  2Z6K C;  4JI8 L;  1IBM Q;  3AEV A;  2YU9 H;  1A8V A;  3G71 A;  4JC0 A;  2EIF A;  4XIG S;  1P8L A;  4AQY L;  2IY5 B;  2AHO B;  3ULJ A;  3CCQ A;  3KDF B;  1J6Q A;  2F4V L;  1NMG A;  2WFW A;  1VQ9 A;  3GTM H;  4DR7 L;  2VNU D;  2WAQ E;  1VQP A;  4A3G H;  1OXV A;  2VQE Q;  1XPO A;  4DR3 Q;  3KOJ A;  2NVT H;  2B63 H;  3M4Q A;  1LM0 A;  4L5R C;  2Q2I A;  3OTO L;  1XJV A;  4GLX A;  4NPS A;  5FLX c;  1QUQ A;  5IYB H;  1M1K C;  2VY3 A;  1VQ6 A;  1UE1 A;  3TRZ A;  4HJ7 A;  3PUV A;  4A3L H;  1X6O A;  2B63 G;  3UE0 A;  5JJK A;  2UUB L;  4DV1 L;  3K80 C;  1KIX A;  1L2F A;  2YYZ A;  4P74 A;  1IBK L;  4LUO A;  2MFI A;  4DV0 L;  1Q86 C;  3UDF A;  4IFD G;  1NBW A;  1FJG Q;  4BY7 H;  2OTL A;  3CCM A;  4JV5 Q;  5M5Y H;  5IT9 c;  3A5U A;  1PH2 A;  4YWK A;  1KQS A;  2C35 B;  2IHF A;  1DGS A;  3RLO A;  3M85 A;  1XMQ Q;  1YEZ A;  4P75 A;  1E1O A;  4JI6 L;  3JAM c;  1N9W A;  2YV5 A;  4BY7 G;  2KEN A;  2UXC L;  4QY7 A;  3T1H L;  2GVA A;  2JA7 H;  2UXB Q;  1OXT A;  4GKK L;  2A1A A;  2CFM A;  2E8G A;  4IFD I;  5AJ3 Q;  4OWX B;  4WJ4 A;  4YHH L;  1HNW Q;  3WWV A;  5H1S E;  4ALP A;  5FJ8 H;  1CKO A;  4RG1 A;  1N8R C;  4WJ3 M;  1BBU A;  2OCE A;  1AE2 A;  4AYB G;  4DR2 Q;  4DV6 L;  3PO2 H;  1Q8K A;  1KC8 C;  4X62 L;  3GTQ H;  1UE7 A;  3HOW G;  4DAM A;  5JEA G;  1VQB A;  2JA7 G;  3E0E A;  4GLV B;  3HOX G;  1Y1W H;  4P71 A;  4B3S L;  2NVQ H;  1JJG A;  3PUX A;  2DUD A;  4A3I H;  5GAD C;  4LFA L;  4JI3 Q;  2UUC L;  5FJ8 G;  2DGY A;  1FGU A;  4LUZ A;  1V43 A;  4DV5 Q;  4HIO A;  2N78 A;  2ZJR A;  3JC6 6;  1RIP A;  3GD7 A;  3EIV A;  2N3S A;  4LW1 A;  2N49 A;  1VQE A;  5LMU L;  4JI7 Q;  4HIM A;  2CKZ B;  4A75 A;  1SRU A;  2L15 A;  2OQ0 A;  1Y1W G;  1PA6 A;  1N32 L;  3UDX A;  1YHA A;  4HJ9 A;  1Y14 B;  2XTI A;  1YI2 A;  4B3T Q;  3CCR A;  4A3I G;  2BA1 A;  4JI4 L;  2BH2 A;  2VUM G;  4IPC A;  3PV0 A;  3E9I A;  3G4S A;  4BBS H;  2HHH L;  1I94 Q;  5C0X I;  2QA4 A;  2E5L L;  3NEM A;  1VQ4 A;  4B3R Q;  4GNX C;  1RL2 A;  3A74 A;  1FL0 A;  4X66 L;  3Q8D A;  5LMN L;  4OXP A;  4QIW E;  4IPD A;  2ZM6 Q;  3ZJY C;  4UP8 A;  4DR7 Q;  4JI5 Q;  2R6G A;  2Z0S A;  3KJO A;  2F52 A;  1TWC H;  2CWP A;  1XNQ L;  1XNR L;  2GVB A;  1MKH A;  2WAQ G;  1T9H A;  3BU2 A;  1D8L A;  4MNO A;  1VQD A;  2D62 A;  1B70 B;  5M3F H;  1EIF A;  4A3F H;  2E2I H;  4OX9 L;  1VS0 A;  4B3M L;  1X3F A;  4K0K Q;  4QGU A;  5LMN W;  1SFO H;  2R7D A;  3T1Y Q;  3CPW A;  1IYJ B;  4DV7 L;  1AH9 A;  1S3O A;  3H0G H;  3PF4 A;  1WCM H;  5M3F G;  4A3F G;  3S1R H;  4GOP C;  2YTX A;  4PG3 A;  1XPU A;  4R1J A;  4KHP Q;  5BR8 Q;  4C3I H;  2K5N A;  4JI1 L;  3J80 i;  3U58 A;  1IBK Q;  3PUW A;  1N33 Q;  1V1Q A;  2R92 H;  2KHI A;  1HNX Q;  4C2M H;  3H0G G;  1WCM G;  1HZ9 A;  2K5V A;  2Z6K A;  2LXJ A;  1SMX A;  5FLM G;  3ER0 A;  1Y1V H;  4O2D A;  1X65 A;  2MQH A;  4IPH A;  4DUZ L;  4FDB A;  4P72 A;  1QZG A;  3GTO H;  2FXQ A;  3J81 i;  1M90 C;  4JI6 Q;  3S24 A;  2JQO A;  2R92 G;  1B8A A;  3G6E A;  5E7N A;  1Q12 A;  4DR5 L;  4NXM L;  1NTG A;  3KF6 A;  3T1H Q;  4A93 H;  2UXC Q;  3RN5 A;  1I5F A;  1KD1 C;  4DV4 L;  4UY8 C;  1Y1V G;  2ATW A;  1GKH A;  5ELO A;  1YVC A;  4UP9 A;  4DR1 Q;  4LWC A;  3AFQ A;  4LFB L;  3RLF A;  1PH1 A;  1NE3 A;  4NB3 A;  3BZK A;  1K3R A;  4DV2 L;  2HQL A;  2YTY A;  2UXD L;  2RHQ B;  1X3G A;  1LUZ A;  3A0J A;  4MTN A;  4X62 Q;  3I55 A;  1VQK A;  3CD6 A;  4A93 G;  4HIK A;  2MO0 A;  1HNZ L;  1GO3 E;  4POF A;  3K8A A;  1CUK A;  5IY0 A;  4GKJ L;  1G6P A;  4IO9 A;  4DK6 C;  2R93 H;  5K36 G;  1YJW A;  2JJQ A;  1A0I A;  2KBN A;  3RZO H;  1N34 L;  3S1M H;  1CSP A;  2IX0 A;  3AYH B;  3KF6 B;  4HID A;  2I0Q A;  4EX5 A;  2NVY H;  4A3G G;  4LFC Q;  5LMU Q;  1I3Q H;  3HOU H;  3H3V I;  3S16 H;  3CCU A;  1PVO A;  5DLQ E;  1N32 Q;  1SN8 A;  4A76 A;  2K75 A;  4HJ8 A;  2EQS A;  4LF9 L;  3HOY H;  1TWF H;  3DLL A;  2AWN A;  1W3S A;  4YY3 L;  1K9M C;  3CCS A;  1CKN A;  3H15 A;  3EBE A;  5LMN Q;  2E2H H;  5IYB G;  1HR0 L;  4Y52 H;  4DUY L;  1BBW A;  3HOU G;  1I50 H;  2B29 A;  4L5S A;  3GTG H;  4A3J H;  3W1G A;  4A3L G;  4PMW A;  2K5H A;  3GTL H;  4KI0 A;  3M4O H;  3CP0 A;  1OXU A;  1PH5 A;  1WJJ A;  4TQU S;  4TVA B;  4R4C A;  1QUQ B;  4NXN L;  4JI2 L;  1N36 L;  5JJI A;  1SR3 A;  2PI2 E;  1J5E L;  3ERS X;  1ASY A;  4LF7 L;  4GN4 B;  4DR6 Q;  4P73 A;  3CQZ H;  1CKM A;  1GM5 A;  3S14 H;  4QL5 A;  3L0O A;  4A3J G;  1JT8 A;  4LF4 L;  1E7Z A;  4DV7 Q;  4DKA C;  2KCT A;  2JEB I;  4X64 L;  4YCW A;  4JBJ A;  1HH2 P;  3S1Q H;  3CC7 A;  3I7F A;  1HZA A;  2WB1 E;  2F3I A;  4C3H H;  1K0R A;  3JAM i;  3CME A;  3LGJ A;  3PF5 A;  1NY4 A;  3I4N H;  4JCV E;  1OXS C;  2JE6 I;  5M3M H;  3HKZ E;  3GTJ H;  1UEB A;  2K4K A;  1Z9F A;  1C9O A;  1UWV A;  3L2P A;  4JI1 Q;  4LF6 L;  2Q2U A;  3CPF A;  1YHQ A;  4KLK A;  5C0X G;  1BVS A;  3CF5 A;  2HIV A;  2JK8 A;  4X65 Q;  1HZB A;  1OTC A;  4JI0 Q;  4LF8 L;  3RR5 A;  1XMO Q;  3GTK H;  2NN6 I;  3OYY A;  5C3E H;  4GNX A;  4XTC S;  4DUZ Q;  1UE5 A;  2QEX A;  4JYA L;  3TQY A;  2Y0S E;  4MZ9 A;  3TS0 A;  1YIT A;  1JJ2 A;  4DV3 L;  1R9T H;  2HT1 A;  3PO2 G;  1C0A A;  4GLA C;  4JOI C;  1KRT A;  1K8A C;  1IBM L;  4OO1 G;  2A19 A;  1U0L A;  3TS2 A;  1PYS B;  4PZ7 A;  1ASZ A;  4BY1 H;  3CXC A;  1W2B A;  1E3P A;  2I5M X;  1B7Y B;  5C3E G;  4JI8 Q;  2VQE L;  2CWA A;  4DAY B;  3KLW A;  3J7A 5;  2RCN A;  4AQY Q;  5HY6 A;  5GRO A;  2F4V Q;  1TWG H;  1VQO A;  1PH3 A;  3S2D H;  3I4O A;  4A3C H;  2VQF L;  4GNX B;  4BY1 G;  3CCJ A;  1C7Y A;  1EFW A;  2JEA I;  4BBS G;  3CC4 A;  4GOP A;  2K14 A;  4OO1 I;  3L7Z C;  3FHW A;  3OTO Q;  2XGT A;  1Q7Y C;  1SE8 A;  2UU9 L;  1EYG A;  2E2J H;  2JA5 H;  3K81 C;  3TEH B;  5C4X H;  3AFP A;  3F8T A;  3M7N A;  4A3C G;  4BA1 I;  3RN2 A;  1PH9 A;  3PCO B;  1FVI A;  1GD7 A;  2VZA A;  3K7A H;  2NVX H;  3U50 C;  2ID0 A;  1VQ8 A;  2R7Z H;  1FJG L;  2UUB Q;  4O0A A;  3M9B A;  3PUY A;  2VL6 A;  4DV1 Q;  4PZ8 A;  4IOC A;  4JBK A;  4R4O A;  2BA0 A;  4YY3 Q;  3CMA A;  2JA5 G;  4DV0 Q;  2LXK A;  3J7Z C;  4X6A H;  4DR4 L;  2K52 A;  4GOP B;  1GVP A;  3GDE A;  1YJ9 A;  4J15 A;  2LSS A;  3W1B A;  4OON A;  4UP7 A;  3CCE A;  4BXX H;  1IXR A;  1X3E A;  1QZH A;  1XTD A;  4L5Q A;  3NEN A;  1NMF A;  4A3E H;  2R7Z G;  1X55 A;  5M5W H;  1H95 A;  4KHZ A;  4NXN