2V1CC

Crystal structure and mutational study of recor provide insight into its role in dna repair
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
234
structure length
229
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RECOMBINATION PROTEIN RECR
publication title Crystal Structure and Mutational Study of Recor Provide Insight Into its Mode of DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
total genus 52
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02565 RecO_C Recombination protein O C terminal
C PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2v1cC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2v1cC01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v1cC03
1VQOA 5GAGC 5HY6A 1HR0W 2YU9H 4JOIC 2ATWA 3RR5A 2Y0SG 2ES2A 3STBC 2VQEQ 3GTQH 3RN2A 4A3JG 5LMUL 4JI3Q 2HIXA 1EUJA 3F2CA 1SLJA 3OYYA 1Q1BA 3GTJH 3OW2A 1YI2A 1N9WA 4R4IA 4IFDG 2Q2HA 3KYHC 2Z6KC 1YIJA 3CC4A 3GD7A 2OQKA 5LMNL 2VQFL 5LMUQ 3G4SA 1U0LA 1JJCB 1IBML 1VQEA 3M4OH 1VQLA 1N32L 2N3SA 3TREA 4UP7A 4HJ8A 1Q81C 4K0KQ 4HJ7A 2YV5A 2VZAA 1QVFA 2VQFQ 3CQZH 4LF9Q 1OXUA 2ZJRA 4IPDA 3HOYG 4IFDJ 4DKAC 3W5OA 1EYGA 4GN5A 1H95A 2YTXA 1E7ZA 3W1BA 1UE5A 3HOZG 3T1YQ 3I55A 2GVBA 1KD1C 3IRBA 2Z0SA 1I94L 2IHFA 3GTGH 3RNUA 4C2MH 1K3RA 1L2FA 2EIFA 4QL5A 3TS0A 1TWFH 3CC2A 3A74A 4QGUA 3UDIA 3FKIH 3AFQA 5C44G 4YWMA 1CSQA 1L1OA 4KHPQ 2F3IA 2MQHA 3EN2A 1FJGL 1JMCA 1B7YB 4PZ6A 2F4VL 1YVCA 2A1AA 1W3SA 1N33L 1CKOA 2F52A 5IP9G 2B3GA 1WYDA 2KCMA 4DR1L 2HT1A 1AH9A 4JI4Q 2UU9Q 2Y0SE 1PH6A 1E24A 5GAEC 2BA1A 3I4OA 3CCUA 5FJ8G 1KAWA 4X66L 4NXNL 1VQPA 3HOZH 2JEBI 2B63G 3M4PA 4BBRG 4DR1Q 4P72A 3GTMH 2VUMG 4TVAB 4RMFA 4WJ4A 2PNHA 2XGTA 3RZDH 2UXDQ 4NXNQ 1E1TA 3J81i 4DV6L 4MNOA 1XNRQ 3F1ZA 1FVIA 1UWVA 2WB1G 5C44H 3TQYA 2UUCL 3CCLA 2IY5B 5H1SE 2JE6I 3GO5A 5LMNW 4HJ5A 2B29A 3KF8B 2BA0A 3KJPA 5IP9H 4JBWA 4DV6Q 4NB3A 4LFCL 3CPFA 2H5XA 4YWKA 4JG2A 5C0XG 4A3BG 1FL0A 5FJ8H 2UUAL 4A3FG 2JA7G 1JE5A 4LF4Q 3JAMi 2LSSA 1SFOH 4DV4L 4LF6L 1SMXA 2K5VA 4BBRH 3H0GH 2B63H 4A3CH 3OTOL 2JA5G 1LTLA 1S3OA 1JB7A 2MFIA 2VUMH 4APVA 3PF5A 4BA2I 4DV2Q 4JI0L 4QIWE 4HIDA 2ZTDA 1Q7YC 2UUAQ 4R4QA 2WAQG 4UPAA 1QVGA 1K83H 3EBEA 3J81c 1Y1WG 3OTOQ 1K8AC 4JI0Q 4R1JA 4AYBG 4DV0L 4GNXA 1YBYA 4A4IA 2R7ZH 2MO0A 3STBD 5IYCG 4DR2L 3CP0A 2RHQB 1QZGA 2UXBQ 4A3KG 3CCSA 5FLMG 2E2JH 2UUBL 5M5YH 4QQBX 1WOCA 1GM5A 2L15A 2JA8G 4KHZA 4DR6L 1IYJB 1KL9A 1SE8A 3JAMc 4YCWA 4JCVE 4DR2Q 2JA5H 3MEFA 1U5KA 2YTYA 4DUZL 3AYHB 4NPSA 1RL2A 2WB1E 4DV5Q 2KBNA 2K4KA 4YY3L 3PO3G 3S24A 1N34L 4KLKA 5IT9c 2N78A 5IWAL 2MO1A 1EWIA 2CFMA 4IPHA 5DLQE 4HJ9A 3S1RH 1QUQB 1Y1WH 1LM0A 4DNIA 4ME3A 