Q;  2NZH A;  3SGI A;  1YHB A;  3PSI A;  1J5E Q;  4RMF A;  4YCU A;  1WI5 A;  3H3V H;  2UXB L;  1JE5 A;  4H02 A;  4LF7 Q;  1L1O C;  3HOZ H;  1HNW L;  5GQO A;  3RLN A;  5IE8 A;  1YJN A;  1JMC A;  4BXX G;  2RHS B;  1XPR A;  1KL9 A;  1PYB A;  4HJA A;  3F1Z A;  4GKK Q;  1MIU A;  3UDI A;  4DR2 L;  4YHH Q;  1EOV A;  4C3J H;  1TWH H;  4IOA A;  1VQ7 A;  1EUJ A;  4A3D H;  1WOC A;  3HOZ G;  2WB1 G;  2V1C C;  3STB C;  2ZJP A;  5M5X H;  4DV6 Q;  1X9N A;  1U5K A;  4DPG A;  2WP8 J;  4LF6 Q;  3I2Z A;  4R4Q A;  3HKZ G;  5IP9 H;  3DM3 A;  4DV5 L;  1MJE A;  1PV4 A;  4B3S Q;  2CCZ A;  3K7U C;  4A3M H;  1E22 A;  1SLJ A;  4L5T A;  1L0W A;  3F2D A;  4LFA Q;  4A3B H;  4LF8 Q;  2UUC Q;  4A3D G;  5C4J H;  4JYA Q;  4A4I A;  2OQK A;  4DV3 Q;  1I94 L;  1EQR A;  4UPA A;  2Y0S G;  3S17 H;  3E9H A;  3CC2 A;  4A3M G;  4B3R L;  2IHE A;  2BH8 A;  4GN3 B;  2ZM6 L;  4JI4 Q;  4PZ6 A;  4A3B G;  2R93 G;  2HHH Q;  4JI5 L;  1VCI A;  2PQA A;  3A5Z B;  4R4I A;  2E5L Q;  4LF5 L;  2PMZ E;  2JA6 H;  3ULP A;  2KCM A;  4X66 Q;  1CSQ A;  3CAM A;  2VW9 A;  5IWA L;  1VQI A;  3D31 A;  4EQ5 A;  3S2H H;  1LTL A;  3RNU A;  4IFD J;  1Q1B A;  4GS3 A;  2AWO A;  2VQF Q;  2B3G A;  5GAG C;  1XNQ Q;  1XNR Q;  1IL2 A;  3HOY G;  3I4M H;  4K0K L;  2D0O A;  3KYH C;  1VQG A;  1OXX K;  3S15 H;  3T1Y L;  1Q81 C;  2UUA L;  2JA6 G;  2IX1 A;  1A63 A;  4OX9 Q;  1Q46 A;  4B3M Q;  2UU9 Q;  3HFZ B;  2PNH A;  1IZ6 A;  1HR0 W;  4HJ5 A;  1VQM A;  1PH6 A;  1PH8 A;  2NN6 G;  3KFU A;  1IBL L;  4KHP L;  1YBY A;  2PQA B;  5BR8 L;  1N33 L;  4YWM A;  3I4M G;  1CKN B;  4POG A;  1EWI A;  3U4Z A;  1Z47 A;  3KF8 B;  3PIO A;  2RF4 A;  1KAW A;  1YIJ A;  1JJC B;  1HNX L;  3BZC A;  4YWL A;  4JOI A;  3BJU A;  5ELN A;  4DR4 Q;  1VQ5 A;  1HJP A;  3FKI H;  4GN5 A;  2N8N A;  5HGQ A;  3CCL A;  5IP7 H;  3J81 j;  1VQF A;  5JEA J;  1QVG A;  4ME3 A;  2ASB A;  3I4N G;  5C0X J;  2ZTE A;  5IYD H;  4IJL A;  4BA2 I;  5M3M G;  2K50 A;  2JA8 H;  1TXY A;  3HOW H;  2IT1 A;  1PHJ A;  2PI2 A;  4QJF A;  3MEF A;  3CW2 C;  4OWW B;  1KHI A;  3HOX H;  1AE3 A;  2D0P A;  3FKI G;  4JG2 A;  4DR1 L;  3VDY A;  1VQN A;  2JA9 A;  5EAY A;  4DR5 Q;  5IP7 G;  1QVC A;  4NXM Q;  3F2C A;  1JB7 A;  3NBH B;  5IYD G;  4LUV A;  4DV4 Q;  4JBW A;  2JA8 G;  1VQJ A;  2EXD A;  2Q2H A;  3F2B A;  5JJL A;  2I5L X;  3ICE A;  4LFB Q;  4DR3 L;  1PFS A;  2QGQ A;  1S40 A;  4DV2 Q;  2MNA A;  2UXD Q;  2VUM H;  2VS1 A;  3PO3 H;  4IJH A;  2KHJ A;  1MJC A;  1HNZ Q;  4APV A;  1VQH A;  1VQC A;  4GKJ Q;  3D0F A;  4LFC L;  4Y7N H;  1S72 A;  3FP9 A;  1WYD A;  3UDG A;  2AKW B;  1N34 Q;  2Q2T A;  1A62 A;  4AH6 A;  2ES2 A;  3RZD H;  1WFQ A;  3PO3 G;  1I6H H;  4DNI A;  2A8V A;  2H5X A;  4OWT B;  3GTP H;  5GAH C;  3PUZ A;  1D7Q A;  4A3K H;  1YZ6 A;  1KXL A;  1O7I A;  3K0X A;  2GN5 A;  1K8G A;  3PGZ A;  4LF9 Q;  4JV5 L;  5IYC H;  1PH7 A;  1L1O A;  3S1N H;  4LF5 Q;  5C4X G;  4YCV A;  1EIY B;  4LNQ A;  1K83 H;  1QVF A;  3M4P A;  4QQB X;  3OW2 A;  1HR0 Q;  4DUY Q;  1LYL A;  1YNX A;  3CCV A;  2OTJ A;  5IWA Q;  3PIP A;  1XMQ L;  3G48 A;  4R4T A;  2ZJQ A;  3HOV H;  1KRS A;  4A3K G;  1V9P A;  4DR6 L;  3HKS A;  1VQL A;  3STB D;  4AIM A;  5IYC G;  3U4V A;  2OWO A;  4JI2 Q;  1N36 Q;  1G29 1;  2UUA Q;  1E24 A;  2HIX A;  3J80 c;  1TWA H;  1X54 A;  1BKB A;  2AMC B;  5AJ3 L;  3AQQ A;  4AYB E;  1PH4 A;  1G51 A;  5FLM H;  1K73 C;  3W5O A;  3HOV G;  4LF4 Q;  1E1T A;  1IBL Q;  3GO5 A;  4A3E G;  4X64 Q;  1L1O B;  1NJI C;  4IPG A;  3TRE A;  3M3Y H;  4JBM A;  2NZO A;  2R7F A;  3B6Y A;  3J81 c;  1SRO A;  4X65 L;  4BBR H;  2YTV A;  3KDF A;  4DK3 C;  2CQO A;  4JI3 L;  3UE1 A;  4JI0 L;  1XMO L;  5C44 H;  5GAE C;  3I56 A;  2MO1 A;  2ALY B;  2ZTC A;  5J3B A;  1X56 A;  3EN2 A;  4JI7 L;  1VQA A;  3ULL A;  2I5H A;  3IRB A;  1UE6 A;  1Q82 C;  1HZC A;  3MXN B;  2ZTD A;  4BBR G;  4B3T L;  1EQQ A; 
#chains in the Genus database with same CATH topology
 1P16 A;  1Q1E A;  2EYP A;  3A55 A;  3G71 A;  2B0U C;  4XIG S;  1P8L A;  1G91 A;  2AHO B;  4KKT A;  2F4V L;  3CCQ A;  1J6Q A;  1VQ9 A;  2CWG A;  1PTO B;  1OXV A;  4C3H B;  3BDC A;  4DR3 Q;  1QJO A;  1LM0 A;  4L5R C;  2Q2I A;  1DD2 A;  2PYK A;  1JOR A;  1QB5 D;  1V1O A;  1SYE A;  3QB3 A;  4RWS C;  1SMY C;  1EY9 A;  5HQ8 A;  3GTK B;  4A3L H;  2B63 G;  1AZQ A;  4KHV A;  5ELF A;  1Z7K B;  1QNU A;  3FPU B;  1TOT A;  1D1K A;  2EY1 A;  2UUB L;  3K80 C;  4P74 A;  1T5X D;  1Q86 C;  4IFD G;  1NBW A;  3B4V C;  3CCM A;  5IT9 c;  1B50 A;  3A5U A;  1PH2 A;  5K5P A;  3U9O A;  4XDX A;  1CA6 A;  3RLO A;  3M85 A;  1A6X A;  3FPP A;  4O42 A;  2AQ2 B;  4RAU C;  4OL7 A;  1QG7 A;  1DON A;  3IFT A;  3T1H L;  1HQM C;  3URY A;  2E8G A;  4Y7N B;  4OWX B;  5D14 A;  4YHH L;  1HNW Q;  1PFB A;  5FJ8 H;  1CKO A;  3P20 A;  1BBU A;  1PJU A;  1WTJ A;  2ODD A;  5CBA E;  2ERW A;  2A6H C;  4X62 L;  5JEA G;  3SGB I;  5BN5 A;  2NVQ H;  4A3I H;  4ILW A;  1FGU A;  1V43 A;  4ZRZ A;  2N78 A;  2ZJR A;  3JC6 6;  4KY6 A;  3HOV B;  5I9P A;  3TO9 A;  4HIM A;  2L5T A;  2K03 A;  1Y14 B;  1CTM A;  1DJR D;  3G4S A;  2KMO A;  1HXY D;  2BCO A;  2F0P A;  5C0X I;  1F9Q A;  2QA4 A;  1GJX A;  3NEM A;  2NTT A;  1TUS A;  2WKD A;  4OXP A;  2ZM6 Q;  4H7B A;  1FGB D;  4JVZ A;  2NWG A;  4UP8 A;  5KNB A;  4JI5 Q;  3K6O A;  1PFM A;  3M3Y B;  2OF1 A;  1D8L A;  4YZ9 A;  5DM7 3;  2VRW B;  1HFG A;  4CJ1 B;  2MHV A;  4K0K Q;  4PL5 A;  5LMN W;  3H6M A;  1SFO H;  5ISR A;  1C8C A;  2QSB A;  3KLS X;  3T1Y Q;  3PF4 A;  3DHQ A;  5M3F G;  4NP5 A;  3QJY A;  3V96 A;  3TZU A;  4IUV A;  1BUV T;  3A8J E;  4R1J A;  2PNR C;  4C3I H;  2K5N A;  4JI1 L;  1N33 Q;  1WTV A;  2KHI A;  2RCF A;  3J81 L;  1O7Z A;  1X32 A;  1B1Z A;  4G57 A;  1HNX Q;  1X3P A;  4CKB A;  4ZK9 B;  3ND8 A;  1ESF A;  5FLM G;  2B2U C;  4U6R A;  2NVT B;  2B63 B;  3NXW A;  4UHV A;  1M90 C;  3Q23 A;  3S24 A;  1O80 A;  3G6E A;  5CR3 A;  1EEI D;  3OXL A;  1O7L A;  2K6A A;  4K2K A;  3T1H Q;  1HTL D;  3GOX A;  1S5B D;  4DV4 L;  1Y1V G;  2EYH A;  2F0D A;  2F03 A;  2PPB C;  4UP9 A;  5EPK A;  4NB3 A;  2YTY A;  4GXT A;  1RKN A;  2EJF C;  4ZKC B;  1X3G A;  4MTN A;  4X62 Q;  2QCP X;  2UXD L;  1VQK A;  2MO0 A;  1ENF A;  1GO3 E;  1YNJ C;  3VR6 A;  1TT2 A;  4N9T A;  3SVM A;  5K36 G;  1A0I A;  4AS3 A;  1PPF I;  4EX5 A;  5LL6 S;  2A68 C;  3HOU H;  3S16 H;  5KRU A;  4M1U B;  1GUN A;  1SN8 A;  3DMU A;  4E1P A;  1W3S A;  2LB7 A;  3VYR A;  3Q22 A;  1K9M C;  1EYD A;  2E2H H;  4Y52 H;  1HR0 L;  1R4Q B;  3LJ1 A;  1I50 H;  2B29 A;  1IY5 A;  3GTQ B;  4A3L G;  2L8E A;  2K5H A;  1WJJ A;  4JPB W;  4I65 A;  1QUQ B;  2SGF I;  3JAM L;  4ZAI A;  1E2Z A;  1GM5 A;  4CDE C;  3L0O A;  4LF4 L;  3TZD A;  4ME5 A;  2IX3 A;  4YCW A;  2A6E C;  3S1Q H;  1WD0 A;  1CFM A;  3AU7 A;  3I4N H;  4A24 A;  2N88 A;  3LGJ A;  1NY4 A;  5FUV A;  1OXS C;  1ZKO A;  2JE6 I;  5C6A A;  5M3M H;  3SXH A;  2EJM A;  1C9O A;  1UWV A;  2PMZ B;  1W4R A;  4JI1 Q;  2Q2U A;  5C4Z A;  3CPF A;  5D65 A;  4OO1 H;  5C0X G;  3D4W A;  2HIV A;  1OTC A;  3OYY A;  4RGO S;  2EYM A;  4JYA L;  5M3F B;  2PO4 A;  3TQY A;  3OSO A;  4DV3 L;  1R9T H;  4E1R A;  1KRT A;  1K8A C;  4JW0 A;  2AUJ D;  3TS2 A;  4IUR A;  4Z7G A;  1HPC A;  1E3P A;  2EXZ A;  5DEH A;  2L0C A;  1P9G A;  4QUC A;  2CWA A;  2Z8L A;  2RCN A;  4KMU C;  3ZYY X;  4AQY Q;  1HUN A;  2B8F A;  3HG9 A;  5I2Y A;  1VQO A;  2A20 A;  4A3C H;  2UZ3 A;  2VQF L;  2JEA I;  5E4W C;  2DKV A;  1GUO A;  1TS5 A;  4OO1 I;  1Q90 A;  7WGA A;  3L7Z C;  4C2M B;  1PTO F;  5JJZ A;  2EVB A;  3OMC A;  1Q7Y C;  1SE8 A;  3KK7 A;  1Y1V B;  2UU9 L;  2NYZ D;  4RFB A;  5CV8 A;  2GIV A;  5IGG A;  3PCO B;  3UIT A;  3U50 C;  1NNX A;  2B2U A;  2F0S A;  1FJG L;  1F9S A;  1U4R A;  1L0X B;  3SEB A;  4DV1 Q;  4KN4 C;  2BA0 A;  3A54 A;  1HA5 A;  1TVX A;  3J7Z C;  3VYT A;  3VR2 A;  1KDA A;  3GDE A;  2LSS A;  1RDP D;  4OON A;  3KUP A;  4UP7 A;  5FOB B;  3CCE A;  1IXR A;  2V6E A;  1FD7 D;  3I72 A;  4HEA 1;  1H95 A;  5M5W H;  2UXB L;  1YHB A;  4C3I G;  3H3V H;  1L1O C;  5GQO A;  5IE8 A;  3R5B A;  1CHQ D;  2CH4 A;  4R8N A;  1EOV A;  1VQ7 A;  2HCI A;  5IIF A;  3MVV A;  2LMC B;  1E2V A;  5A35 A;  5JHW C;  2V1C C;  3STB C;  1H9S A;  3I2Z A;  2FU2 A;  3KBX A;  2XVS A;  2A69 C;  3I91 A;  3K7U C;  1CHP D;  3TP8 A;  3M4O B;  2CWH A;  2B2T C;  2F0V A;  3M4Y A;  5C4J H;  2N52 A;  4JYA Q;  4A4I A;  4RHR A;  3PIO 3;  1QIL A;  5JAV A;  4DV3 Q;  4DXG A;  2ZT9 C;  5J8F A;  2ICI A;  3E9H A;  2L11 A;  3FVQ A;  1PRT C;  3D00 A;  2WAC A;  2NU2 I;  4GN3 B;  2BDN A;  4DU9 A;  2FJ2 A;  2SGP I;  4R4I A;  2E5L Q;  2JA6 H;  3R5D A;  2KCM A;  1BF4 A;  4HED A;  2VW9 A;  3I90 A;  3S2H H;  4EQ5 A;  4ZQ3 A;  4GS3 A;  2VQF Q;  2B3G A;  5GAG C;  1XNQ Q;  1XNR Q;  1TKW B;  3BVZ A;  4N8X 1;  2IX1 A;  1L0Y B;  1K3B C;  1IYU A;  1XTC D;  4OX9 Q;  1B2T A;  2UU9 Q;  2ENN A;  1HR0 W;  1HQR D;  3C2P A;  5IT9 E;  2KCN A;  1AEX A;  1YBY A;  2PQA B;  4PMC A;  1PTO H;  5BR8 L;  3A7L A;  3OWF A;  2JN4 A;  5COY A;  1Z47 A;  3VA5 A;  2RF4 A;  3SDZ A;  1JJC B;  2M2L A;  4FP5 D;  5KND A;  1R0R I;  2N8N A;  2XTR A;  3CCL A;  2MUY A;  3TP5 A;  3I4N G;  1D1I A;  1EIH A;  4IJL A;  5M3M G;  2K50 A;  1TXY A;  2IT1 A;  1PHJ A;  4WRD A;  2RIJ A;  3UFF A;  1SNM A;  1MT1 A;  4FKD A;  3E5S A;  2KMR A;  4KV6 A;  3HGB A;  1VQN A;  3MXU A;  1NCV A;  3F2C A;  5EBC A;  5KEE A;  2E75 C;  2J0T D;  2JA8 G;  1F2Y A;  1SNP A;  1TY2 A;  4R9W A;  2SDF A;  2L9H A;  2I5L X;  3ICE A;  2QGQ A;  2MNA A;  1TUR A;  2VS1 A;  4C3I B;  2KHJ A;  2XNA C;  4U68 A;  2KMP A;  1HNZ Q;  1K7T A;  4GKJ Q;  1EQT A;  1LTA D;  4Y7N H;  3B55 A;  1WYD A;  2WKC A;  1N34 Q;  2ES2 A;  3PO3 G;  2VB2 X;  2A8V A;  2H5X A;  1D6E C;  3E59 A;  1I4Q A;  4UXH A;  3PUZ A;  2KEC A;  1KXL A;  1O7I A;  3FC3 A;  3PGZ A;  4LF9 Q;  1GHK A;  1L1O A;  3QOJ A;  3SR1 A;  3OW2 A;  1B3A A;  3P23 A;  4DUY Q;  1YNX A;  1ET6 A;  4L9M A;  4SGB I;  3HOV H;  1KRS A;  1Y8P B;  1VQL A;  2OWO A;  1N36 Q;  1G29 1;  2V1C A;  3DWA A;  1EZ6 A;  2AMC B;  1DOM A;  1LR8 A;  1VDZ A;  1XWE A;  1EY7 A;  4S3S A;  3T53 B;  4X64 Q;  1WTP A;  3WOF A;  1NJI C;  4IPG A;  5I9O A;  2E73 A;  3M3Y H;  3FVV A;  1YNN D;  2R7F A;  3J81 c;  1LT3 D;  2F0T A;  1SE3 A;  2K01 A;  2YTV A;  4JI0 L;  1F2M A;  2K05 A;  1LTB D;  2A74 C;  1STE A;  3QAH A;  4IN3 A;  1K8O A;  1I50 B;  2K32 A;  5HUR A;  3AMU A;  2F0M A;  3MXN B;  2ZTD A;  2O5I C;  1SGP I;  4B3T L;  1EQQ A;  3NEL A;  3VDU A;  2Z6K C;  1ONL A;  5FO9 B;  4JC0 A;  3DXJ C;  3WOE A;  3ULJ A;  3KDF B;  3GTM H;  4DR7 L;  2VNU D;  3S1Q B;  2VQE Q;  3G7L A;  3I4N B;  5FLX E;  4ZKB B;  2Q8I B;  2NVT H;  5M3M B;  2B63 H;  1AZP A;  2AQ1 B;  3QO2 A;  1XJV A;  1TDP A;  1STA A;  3HP3 A;  2ZXO A;  1QUQ A;  3MZ5 A;  4IFD H;  1M1K C;  2P22 B;  1UE1 A;  4EQN A;  3TRZ A;  4HJ7 A;  1TS4 A;  1SEB D;  2Q8T A;  3BS1 A;  2JA8 B;  4DAV A;  5T1I A;  3LJ0 A;  2YYZ A;  2ETD A;  1IBK L;  1Y1C A;  1G2S A;  4LUO A;  1D5Z C;  2E5R A;  1NUC A;  3UGL A;  5E4X A;  5JVG 3;  1BCP D;  3T56 B;  5BN3 A;  1UHA A;  4YWK A;  3K5L A;  1GOZ A;  5ELC A;  2C35 B;  1Z7T A;  2JW6 A;  1YEZ A;  4JI6 L;  3PO3 B;  2XRQ D;  3JAM c;  3JSB A;  1LO5 D;  3SEK C;  2Z1C A;  3FSX A;  1I6V C;  3D3R A;  5JEA H;  1CQF A;  3UEY A;  1OXT A;  4GKK L;  4IFD I;  4WJ4 A;  1SYC A;  2EYJ A;  2F4I A;  2M9V A;  3BDO A;  1LTR D;  2OCE A;  1AE2 A;  2AQ3 B;  1I6H B;  3TSS A;  4DR2 Q;  4DV6 L;  3PO2 H;  1Q8K A;  1KC8 C;  3GTQ H;  1UE7 A;  1V8Q A;  2JA7 G;  1UVG A;  3E0E A;  4B3S L;  3Q24 A;  5EKL A;  1JJG A;  2DUD A;  5GAD C;  4LFA L;  1NAP A;  4LUZ A;  2JBW A;  3EIV A;  3H91 A;  2LEO A;  2IJ0 A;  1VQE A;  2CKZ B;  1SRU A;  1Y1W G;  4HGU A;  1N32 L;  3UDX A;  1HRJ A;  3CHB D;  1YI2 A;  4B3T Q;  2BA1 A;  5A2Q L;  2YUU A;  4IPC A;  1JC7 A;  1GUS A;  1TWA B;  4XYO A;  3OIQ A;  5G3L D;  2B2W C;  4B3R Q;  4GNX C;  2ENZ A;  4X66 L;  5LMN L;  2PZT A;  4QIW E;  1B3Q A;  3NBI A;  1ULN A;  4OVO A;  1CGJ I;  4CDF C;  4DR7 Q;  2Z0S A;  2YFA A;  3KJO A;  1TWC H;  3IKJ A;  1T9H A;  5M3F H;  3NQI A;  2D62 A;  1EIF A;  2O2L D;  2EE1 A;  1ENA A;  1E0B A;  4O1P A;  1X3F A;  1RD9 D;  5IOC A;  2R7D A;  2F66 B;  1LTI D;  1IYJ B;  4DV7 L;  1AH9 A;  3BYT B;  3J80 L;  3EVQ A;  3K5O A;  1MBY A;  4RGT A;  4A3F G;  1M8C A;  1IW4 A;  1O78 A;  1RTO A;  1V1P B;  1IBK Q;  5DAU A;  3RUZ A;  4C2M H;  1WCM G;  1Y8F A;  3MA2 B;  2ORW A;  5CC4 A;  2Z6K A;  1ET9 A;  1SMX A;  4UXI A;  1Y1V H;  3L9A X;  4O2D A;  2DY8 A;  4DUZ L;  4IPH A;  1SE4 A;  1QZG A;  2RQX A;  3J81 i;  4JI6 Q;  5F2D A;  4G7Z C;  3HZX A;  2R92 G;  1PLF A;  1PZK D;  5E7N A;  1Q12 A;  4DR5 L;  1NTG A;  3KF6 A;  2L12 A;  4UY8 C;  1DXM A;  2KUM A;  1JWU D;  2K1B A;  5K36 H;  2NB0 A;  1STB A;  1SMY D;  4X3S A;  2EYL A;  1PH1 A;  1NE3 A;  3BZK A;  2N1A B;  2RHQ B;  3SK6 A;  1LUZ A;  4A93 G;  3CD6 A;  4KJN A;  4POF A;  3R2T A;  5M5Y B;  1G6P A;  4IO9 A;  1ILQ A;  1HHV A;  2Y0M A;  4TKO B;  2KBN A;  4DFA A;  2Z6B A;  2GA4 B;  1Q8I A;  4K8I A;  2P5Z X;  1VF7 A;  3CCU A;  4XYQ A;  1N32 Q;  1HJA I;  1NR2 A;  2JA7 B;  1Y1B A;  2EQS A;  4H13 C;  1AW7 A;  2AWN A;  1ZYR C;  1QOH A;  2JXM B;  2WCY A;  4LMQ D;  2DJG C;  3CCS A;  3H15 A;  3EBE A;  5LMN Q;  1IHZ A;  3GTG H;  3W1G A;  3M4O H;  1MJ9 A;  4KI0 A;  2A6H D;  2EPB A;  2OT2 A;  1Y1W B;  2SGD I;  3R3O A;  4OEM B;  5JJI A;  1CHO I;  2QZG A;  4K6L A;  3SK8 A;  3CQZ H;  1NSN S;  1CKM A;  3NWT A;  3R5A A;  5EPL A;  4QL5 A;  1E7Z A;  5C0X H;  4DV7 Q;  2ZW3 A;  1OVO A;  3H94 A;  3CC7 A;  1LTS D;  3I7F A;  2WB1 E;  3JAM i;  1K0R A;  4CKC A;  3PF5 A;  3UOE A;  4I7A A;  2MJ8 A;  3EFX D;  2FMC A;  2K4K A;  1Z9F A;  3X3M A;  4KLK A;  2JZM A;  1STH A;  3GQB A;  2B8G A;  1SGN I;  1FNV A;  1EZ8 A;  5LL6 X;  2B2W A;  1XMO Q;  3J7A V;  4GNX A;  4X3U A;  4XTC S;  4DUZ Q;  1BXT A;  1UE5 A;  1LT5 D;  2QEX A;  4A3F B;  2HT1 A;  3PO2 G;  2AUK A;  1C0A A;  1A2T A;  4GLA C;  2BUS A;  4C56 C;  1IBM L;  2PQ8 A;  1PYS B;  4PZ7 A;  3KP9 A;  2EY2 A;  1A2U A;  2Z4H A;  2EOT A;  2CJS C;  1IW7 C;  1WCM B;  4G76 A;  2DB6 A;  4DAY B;  3KLW A;  3J7A 5;  4RCO A;  3SDJ A;  2F4V Q;  2PQE A;  3O13 A;  1EFW A;  2L55 A;  4K8J A;  4BY1 G;  1SDF A;  2R92 B;  4L63 B;  1EY4 A;  4FF2 A;  3H3V C;  1M4V A;  3C3L A;  1QWY A;  4KY5 A;  2RBM A;  1SND A;  3K81 C;  3AFP A;  1QNK A;  5J1Z A;  1DS3 I;  2KMQ A;  4ZYS A;  1GD7 A;  2VZA A;  4KD3 A;  1ENC A;  1VMC A;  2ID0 A;  1VQ8 A;  3S9W A;  4A93 B;  4YZC A;  2BE5 C;  4K5X A;  4OEL B;  2UUB Q;  1PFN A;  4DWL A;  2J7Z A;  1ML0 D;  2WVJ A;  4DR4 L;  4GOP B;  1GVP A;  1MSH A;  1YJ9 A;  4J15 A;  3BJI A;  3W1B A;  3SK4 A;  2FHT A;  3GTM B;  1QZH A;  4L5Q A;  1NMF A;  4HN7 A;  3KLR A;  3SHL A;  2NZH A;  3MEH A;  3PSI A;  1WI5 A;  2R93 B;  1F2L A;  1YNJ D;  4H02 A;  1G6Z A;  1JMC A;  1ILP A;  1YJN A;  5KGU A;  1PYB A;  3J81 E;  1XPR A;  3MHB A;  3UDI A;  4YHH Q;  4IOA A;  1EUJ A;  1H9M A;  1H0Z A;  3DEO A;  2WB1 G;  2LS0 1;  1X9N A;  2DNE A;  3I4L A;  5IGE A;  2OZU A;  3DM3 A;  4DV5 L;  2XWB B;  3GTL B;  3DEP A;  2B39 A;  1Q9B A;  4QMG A;  3NP8 A;  5JVH 3;  1I94 L;  2KKM A;  1PTO C;  4UPA A;  3S17 H;  3CC2 A;  4P2C B;  4A3M G;  1XX6 A;  3K58 A;  4HSV A;  3S14 B;  5C5L A;  1T5E A;  1G8Z D;  1WVL A;  4PZ6 A;  2CWF A;  4YIJ A;  4NMZ A;  4LF5 L;  3ULP A;  4HCE A;  2A6E D;  5CV9 A;  1VQI A;  3GTJ B;  2EY5 A;  4DN4 M;  3PO2 B;  1Q1B A;  2AWO A;  4N9P A;  3CRL C;  1OXX K;  1CSO I;  1AP0 A;  4DNC A;  2PNH A;  4HJ5 A;  1PH8 A;  1IBL L;  2OVO A;  4KHP L;  1CKN B;  3F4M A;  2GVI A;  2YQP A;  4BY1 B;  3MXG A;  2F0N A;  1D5M C;  1DOL A;  2DY7 A;  4ZUI A;  1MHW C;  4DR4 Q;  1HJP A;  1IKM A;  3I9V 1;  1TS3 A;  1KAA A;  1VQF A;  3J81 j;  3S2D B;  5DAE A;  5C0X J;  1DOK A;  1TWC B;  4BA2 I;  1SYG A;  3VR5 A;  2JA8 H;  3HOW H;  2PI2 A;  3V05 A;  4OWW B;  1B44 D;  4LK1 C;  2D5D A;  1KLU D;  5CCL A;  3FKI G;  4JG2 A;  4DR1 L;  3VDY A;  2E2J B;  2QQ0 A;  5C4X B;  1B4O A;  1TBO A;  2NU1 I;  4Q5V A;  4DV4 Q;  1LLR D;  2NVX B;  5KYI A;  2EXD A;  1ZXT A;  2Q2H A;  4IUQ A;  4H0L C;  2ICE C;  2K28 A;  2UXD Q;  2BL7 A;  3PO3 H;  1JR0 D;  3VDP A;  4LFC L;  2PCF B;  2AKW B;  2Q2T A;  4OAV B;  4CHT B;  2M5X A;  5ELE A;  1I6H H;  4QCL A;  2WB1 B;  2K33 A;  3K0X A;  5C3W A;  1K8G A;  3BVG A;  4Q0F A;  1PH7 A;  4LF5 Q;  1QVF A;  2F0H A;  3L3O C;  3M4P A;  5J8C A;  1HR0 Q;  5CGK A;  3PIP A;  4WJW A;  3G48 A;  4R4T A;  4F87 A;  1CI3 M;  3OWE B;  1K28 A;  1U4L A;  4DR6 L;  3STB D;  1A3V A;  5IYC G;  2IPK D;  3U4V A;  4G7H C;  4A3M B;  2V4D A;  4L6T B;  5CCM A;  1EWH A;  1E24 A;  2HIX A;  3J80 c;  1TWA H;  3LWE A;  1BKB A;  5AJ3 L;  1U4P A;  2B2V C;  1KBE A;  4AYB E;  1G51 A;  4ABN A;  1K73 C;  2K7V A;  3AJF A;  4LF4 Q;  1E1T A;  1SJ8 A;  1IBL Q;  1P9Z A;  4B08 A;  3TRE A;  2NZO A;  2KED A;  4X65 L;  1PRT D;  4JI3 L;  5BN4 A;  1JQO A;  1FNU A;  5ELB A;  2O4X A;  4IZ8 A;  4B9W A;  3I56 A;  1B9M A;  3FSY A;  1SYB A;  3GTG B;  4UDU C;  4X3K A;  1VQA A;  3E0J A;  1JOQ A;  1PZI D;  3IRB A;  1UE6 A;  3D4D A;  3S15 B;  3KJP A;  2SNM A;  5TSS A;  3AEV A;  1GUT A;  4TRD A;  4JI8 L;  3CQZ B;  1A8V A;  1Z6H A;  1EYC A;  1PDQ A;  1CQV A;  2WFW A;  2WAQ E;  2OU2 A;  2FFK B;  3R93 A;  4CKE A;  1XPO A;  3LX0 A;  4G7O C;  3KOJ A;  4FF4 A;  2K04 A;  3M4Q A;  3OTO L;  4ZCK A;  1SGY I;  2RA4 A;  1FAQ A;  3GV6 A;  3NQT A;  3FKI B;  2VY3 A;  1EWC A;  1S5C D;  1TBQ R;  1Y69 U;  3PUV A;  1X6O A;  5ELD A;  5JJK A;  2QGM A;  4OIJ A;  4NW2 A;  1L2F A;  2FNF X;  4DV0 L;  1S5F D;  3UDF A;  2YFB A;  1X3Q A;  1FJG Q;  3P1H A;  5M5Y H;  3QWN A;  4XQN A;  2HGK A;  1R4P B;  1KQS A;  1DGS A;  4P75 A;  2KA7 A;  1E1O A;  2F3W A;  2SNS A;  2YV5 A;  4BY7 G;  1CT2 I;  2UXC L;  1S5D D;  2JA7 H;  2UXB Q;  1WTO A;  5AJ3 Q;  1FY7 A;  2OD1 A;  4ALP A;  2JA1 A;  2HCC A;  1N8R C;  4HMI A;  3C1E A;  3RZD B;  4AYB G;  4RKL A;  3HOW G;  3PMF A;  1IY6 A;  2ARP F;  4CDD C;  9WGA A;  1BCP B;  1Y1W H;  1HUM A;  3PUX A;  3FEW X;  4JI3 Q;  3S1N B;  2UUC L;  5FK9 C;  1K83 B;  2ELI A;  1SYF A;  1LR7 A;  1RIP A;  2SEB D;  2N3S A;  4LW1 A;  3I70 A;  5LMU L;  4A75 A;  5EJW A;  2OQ0 A;  1YHA A;  2XTI A;  5C3X A;  4JI4 L;  1MGS A;  2RLD A;  3PV0 A;  3E9I A;  2BDO A;  2HHH L;  2IL8 A;  3A74 A;  3L0I A;  1FL0 A;  3Q8D A;  2L1B A;  2QKI C;  3ZJY C;  1TGS I;  1VMP A;  2R6G A;  1LAB A;  2F52 A;  2B2V A;  2CWP A;  2CVR A;  1MKH A;  2WAQ G;  3BU2 A;  4MNO A;  2JYO A;  4K2L A;  4A3F H;  2E2I H;  2K5Q A;  1VS0 A;  4B3M L;  5DNF A;  3NTI A;  4QGU A;  4PL4 A;  4DF7 A;  2NU4 I;  2QQE A;  3CPW A;  2CW0 C;  4DGZ A;  2HDM A;  1WCM H;  1XPU A;  1PXU A;  4FVM A;  5BR8 Q;  1EQV A;  3J80 i;  3S17 B;  3PUW A;  2YU9 B;  3FRP B;  1NR4 A;  4OIK A;  2R92 H;  3H0G G;  2RC4 A;  3Q0A A;  1HZ9 A;  2K5V A;  1UAP A;  2J87 A;  3ER0 A;  2WGC A;  1HEV A;  1JB3 A;  1OMU A;  4NV5 A;  1B8A A;  1DZ1 A;  1XX8 A;  2KOL A;  3A8I E;  2G9D A;  4NXM L;  4A93 H;  2UXC Q;  1BNZ A;  2X6L A;  3QOL A;  3GV3 A;  1EY5 A;  2ENB A;  3NWS A;  2ATW A;  1GKH A;  1YVC A;  4KD4 A;  4LWC A;  3AFQ A;  4LFB L;  2P6A C;  2X69 A;  5LHY 1;  1WTR A;  2Z9H A;  1K3R A;  3NTH A;  2HQL A;  4DV2 L;  1SNO A;  4GZY C;  3I55 A;  1D5X C;  1GUG A;  5FUW A;  4HIK A;  1STN A;  3T51 B;  1Y8N B;  4BY7 B;  1BMO A;  1U4M A;  2R93 H;  2A5H A;  1YJW A;  4RGM A;  3TOA A;  2JJQ A;  3LJ2 A;  4EQO A;  3RZO H;  5FUX A;  1CSP A;  5FLX L;  3J7A F;  2GKV A;  2H1E A;  3MC0 B;  2H4O A;  4PMB A;  5LMU Q;  2ROW A;  4AYB B;  1MJB A;  4E6I A;  4U67 3;  5DLQ E;  1SGD I;  3HOW B;  5EKI A;  5JPN C;  2LKV A;  4YY3 L;  2PZW A;  3IL8 A;  1CKN A;  2ZRR A;  2NBF A;  1KNA A;  4PMW A;  4NKL A;  3GTL H;  1PH5 A;  2HDL A;  1EYA A;  1I4G A;  4TVA B;  1RFH A;  2F0E A;  4JI2 L;  2Z4I A;  1SR3 A;  1ASY A;  1EOT A;  3ERS X;  3J7Y W;  3VR4 A;  4V19 0;  4RH6 A;  2QQD A;  1X4S A;  3OW7 A;  3QIA A;  3S14 H;  2CAZ B;  3QG1 A;  4A3J G;  4HTH A;  2JEB I;  3LWU A;  3EA6 A;  1HZA A;  2PW5 A;  4JCV E;  3G6J B;  3GTJ H;  1UEB A;  2WAQ B;  4F88 A;  5IGF A;  2FUG 1;  1FAR A;  1UEA B;  3CF5 A;  2KCC A;  3P7J A;  4JI0 Q;  4BWG B;  4WOR A;  5KIX A;  2F0O A;  3IAM 1;  2R61 A;  1LTG D;  1O7Y A;  2Y0S E;  4MZ9 A;  3TS0 A;  1YIT A;  1ULM A;  3Q6S A;  1H9K A;  3DWP A;  3VYS A;  2A19 A;  3TP7 A;  3UI2 A;  4C1N K;  4BY1 H;  3CXC A;  1JOO A;  2JAE A;  1W2B A;  4GI3 C;  2G9H D;  5C3E G;  3H0G B;  2EYF A;  3ERO A;  3S1R B;  4FF3 A;  5HY6 A;  1TWG H;  3S2D H;  1C7Y A;  1B53 A;  5A2Q E;  2E76 C;  2XRC A;  4MTK A;  1STY A;  3FNB A;  2E2J H;  1PYW D;  5C4X H;  5CV4 A;  3F8T A;  3H09 A;  3W2D A;  2F3C I;  2WIN B;  3RN2 A;  1PH9 A;  2XMX A;  3HEJ A;  1FVI A;  2NVX H;  1K7V A;  2LY7 A;  3M9B A;  4IOC A;  2EYO A;  2VL6 A;  4PZ8 A;  4YY3 Q;  2JA5 G;  3CMA A;  1JE4 A;  2LXK A;  3TDQ A;  4X6A H;  1MD2 D;  2RDH A;  2D9U A;  1HFN A;  2K52 A;  1S20 A;  1PZJ D;  3J80 E;  1X3E A;  2CQA A;  3OPO A;  3NEN A;  4A3E H;  2R7Z G;  1ESR A;  5KYL A;  1WD1 A;  4YCU A;  1HNW L;  1RTN A;  3S1M B;  4BXX G;  3TJQ A;  4J8Q A;  5HGT A;  1KL9 A;  3F1Z A;  3DO9 A;  1EFI D;  1MIU A;  4GKK Q;  4Q9V A;  2RSN A;  4DAP A;  5J39 A;  3OL0 A;  4TSS A;  3VR3 A;  1IYV A;  4CJ0 B;  3HOZ G;  1TWF B;  1EEF D;  2JP1 A;  5HGI A;  5M5X H;  4DV6 Q;  5E1F A;  2WP8 J;  4WFN 3;  4R4Q A;  5IP9 H;  1MJE A;  2MGS A;  4B3S Q;  5COR A;  4A3M H;  1E22 A;  2MP1 A;  1SLJ A;  4C3J G;  5E3R A;  1IL8 A;  4A3J B;  4LFA Q;  4K5V A;  2IWH A;  2B2Y C;  2GKR I;  1BCP F;  1SJE D;  4A3D G;  2K9H A;  2N17 A;  3K5N A;  1CE3 A;  3NPP A;  1TS2 A;  1JWS D;  2Y0S G;  2J9R A;  2BH8 A;  1KNE A;  2ZM6 L;  4A3B G;  5C4H A;  2R93 G;  1H9S B;  3E6Z X;  2F1M A;  1VCI A;  3EJI A;  4JI5 L;  1F9P A;  2JSO A;  2PQA A;  3QWP A;  2PMZ E;  1LT6 D;  4X66 Q;  3SGQ I;  1CSQ A;  2CHB D;  3CAM A;  3GP7 A;  5IWA L;  3D31 A;  2J4X A;  4IFD J;  1FYC A;  4H44 C;  4K0K L;  1M8A A;  1OO9 B;  3KYH C;  1VQG A;  5FO7 B;  3S15 H;  3I73 A;  3T1Y L;  1Q81 C;  2UUA L;  2HUG A;  2R3Z A;  3MXP A;  5C3E B;  5CMD A;  1PH6 A;  3CKI B;  1HCZ A;  3KFU A;  3UGD A;  1AFP A;  4IAL A;  3I4M G;  1N33 L;  4YWM A;  1OYV I;  2D2C C;  1PTR A;  4POG A;  1EWI A;  1PCE A;  5EQ0 A;  3KF8 B;  1HNX L;  1KAW A;  1YIJ A;  3BZC A;  4MPI A;  3BJU A;  2VB3 X;  5T1G A;  2F0I A;  3N6R A;  5ELN A;  5G3L F;  4R8I A;  5FKA C;  2RVL A;  5IGC A;  3TN2 A;  1IW7 D;  3FKI H;  4GN5 A;  5HGQ A;  1SBB B;  1Q3L A;  5JEA J;  5CV5 A;  1Y8O B;  1YTP A;  2V53 A;  3TOB A;  4HSP A;  4PV1 C;  3D8G A;  1NUB A;  1XYI A;  3MEF A;  3CW2 C;  4FXG C;  2E2I B;  1KHI A;  3HOX H;  3UEJ A;  1AE3 A;  2A73 B;  3DA3 A;  3FMC A;  3M7G A;  2JA5 B;  3CU7 A;  5NUC A;  4DR5 Q;  5IP7 G;  1QVC A;  1XXG A;  1JB7 A;  1XBT A;  3NBH B;  2KHS A;  3PIP 3;  5IYD G;  4HFV A;  4XXE A;  3K7A B;  1VQJ A;  3F2B A;  2R7Z B;  2RDF A;  3DUZ A;  2N71 A;  4DK0 A;  1EL0 A;  2VUM H;  2BE5 D;  2QF7 A;  1MJC A;  3KBG A;  4KKS A;  2RDG A;  3BYY B;  1KBF A;  1H9J A;  2L1L B;  1QE6 A;  1VQH A;  5HI7 A;  1K8M A;  1VQC A;  3D0F A;  1S72 A;  3FP9 A;  4Z9C B;  3UDG A;  1E2W A;  2F0J A;  1ZEQ X;  1TU2 B;  1A62 A;  4AH6 A;  2F0L A;  3RZD H;  4DNI A;  3FBV A;  3HOZ B;  4OWT B;  1DS2 I;  1D7Q A;  4HAE A;  4M8A A;  2QDB A;  2GN5 A;  4JV5 L;  1GXD C;  4AS2 A;  1SNC A;  5IYC H;  3OXF A;  1SNQ A;  4DNT B;  4C3J B;  3S1N H;  1TWH B;  5IGD A;  5C4X G;  1XA6 A;  1EIY B;  4LNQ A;  1K83 H;  3NE5 B;  4QQB X;  1KDC A;  2I46 A;  3OOC A;  4A3D B;  2OTJ A;  5IWA Q;  1XMQ L;  2ZJQ A;  4A3K G;  3R2I A;  5E3P A;  4FF1 A;  4AIM A;  2Y0S B;  1TII D;  2HQE A;  4DK1 A;  2UUA Q;  4A3B B;  1X54 A;  4YZD A;  2IW3 A;  1PH4 A;  3RZO B;  3MXN A;  3W5O A;  2QPO A;  1TQO A;  4A3E G;  5EPJ A;  2XIW A;  1L1O B;  1BDO A;  3DWQ A;  2B2Y A;  1BR9 A;  1VF5 C;  4L8J A;  4QIW B;  2A68 D;  4JBM A;  3K0Y A;  3B6Y A;  1PTO D;  5L37 A;  1SRO A;  3KDF A;  5AFW A;  2F3V A;  3BZD B;  1JQY D;  2ALY B;  3N52 A;  5J3B A;  1X56 A;  4JI7 L;  3ULL A;  2I5H A;  1RHP A;  3I4M B;  2TMP A;  1SXT A;  4BBR G;  2FMM A;  5IP9 G;  3OMG A;  2XSC A;  4NDX A;  5C44 G;  1IBM Q;  1JIC A;  2YU9 H;  4BS9 A;  2EIF A;  2IY5 B;  5C5M A;  4AQY L;  4N8F A;  1WTQ A;  4FYD A;  3IFD A;  1NMG A;  1LTT D;  1VQP A;  4A3G H;  1V1H A;  1PRT B;  5IGB A;  1C4Q A;  1SSO A;  3AB9 A;  1SGQ I;  3DA4 A;  4IUU A;  3LNN A;  4XQQ A;  4K5W A;  2SGE I;  5FUY A;  4GLX A;  3NUC A;  4NPS A;  5FLX c;  4WP4 A;  1F9R A;  5IYB H;  1VQ6 A;  2IP6 A;  1KTK A;  5CBE E;  3P75 A;  2XTQ A;  3UE0 A;  1HA6 A;  1QCB D;  1I4H A;  4CDC C;  1EY0 A;  5CV7 A;  1K7U A;  4EQP A;  2MJF B;  4DV1 L;  1KIX A;  4CGY B;  4FXK C;  2XWJ B;  1DCZ A;  4IUT A;  2NTS A;  2MFI A;  2NUC A;  3A56 A;  3RMH A;  4DXF A;  3K59 A;  4BY7 H;  1I4R A;  2OTL A;  3PQI A;  4JV5 Q;  2FIN B;  1CT0 I;  3T4A C;  3JAM E;  2IHF A;  2NU0 I;  3WDN A;  4V0B A;  1XMQ Q;  1TWG B;  1A3U A;  2GKT I;  1N9W A;  2K19 A;  1CT1 D;  2KEN A;  2JB2 A;  1I4X A;  4QY7 A;  2GVA A;  3RU0 A;  2A1A A;  2CFM A;  1V1I A;  3FDT A;  3WWV A;  5H1S E;  2B8T A;  4RG1 A;  4WJ3 M;  2MPM A;  3GTP B;  4DAM A;  1VQB A;  4A3K B;  4GLV B;  3HOX G;  4P71 A;  4JK1 C;  1MSG A;  1B9N A;  5FJ8 G;  2DGY A;  2RIO A;  3MEK A;  4DV5 Q;  4HIO A;  2N55 A;  3HH2 C;  3OHX C;  3I3C A;  1EY8 A;  3GD7 A;  4HR7 B;  1GHJ A;  5E3Q A;  4RKB A;  2N49 A;  4JI7 Q;  2F0G A;  2KJX A;  4A3E B;  2L15 A;  4PQX A;  1PA6 A;  4HJ9 A;  3TP6 A;  2VUM G;  3CCR A;  4A3I G;  2F0F A;  2BH2 A;  4BBS H;  1I94 Q;  2E5L L;  1VQ4 A;  1RL2 A;  4IPD A;  4KTA A;  1V1P A;  3BDL A;  3K57 A;  2RKS A;  5IOD A;  1XNQ L;  1XNR L;  2GVB A;  3VA7 A;  1VQD A;  2KQ3 A;  1B70 B;  3V2T A;  4BBR B;  5M5X B;  4FXD A;  4ULL A;  2NZ1 D;  4OX9 L;  1W6K A;  4RA8 A;  5C44 B;  4FO2 A;  3TO7 A;  2A69 D;  1S3O A;  3H0G H;  5EBD A;  1N13 A;  3S1R H;  2JB3 A;  4C1N I;  4GOP C;  3VA9 A;  2YTX A;  4PG3 A;  1MI2 A;  2M00 A;  4KHP Q;  3U58 A;  3MAQ A;  1DYQ A;  3K5M A;  3E3X A;  1II3 A;  1V1Q A;  5CYU A;  1LV9 A;  2DJF C;  5D3D A;  2LXJ A;  1ULK A;  1SJH D;  1A3T A;  4UXJ A;  3D4R A;  1X65 A;  2MQH A;  3UGI A;  4FDB A;  4P72 A;  3GTO H;  4I7Z C;  2FXQ A;  1U9R A;  2JXD A;  2JQO A;  4CBV A;  1CA5 A;  4IUP A;  2OEO A;  2TSS A;  3RN5 A;  1I5F A;  1KD1 C;  1WTW A;  1WKX A;  4LAA A;  5ELO A;  4DR1 Q;  1CZW A;  3RLF A;  4KN7 C;  3A0J A;  4XQJ A;  2BL8 A;  1HNZ L;  1J9O A;  3K8A A;  1CUK A;  1F77 A;  5IY0 A;  1AN8 A;  2PW7 A;  1ICF B;  4QB4 A;  4GKJ L;  2EY6 A;  1OMT A;  4DK6 C;  5I4D A;  3EQL C;  1HPT A;  1N34 L;  3S1M H;  2IX0 A;  4HID A;  3AYH B;  3ITP A;  3KF6 B;  2I0Q A;  4FNF A;  4ZLT F;  2NVY H;  4A3G G;  4LFC Q;  1I3Q H;  2WV6 D;  3H3V I;  2A2C A;  2F0U A;  4MIU A;  1EY6 A;  1PVO A;  2KVM A;  2E2D C;  4A76 A;  2K75 A;  4KJO A;  3NHH A;  4HJ8 A;  4LF9 L;  3HOY H;  1TWF H;  3A7A B;  3E2I A;  3R5C A;  3DLL A;  3HOX B;  1UNS A;  1HTP A;  1Z2I A;  5IYB G;  4I1T A;  5EKK A;  1BBW A;  4DUY L;  3KF8 A;  3HOU G;  4L5S A;  2DNC A;  3KLS A;  4A3J H;  5IT9 L;  2NN6 H;  1KLG D;  1BO0 A;  1WTH A;  3CP0 A;  2F0K A;  1WGT A;  1OXU A;  4TQU S;  4QUF A;  5JOB A;  4R4C A;  4NXN L;  2NVQ B;  1N36 L;  2PI2 E;  1J5E L;  2OXP A;  2VUM B;  1TY0 A;  4A3I B;  4LF7 L;  5CV6 A;  4GN4 B;  3OIP A;  4B9X A;  4DR6 Q;  4P73 A;  5LNK 1;  4MN3 A;  2L4N A;  1JT8 A;  1RJT A;  4DKA C;  2KCT A;  3NSW A;  4X64 L;  3IAS 1;  4JBJ A;  1HH2 P;  4MHE A;  5I6Y A;  4C3H H;  2F3I A;  4PNY A;  4F8M A;  3CME A;  1EU4 A;  3NBH A;  3HKZ E;  1BQQ T;  3L2P A;  4LF6 L;  1IKL A;  1YHQ A;  1CZG A;  4NV2 A;  4DAY A;  1BVS A;  2JK8 A;  4X65 Q;  3ERQ A;  2W0T A;  1HZB A;  2ZXR A;  4LF8 L;  3RR5 A;  2E74 C;  3GTK H;  2NN6 I;  5C3E H;  1C48 A;  1JJ2 A;  3D6C A;  4Z7H A;  3R8B A;  2K5D A;  4JOI C;  4OO1 G;  4HMJ A;  1WTX A;  1U0L A;  2HD3 A;  4UAI A;  1SFO B;  3VE5 A;  1ASZ A;  3U9S A;  2QW7 A;  2BOS A;  2I5M X;  1B7Y B;  2EJG C;  4JI8 Q;  1JWM D;  2EDG A;  4EGV A;  2VQE L;  2CW0 D;  3MFG A;  2FEF A;  5GRO A;  2XRS D;  1EU3 A;  1PH3 A;  3I4O A;  2C5C A;  4GNX B;  3CCJ A;  4B6D A;  4BBS G;  3CC4 A;  4GOP A;  2K14 A;  1UUC A;  3FHW A;  3OTO Q;  1PRT F;  2XGT A;  1CGI I;  1EYG A;  2JA5 H;  4XT1 B;  3TEH B;  3M7N A;  4A3C G;  4BA1 I;  1FNW A;  5J22 A;  3A8K E;  3OVO A;  3K7A H;  5M9O A;  5FO8 B;  2R7Z H;  1EIG A;  1LR9 A;  4O0A A;  3PUY A;  2X52 A;  4JBK A;  4R4O A;  3C1F A;  2C9O A;  4DV0 Q;  1BOS A;  3SE0 A;  4LJZ C;  1PTQ A;  4BXX H;  1A15 A;  5I6W A;  5EX3 A;  1KDB A;  1XTD A;  4A3G B;  5KNC A;  1X55 A;  4KHZ A;  4NXN Q;  4QF4 A;  3SGI A;  1J5E Q;  4KK7 A;  4RMF A;  1JE5 A;  4LF7 Q;  1JCK B;  4OHJ A;  3HOZ H;  1HDL A;  1ICW A;  3RLN A;  2LFN A;  2RHS B;  4HJA A;  2VXW A;  2F0W A;  5I2X A;  2ORV A;  3PDN A;  3HOU B;  4DR2 L;  1SGE I;  3TBI B;  3S16 B;  4C3J H;  1TWH H;  2B2T A;  2LUY A;  5E3F A;  2SGQ I;  4A3D H;  1WOC A;  2ZJP A;  1U5K A;  1FR3 A;  4DPG A;  4LF6 Q;  3HKZ G;  1LAC A;  3NK9 A;  2E2H B;  1PV4 A;  2CCZ A;  4IQZ A;  4CJ2 C;  4L5T A;  1K0S A;  1SE2 A;  1L0W A;  1SAP A;  3F2D A;  1AN1 I;  4RHS A;  4A3B H;  1H9R A;  2UUC Q;  4LF8 Q;  3VYU A;  2O5J C;  1KMA A;  2DIP A;  2OQK A;  4PL3 A;  4OGQ C;  1GUW A;  3OXG A;  1EQR A;  1YNN C;  1PMR A;  4B3R L;  2IHE A;  4EVO A;  4JI4 Q;  3T16 A;  1LT4 D;  2HHH Q;  1SGR I;  2G5D A;  3T13 A;  3A5Z B;  3W3A A;  3HS0 C;  1MJA A;  3X3N A;  2Q8R E;  1VDD A;  1LTL A;  3RNU A;  1JOK A;  3QTL D;  2DN8 A;  2KCX A;  2JYY A;  1IL2 A;  3HOY G;  4ODG A;  3I4M H;  2D0O A;  1W6J A;  2A2D A;  1RF2 D;  2JA6 G;  1A63 A;  2WII B;  1Q46 A;  4B3M Q;  3HFZ B;  1TBR R;  3CRK C;  1IZ6 A;  3KY9 A;  1VQM A;  2NN6 G;  2RSO A;  1R9T B;  2QIL A;  2F0Q A;  2ZXP A;  1I4P A;  1G2T A;  5JPM C;  1CT4 I;  1R79 A;  3MTS A;  2K5W A;  3U4Z A;  3MWY W;  3PIO A;  4BBS B;  4YWL A;  1SYD A;  3C46 A;  1TIH A;  4JOI A;  4HCS A;  3IAY A;  2X3T A;  1VQ5 A;  1X74 A;  2RAD A;  4RCN A;  1CM9 A;  1TBN A;  3QR8 A;  5IP7 H;  4C3H G;  2ASB A;  1QVG A;  4ME3 A;  3F2U A;  4X3T A;  5IYD H;  2ZTE A;  4F7X A;  4QJF A;  1CK1 A;  1J8I A;  3SK5 A;  1NXU A;  2D0P A;  3RD4 A;  4XT3 B;  3TO6 A;  1F2Z A;  2JA9 A;  3NTK A;  5EAY A;  4NXM Q;  1BCP C;  1D2B A;  1WGC A;  4LUV A;  4JBW A;  1ROD A;  1UUP A;  5JJL A;  3I8Z A;  4LFB Q;  4DR3 L;  1PFS A;  1S40 A;  4DV2 Q;  2QEJ C;  4K6D A;  4IJH A;  5EGT A;  4OAU C;  4KY7 A;  4APV A;  3ND9 A;  1FYB A;  4G4K A;  2KEE A;  1DM0 B;  2PZU A;  5M5W B;  2L7X A;  1S5E D;  3CXL A;  1WFQ A;  3GTO B;  2UVO A;  5EX0 A;  3GTP H;  4DNR B;  3D6W A;  5GAH C;  2NU3 I;  4A3K H;  1YZ6 A;  1UVF A;  3HKZ B;  4ID6 A;  2QDL A;  4ZUJ A;  4J1M A;  2F6M B;  4YCV A;  1YU6 C;  4AML A;  1LYL A;  3MFY A;  3CCV A;  1KAB A;  4O1N A;  1V9P A;  3HKS A;  1BBX C;  4JI2 Q;  3HRZ C;  1YO7 A;  2CH4 W;  1BUS A;  3AQQ A;  3ONA B;  4K14 A;  3BG3 A;  5C4J B;  5FLM H;  4DA2 A;  2QQC A;  3HOV G;  2NVY B;  4KKU A;  1STG A;  4RGN A;  3GO5 A;  4G75 A;  1I3Q B;  3TME A;  3BVM A;  2JB1 A;  4BBR H;  3HOY B;  5DM6 3;  4DK3 C;  2CQO A;  1TR5 A;  3UE1 A;  2SOB A;  1XMO L;  2JA6 B;  5C44 H;  5GAE C;  1ZYR D;  2MO1 A;  2I07 B;  4IUN A;  2GSC A;  4J6H A;  3S2H B;  2ZTC A;  2EZV A;  1S4Z A;  3EN2 A;  2XN9 C;  5D3I B;  4O1O A;  1RCV D;  1Q82 C;  1HZC A;  3DM1 A;  1M8B A;  2X6G A; 
#chains in the Genus database with same CATH homology
 1P16 A;  1Q1E A;  3G71 A;  2B0U C;  4XIG S;  1P8L A;  2AHO B;  2F4V L;  3CCQ A;  1J6Q A;  1VQ9 A;  1OXV A;  4DR3 Q;  1LM0 A;  4L5R C;  2Q2I A;  5HQ8 A;  4A3L H;  2B63 G;  1Z7K B;  1TOT A;  2UUB L;  3K80 C;  4P74 A;  1Q86 C;  4IFD G;  1NBW A;  3B4V C;  3CCM A;  5IT9 c;  3A5U A;  1PH2 A;  3RLO A;  3M85 A;  3T1H L;  2E8G A;  4OWX B;  4YHH L;  1HNW Q;  5FJ8 H;  1CKO A;  1BBU A;  1PJU A;  2ODD A;  2ERW A;  4X62 L;  5JEA G;  3SGB I;  2NVQ H;  4A3I H;  1FGU A;  1V43 A;  2N78 A;  2ZJR A;  3JC6 6;  4HIM A;  1Y14 B;  3G4S A;  2KMO A;  5C0X I;  2QA4 A;  1TUS A;  3NEM A;  4OXP A;  2ZM6 Q;  4UP8 A;  4JI5 Q;  1D8L A;  4YZ9 A;  2VRW B;  4K0K Q;  4PL5 A;  5LMN W;  1SFO H;  3T1Y Q;  3PF4 A;  5M3F G;  4R1J A;  4C3I H;  2K5N A;  4JI1 L;  1N33 Q;  2KHI A;  1HNX Q;  5FLM G;  4U6R A;  1M90 C;  3S24 A;  3G6E A;  3OXL A;  3T1H Q;  3GOX A;  4DV4 L;  1Y1V G;  4UP9 A;  4NB3 A;  2YTY A;  4GXT A;  2UXD L;  1X3G A;  4MTN A;  4X62 Q;  1VQK A;  2MO0 A;  1GO3 E;  5K36 G;  1A0I A;  4AS3 A;  1PPF I;  4EX5 A;  3HOU H;  3S16 H;  1SN8 A;  4E1P A;  1W3S A;  1K9M C;  2E2H H;  4Y52 H;  1HR0 L;  3LJ1 A;  1I50 H;  2B29 A;  1IY5 A;  4A3L G;  2L8E A;  2K5H A;  1WJJ A;  1QUQ B;  2SGF I;  1GM5 A;  3L0O A;  4LF4 L;  4YCW A;  3S1Q H;  3I4N H;  4A24 A;  3LGJ A;  5FUV A;  1NY4 A;  1OXS C;  2JE6 I;  5M3M H;  1C9O A;  1UWV A;  1W4R A;  4JI1 Q;  2Q2U A;  3CPF A;  5C0X G;  2HIV A;  1OTC A;  3OYY A;  4JYA L;  3TQY A;  4DV3 L;  1R9T H;  4E1R A;  1KRT A;  1K8A C;  3TS2 A;  4Z7G A;  1E3P A;  2CWA A;  2RCN A;  4AQY Q;  1VQO A;  2A20 A;  4A3C H;  2UZ3 A;  2VQF L;  2JEA I;  4OO1 I;  3L7Z C;  1Q7Y C;  1SE8 A;  2UU9 L;  3PCO B;  3UIT A;  3U50 C;  1FJG L;  4DV1 Q;  2BA0 A;  3J7Z C;  3GDE A;  2LSS A;  4OON A;  4UP7 A;  3CCE A;  1IXR A;  2V6E A;  4HEA 1;  1H95 A;  5M5W H;  2UXB L;  1YHB A;  3H3V H;  1L1O C;  5GQO A;  5IE8 A;  1EOV A;  1VQ7 A;  5JHW C;  2V1C C;  3STB C;  3I2Z A;  3K7U C;  5C4J H;  2N52 A;  4JYA Q;  4A4I A;  4DV3 Q;  3E9H A;  3D00 A;  2NU2 I;  4GN3 B;  2SGP I;  4R4I A;  2E5L Q;  2JA6 H;  2KCM A;  2VW9 A;  3S2H H;  4EQ5 A;  4GS3 A;  2VQF Q;  2B3G A;  5GAG C;  1XNQ Q;  1XNR Q;  2IX1 A;  4OX9 Q;  2UU9 Q;  2ENN A;  1HR0 W;  1YBY A;  2PQA B;  5BR8 L;  1Z47 A;  2RF4 A;  1JJC B;  1R0R I;  2N8N A;  2XTR A;  3CCL A;  3I4N G;  4IJL A;  5M3M G;  2K50 A;  1TXY A;  2IT1 A;  1PHJ A;  3UFF A;  1MT1 A;  4FKD A;  2KMR A;  1VQN A;  3F2C A;  2JA8 G;  2I5L X;  3ICE A;  2QGQ A;  2MNA A;  1TUR A;  2VS1 A;  2KHJ A;  2KMP A;  1HNZ Q;  4GKJ Q;  4Y7N H;  1WYD A;  1N34 Q;  2ES2 A;  3PO3 G;  2A8V A;  2H5X A;  3E59 A;  4UXH A;  3PUZ A;  1KXL A;  1O7I A;  3FC3 A;  3PGZ A;  4LF9 Q;  1L1O A;  3OW2 A;  3P23 A;  4DUY Q;  1YNX A;  4L9M A;  4SGB I;  3HOV H;  1KRS A;  1VQL A;  2OWO A;  1N36 Q;  1G29 1;  2V1C A;  2AMC B;  1LR8 A;  4X64 Q;  1NJI C;  4IPG A;  2E73 A;  3M3Y H;  2R7F A;  3J81 c;  2YTV A;  4JI0 L;  3MXN B;  2ZTD A;  1SGP I;  4B3T L;  1EQQ A;  3NEL A;  3VDU A;  2Z6K C;  4JC0 A;  3ULJ A;  3KDF B;  3GTM H;  4DR7 L;  2VNU D;  2VQE Q;  2NVT H;  2B63 H;  1XJV A;  1QUQ A;  1M1K C;  2P22 B;  1UE1 A;  3TRZ A;  4HJ7 A;  3LJ0 A;  2YYZ A;  1IBK L;  1Y1C A;  4LUO A;  2E5R A;  3UGL A;  4YWK A;  2C35 B;  2JW6 A;  1YEZ A;  4JI6 L;  3JAM c;  3JSB A;  3SEK C;  3UEY A;  1OXT A;  4GKK L;  4IFD I;  4WJ4 A;  2OCE A;  1AE2 A;  4DR2 Q;  4DV6 L;  3PO2 H;  1Q8K A;  1KC8 C;  3GTQ H;  1UE7 A;  2JA7 G;  1UVG A;  3E0E A;  4B3S L;  1JJG A;  2DUD A;  5GAD C;  4LFA L;  4LUZ A;  3EIV A;  2LEO A;  1VQE A;  2CKZ B;  1SRU A;  1Y1W G;  4HGU A;  1N32 L;  3UDX A;  1YI2 A;  4B3T Q;  2BA1 A;  2YUU A;  4IPC A;  4B3R Q;  4GNX C;  2ENZ A;  4X66 L;  5LMN L;  4QIW E;  4OVO A;  1CGJ I;  4DR7 Q;  2Z0S A;  2YFA A;  3KJO A;  1TWC H;  1T9H A;  5M3F H;  2D62 A;  1EIF A;  4O1P A;  1X3F A;  2R7D A;  2F66 B;  1IYJ B;  4DV7 L;  1AH9 A;  4A3F G;  1M8C A;  1IW4 A;  1IBK Q;  4C2M H;  1WCM G;  1Y8F A;  2ORW A;  2Z6K A;  1SMX A;  4UXI A;  1Y1V H;  4O2D A;  4DUZ L;  4IPH A;  1QZG A;  3J81 i;  4JI6 Q;  2R92 G;  5E7N A;  1Q12 A;  4DR5 L;  1NTG A;  3KF6 A;  4UY8 C;  1PH1 A;  1NE3 A;  3BZK A;  2N1A B;  2RHQ B;  1LUZ A;  4A93 G;  3CD6 A;  4POF A;  1G6P A;  4IO9 A;  2KBN A;  3CCU A;  1N32 Q;  1HJA I;  1Y1B A;  2EQS A;  2AWN A;  2WCY A;  3CCS A;  3H15 A;  3EBE A;  5LMN Q;  3GTG H;  3W1G A;  3M4O H;  4KI0 A;  2SGD I;  5JJI A;  1CHO I;  3CQZ H;  1CKM A;  4QL5 A;  1E7Z A;  4DV7 Q;  1OVO A;  3CC7 A;  3I7F A;  2WB1 E;  3JAM i;  1K0R A;  3PF5 A;  2K4K A;  1Z9F A;  4KLK A;  2JZM A;  1SGN I;  1XMO Q;  4GNX A;  4XTC S;  4DUZ Q;  1UE5 A;  2QEX A;  3PO2 G;  2HT1 A;  1C0A A;  4GLA C;  2BUS A;  1IBM L;  1PYS B;  4PZ7 A;  3KP9 A;  2CJS C;  4G76 A;  2DB6 A;  4DAY B;  3KLW A;  3J7A 5;  3SDJ A;  2F4V Q;  1EFW A;  4BY1 G;  3K81 C;  3AFP A;  1DS3 I;  2KMQ A;  1GD7 A;  2VZA A;  2ID0 A;  1VQ8 A;  4YZC A;  2UUB Q;  4DWL A;  2WVJ A;  4DR4 L;  4GOP B;  1GVP A;  1YJ9 A;  4J15 A;  3BJI A;  3W1B A;  1QZH A;  4L5Q A;  1NMF A;  2NZH A;  3PSI A;  1WI5 A;  4H02 A;  1JMC A;  1YJN A;  1XPR A;  1PYB A;  3UDI A;  4YHH Q;  4IOA A;  1EUJ A;  1H0Z A;  2WB1 G;  1X9N A;  3DM3 A;  4DV5 L;  1I94 L;  2KKM A;  4UPA A;  3S17 H;  3CC2 A;  4A3M G;  1XX6 A;  4PZ6 A;  4LF5 L;  3ULP A;  1VQI A;  1Q1B A;  2AWO A;  1OXX K;  1CSO I;  2PNH A;  4HJ5 A;  1PH8 A;  1IBL L;  2OVO A;  4KHP L;  1CKN B;  3F4M A;  2GVI A;  2YQP A;  4DR4 Q;  1HJP A;  3I9V 1;  3J81 j;  1VQF A;  5DAE A;  5C0X J;  4BA2 I;  2JA8 H;  3HOW H;  2PI2 A;  4OWW B;  5CCL A;  3FKI G;  4JG2 A;  4DR1 L;  3VDY A;  2QQ0 A;  1TBO A;  2NU1 I;  4DV4 Q;  2EXD A;  2Q2H A;  2UXD Q;  3PO3 H;  3VDP A;  4LFC L;  2AKW B;  2Q2T A;  4OAV B;  2M5X A;  1I6H H;  3K0X A;  1K8G A;  1PH7 A;  4LF5 Q;  1QVF A;  3M4P A;  1HR0 Q;  3PIP A;  3G48 A;  4R4T A;  4DR6 L;  3STB D;  5IYC G;  3U4V A;  5CCM A;  1E24 A;  2HIX A;  3J80 c;  1TWA H;  1BKB A;  5AJ3 L;  1KBE A;  4AYB E;  1G51 A;  1K73 C;  3AJF A;  4LF4 Q;  1E1T A;  1SJ8 A;  1IBL Q;  3TRE A;  2NZO A;  4X65 L;  4JI3 L;  3I56 A;  1VQA A;  3IRB A;  1UE6 A;  3KJP A;  3AEV A;  4JI8 L;  1A8V A;  2WFW A;  2WAQ E;  1XPO A;  3KOJ A;  3M4Q A;  3OTO L;  1SGY I;  1FAQ A;  2VY3 A;  1TBQ R;  3PUV A;  1X6O A;  5JJK A;  1L2F A;  2FNF X;  4DV0 L;  3UDF A;  2YFB A;  1FJG Q;  5M5Y H;  1KQS A;  1DGS A;  4P75 A;  1E1O A;  2YV5 A;  4BY7 G;  1CT2 I;  2UXC L;  2JA7 H;  2UXB Q;  5AJ3 Q;  2OD1 A;  4ALP A;  2JA1 A;  1N8R C;  4AYB G;  3HOW G;  1IY6 A;  2ARP F;  1Y1W H;  3PUX A;  4JI3 Q;  2UUC L;  2ELI A;  1LR7 A;  1RIP A;  2N3S A;  4LW1 A;  5LMU L;  4A75 A;  2OQ0 A;  1YHA A;  2XTI A;  4JI4 L;  3PV0 A;  3E9I A;  2HHH L;  3A74 A;  3L0I A;  1FL0 A;  3Q8D A;  3ZJY C;  1TGS I;  2R6G A;  2F52 A;  2CWP A;  1MKH A;  2WAQ G;  3BU2 A;  4MNO A;  4A3F H;  2E2I H;  1VS0 A;  4B3M L;  4QGU A;  4PL4 A;  2NU4 I;  2QQE A;  3CPW A;  1WCM H;  1XPU A;  5BR8 Q;  3J80 i;  3PUW A;  2R92 H;  3H0G G;  1HZ9 A;  2K5V A;  2J87 A;  3ER0 A;  1OMU A;  4NV5 A;  1B8A A;  4A93 H;  2UXC Q;  4NXM L;  2ATW A;  1GKH A;  1YVC A;  4LWC A;  3AFQ A;  4LFB L;  2P6A C;  1K3R A;  4DV2 L;  2HQL A;  3I55 A;  5FUW A;  4HIK A;  1BMO A;  2R93 H;  1YJW A;  2JJQ A;  3LJ2 A;  5FUX A;  3RZO H;  1CSP A;  2GKV A;  5LMU Q;  2ROW A;  1SGD I;  5DLQ E;  4YY3 L;  1CKN A;  2ZRR A;  4PMW A;  3GTL H;  1PH5 A;  4TVA B;  1RFH A;  4JI2 L;  1SR3 A;  1ASY A;  3ERS X;  2QQD A;  1X4S A;  3S14 H;  2CAZ B;  4A3J G;  2JEB I;  1HZA A;  4JCV E;  3GTJ H;  1UEB A;  2FUG 1;  1FAR A;  3CF5 A;  4JI0 Q;  3IAM 1;  2Y0S E;  4MZ9 A;  3TS0 A;  1YIT A;  2A19 A;  4BY1 H;  3CXC A;  2JAE A;  1W2B A;  4GI3 C;  5C3E G;  5HY6 A;  1TWG H;  3S2D H;  1C7Y A;  2XRC A;  2E2J H;  5C4X H;  3F8T A;  2F3C I;  3RN2 A;  1PH9 A;  2XMX A;  1FVI A;  2NVX H;  3M9B A;  4IOC A;  2VL6 A;  4PZ8 A;  4YY3 Q;  2JA5 G;  3CMA A;  2LXK A;  4X6A H;  2K52 A;  1X3E A;  3NEN A;  4A3E H;  2R7Z G;  4YCU A;  1HNW L;  4BXX G;  3TJQ A;  1KL9 A;  3F1Z A;  3DO9 A;  4GKK Q;  1MIU A;  4Q9V A;  3OL0 A;  3HOZ G;  5HGI A;  5M5X H;  4DV6 Q;  2WP8 J;  4R4Q A;  5IP9 H;  1MJE A;  4B3S Q;  4A3M H;  1E22 A;  1SLJ A;  4LFA Q;  2GKR I;  4A3D G;  2K9H A;  2N17 A;  1CE3 A;  2Y0S G;  2J9R A;  2BH8 A;  2ZM6 L;  4A3B G;  2R93 G;  4JI5 L;  1VCI A;  3QWP A;  2PQA A;  2PMZ E;  3SGQ I;  4X66 Q;  1CSQ A;  3CAM A;  5IWA L;  3D31 A;  4IFD J;  4K0K L;  3KYH C;  1VQG A;  3S15 H;  3T1Y L;  1Q81 C;  2UUA L;  1PH6 A;  3KFU A;  3UGD A;  3I4M G;  1N33 L;  4YWM A;  1OYV I;  1PTR A;  4POG A;  1EWI A;  1PCE A;  3KF8 B;  1HNX L;  1KAW A;  1YIJ A;  3BZC A;  3BJU A;  5ELN A;  3FKI H;  4GN5 A;  5HGQ A;  5JEA J;  1YTP A;  2V53 A;  1NUB A;  3MEF A;  3CW2 C;  1KHI A;  3HOX H;  3UEJ A;  1AE3 A;  3DA3 A;  4DR5 Q;  5IP7 G;  1QVC A;  1JB7 A;  1XBT A;  3NBH B;  5IYD G;  4HFV A;  1VQJ A;  3F2B A;  2N71 A;  2VUM H;  1MJC A;  1KBF A;  2L1L B;  1VQH A;  5HI7 A;  1VQC A;  3D0F A;  1S72 A;  3FP9 A;  3UDG A;  1A62 A;  4AH6 A;  3RZD H;  4DNI A;  3FBV A;  4OWT B;  1DS2 I;  1D7Q A;  2GN5 A;  4JV5 L;  4AS2 A;  5IYC H;  3OXF A;  3S1N H;  1XA6 A;  5C4X G;  1EIY B;  4LNQ A;  1K83 H;  4QQB X;  2OTJ A;  5IWA Q;  1XMQ L;  2ZJQ A;  4A3K G;  4AIM A;  2UUA Q;  1X54 A;  4YZD A;  1PH4 A;  3W5O A;  2QPO A;  4A3E G;  1L1O B;  4JBM A;  3B6Y A;  1SRO A;  3KDF A;  2ALY B;  5J3B A;  1X56 A;  4JI7 L;  3ULL A;  2I5H A;  4BBR G;  5IP9 G;  5C44 G;  1IBM Q;  2YU9 H;  2EIF A;  2IY5 B;  4AQY L;  1NMG A;  1VQP A;  4A3G H;  1V1H A;  1SGQ I;  3DA4 A;  2SGE I;  5FUY A;  4GLX A;  4NPS A;  5FLX c;  5IYB H;  1VQ6 A;  2IP6 A;  2XTQ A;  3UE0 A;  2MJF B;  4DV1 L;  1KIX A;  2MFI A;  4BY7 H;  2OTL A;  4JV5 Q;  1CT0 I;  2IHF A;  2NU0 I;  1XMQ Q;  2GKT I;  1N9W A;  2K19 A;  2KEN A;  2JB2 A;  4QY7 A;  3RU0 A;  2GVA A;  2A1A A;  2CFM A;  1V1I A;  3WWV A;  5H1S E;  2B8T A;  4RG1 A;  4WJ3 M;  4DAM A;  1VQB A;  4GLV B;  3HOX G;  4P71 A;  5FJ8 G;  2DGY A;  2RIO A;  3MEK A;  4DV5 Q;  4HIO A;  3HH2 C;  3GD7 A;  2N49 A;  4JI7 Q;  2L15 A;  1PA6 A;  4HJ9 A;  2VUM G;  3CCR A;  4A3I G;  2BH2 A;  4BBS H;  1I94 Q;  2E5L L;  1VQ4 A;  1RL2 A;  4IPD A;  1XNQ L;  1XNR L;  2GVB A;  1VQD A;  1B70 B;  4OX9 L;  1S3O A;  3H0G H;  1N13 A;  3S1R H;  2JB3 A;  4GOP C;  3VA9 A;  2YTX A;  4PG3 A;  4KHP Q;  3U58 A;  1V1Q A;  2LXJ A;  4UXJ A;  1X65 A;  2MQH A;  3UGI A;  4FDB A;  4P72 A;  3GTO H;  2FXQ A;  2JXD A;  2JQO A;  3RN5 A;  1I5F A;  1KD1 C;  5ELO A;  4DR1 Q;  3RLF A;  3A0J A;  1HNZ L;  3K8A A;  1CUK A;  5IY0 A;  4GKJ L;  1OMT A;  4DK6 C;  1HPT A;  1N34 L;  3S1M H;  2IX0 A;  4HID A;  3AYH B;  3KF6 B;  2I0Q A;  2NVY H;  4A3G G;  4LFC Q;  1I3Q H;  3H3V I;  2A2C A;  1PVO A;  4A76 A;  2K75 A;  4HJ8 A;  4LF9 L;  3HOY H;  1TWF H;  3E2I A;  3DLL A;  5IYB G;  4I1T A;  4DUY L;  1BBW A;  3HOU G;  4L5S A;  4A3J H;  3CP0 A;  1OXU A;  4TQU S;  4R4C A;  4NXN L;  1N36 L;  2PI2 E;  1J5E L;  4LF7 L;  4GN4 B;  4DR6 Q;  4P73 A;  5LNK 1;  1JT8 A;  4DKA C;  2KCT A;  4X64 L;  3IAS 1;  4JBJ A;  1HH2 P;  4C3H H;  2F3I A;  3CME A;  3HKZ E;  3L2P A;  4LF6 L;  1YHQ A;  4NV2 A;  1BVS A;  2JK8 A;  4X65 Q;  2W0T A;  1HZB A;  4LF8 L;  3RR5 A;  3GTK H;  2NN6 I;  5C3E H;  1JJ2 A;  4Z7H A;  4JOI C;  4OO1 G;  1U0L A;  3VE5 A;  1ASZ A;  2I5M X;  1B7Y B;  4JI8 Q;  2VQE L;  5GRO A;  1PH3 A;  3I4O A;  4GNX B;  3CCJ A;  4B6D A;  4BBS G;  3CC4 A;  4GOP A;  2K14 A;  1UUC A;  3FHW A;  3OTO Q;  2XGT A;  1CGI I;  1EYG A;  2JA5 H;  3TEH B;  3M7N A;  4A3C G;  4BA1 I;  3OVO A;  3K7A H;  2R7Z H;  1LR9 A;  4O0A A;  3PUY A;  4JBK A;  4R4O A;  4DV0 Q;  1PTQ A;  4BXX H;  5EX3 A;  1XTD A;  1X55 A;  4KHZ A;  4NXN Q;  3SGI A;  1J5E Q;  4RMF A;  1JE5 A;  4LF7 Q;  3HOZ H;  1HDL A;  3RLN A;  2RHS B;  4HJA A;  2ORV A;  3PDN A;  4DR2 L;  1SGE I;  4C3J H;  1TWH H;  2LUY A;  2SGQ I;  4A3D H;  1WOC A;  2ZJP A;  1U5K A;  4DPG A;  4LF6 Q;  3HKZ G;  1PV4 A;  2CCZ A;  4L5T A;  1L0W A;  3F2D A;  1AN1 I;  4A3B H;  4LF8 Q;  2UUC Q;  1KMA A;  2DIP A;  2OQK A;  4PL3 A;  3OXG A;  1EQR A;  4B3R L;  2IHE A;  4JI4 Q;  2HHH Q;  1SGR I;  3A5Z B;  1VDD A;  1LTL A;  3RNU A;  3QTL D;  2KCX A;  2JYY A;  1IL2 A;  3HOY G;  3I4M H;  2D0O A;  2A2D A;  2JA6 G;  1A63 A;  1Q46 A;  4B3M Q;  3HFZ B;  1TBR R;  1IZ6 A;  3KY9 A;  1VQM A;  2NN6 G;  1CT4 I;  1R79 A;  3U4Z A;  3PIO A;  4YWL A;  1TIH A;  4JOI A;  1VQ5 A;  1X74 A;  1TBN A;  5IP7 H;  2ASB A;  1QVG A;  4ME3 A;  5IYD H;  2ZTE A;  4QJF A;  2D0P A;  2JA9 A;  5EAY A;  4NXM Q;  4LUV A;  4JBW A;  5JJL A;  4LFB Q;  4DR3 L;  1PFS A;  1S40 A;  4DV2 Q;  4IJH A;  4OAU C;  4APV A;  1FYB A;  2L7X A;  3CXL A;  1WFQ A;  5EX0 A;  3GTP H;  5GAH C;  2NU3 I;  4A3K H;  1YZ6 A;  1UVF A;  2F6M B;  4YCV A;  1YU6 C;  1LYL A;  3CCV A;  1V9P A;  3HKS A;  4JI2 Q;  1YO7 A;  1BUS A;  3AQQ A;  5FLM H;  2QQC A;  3HOV G;  3GO5 A;  4G75 A;  2JB1 A;  4BBR H;  4DK3 C;  2CQO A;  3UE1 A;  1XMO L;  5C44 H;  5GAE C;  2MO1 A;  2ZTC A;  3EN2 A;  4O1O A;  1Q82 C;  1HZC A;  1M8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...