1HNZL 4B3TL 1GKHA 3E9IA 3ULJA 1ASYA 4B3MQ 4LF7L 3RLNA 1P16A 3KF6A 2OTJA 4MTNA 4YY3Q 4A3EH 1C7YA 3E0EA 1X56A 1N34Q 4GOPB 5IWAQ 1VQ5A 1OXSC 3DM3A 5IYCH 3J81j 2DGYA 3F2BA 4B3TQ 2VQEL 1EQRA 1KRSA 4JI7L 4GKJQ 1X3EA 1Q46A 4JI3L 3HKZG 2JA8H 1RIPA 3D31A 1XJVA 2IX0A 1X3GA 2DUDA 2JJQA 4RG1A 4L5QA 1UE6A 3CCRA 2NZHA 4YHHL 2XTIA 4JI7Q 2WAQE 4H02A 3U50C 2ID0A 3PO3H 4JBJA 3WWVA 3PCOB 4A3IG 4JI1Q 1IL2A 4DR6Q 3PUWA 3NENA 1PYBA 3SGIA 3AQQA 4A75A 1VQNA 4JI6Q 4JYAL 4JI5L 4AYBE 4IJHA 4R4OA 4YHHQ 5EAYA 1VQ4A 1IBLQ 1PH8A 4LFBQ 5GQOA 2QGQA 4K0KL 1PVOA 3FKIG 1IXRA 3MXNB 1BBWA 1HH2P 3CC7A 4LF9L 1A63A 3FHWA 1D8LA 3HKSA 1M1KC 4OO1I 1M90C 4JYAQ 1J5EQ 4JI5Q 3M9BA 2R7DA 1XTDA 4HIKA 2RHSB 4DR3L 2IHEA 3T1YL 4NXMQ 4LFAQ 2CWAA 3ULLA 4Y52H 1VQAA 4OONA 4EQ5A 1B8AA 1NBWA 2CKZB 2KHJA 2VW9A 5M3FH 1L1OC 1YHQA 1PA6A 4OX9L 1NJIC 2NVQH 2YTVA 1KXLA 3I56A 4DR3Q 5IY0A 4A3IH 1DGSA 2NZOA 2PQAA 4A3LG 3HOUG 4KHPL 3NBHB 4GS3A 5IYBH 2WFWA 1PV4A 1KQSA 3A5UA 1YEZA 4DK6C 1PH9A 4GKKQ 3UE0A 4OX9Q 4OWTB 1KRTA 1TWAH 1VQHA 1X65A 2K5NA 2AKWB 4LUZA 2UU9L 4JI4L 3S1MH 1YZ6A 3K7UC 1XPRA 1PH1A 2Q2TA 1L1OB 1TXYA 2E8GA 2Q2UA 5K36G 1VCIA 3HKZE 1SR3A 2AMCB 3BU2A 4DPGA 1X55A 2OCEA 1I5FA 2KENA 1K8GA 2CCZA 1OXXK 3HOVG 2N8NA 4GLXA 3RLFA 5GADC 2UXDL 2V1CC 4X64Q 4O2DA 2ZJPA 2D0PA 1XNRL 3K7AH 3KDFA 4IPCA 4A3CG 3H0GG 4A3LH 3HOUH 3M7NA 1LUZA 1R9TH 1BVSA 1OXVA 3TRZA 3PGZA 3FP9A 1VQJA 1AE2A 3TS2A 3EIVA 2I0QA 4C3JH 3S15H 4DR7L 1HNWQ 1A62A 3GDEA 4R4CA 3U4VA 3W1GA 5ELOA 5J3BA 4BA1I 4LF4L 1E3PA 4FDBA 4GN4B 1PH3A 4C3HH 2R7ZG 5GAHC 1VQKA 4L5SA 3GTPH 3CCEA 4AH6A 3T1HQ 3NELA 2ASBA 4YWLA 3HOVH 4DR7Q 4P73A 4DV2L 1VQFA 3M4QA 4A93G 4LWCA 4GNXC 1XNQQ 2UXCQ 2A19A 4DV1Q 4DV3L 1SRUA 4LF8Q 3K0XA 4A3DG 3JC66 4IJLA 1HJPA 1L0WA 5BR8Q 3CXCA 5JJLA 5C0XJ 4PZ7A 1N8RC 2UXBL 2VNUD 2K52A 4DV3Q 2CQOA 1VQGA 4HJAA 2R93G 1C9OA 2E2IH 1IBKQ 2Q2IA 3S2HH 4IPGA 2ALYB 4UP8A 3PIOA 4A3EG 1EIYB 5C4JH 4GNXB 4OWXB 4R4TA 3CMEA 2IT1A 2JQOA 1NE3A 1CKMA 3UDFA 4DV5L 4IOAA 1GVPA 4A93H 3S1QH 4DR5Q 1CKNA 3GTOH 3I2ZA 1MJCA 4P71A 2VY3A 4X62Q 3ERSX 4GOPC 1HR0Q 4BBSG 3GTKH 4C3IH 2VS1A 2OWOA 4B3ML 4LF5L 1CUKA 1UE7A 2JA9A 4A3DH 4JV5Q 2AWNA 2I5MX 4LW1A 4AQYQ 1Y1VG 1OXTA 3PUYA 4HIMA 1V9PA 4YCUA 2NN6I 3G6EA 4LF5Q 4B3RQ 1YJ9A 2R93H 4GKJL 1WFQA 2JA6G 1XPOA 3U4ZA 1PYSB 3AFPA 3KF6B 4YCVA 5HGQA 1S40A 4A3GG 4L5TA 4XIGS 1N36Q 1GD7A 4DAYB 4J15A 5JEAG 4JI1L 2FXQA 3UDXA 1VQMA 1HZ9A 1P8LA 1PH4A 4QJFA 2LXKA 4JI6L 4BBSH 2BH2A 1E22A 2PMZE 4PMWA 5M3FG 3CCMA 3CD6A 4LFBL 1Q8KA 4GN3B 2ZM6Q 1IBLL 1G6PA 1EOVA 5C4XG 1PH2A 4DV7L 4GLAC 1Y1VH 2ZTEA 3HOWG 3A0JA 1V43A 3S1NH 5IYBG 5IE8A 3H3VH 3CW2C 1V1QA 1J5EL 1HNXL 3H3VI 4X65Q 2K5HA 3L2PA 2QA4A 1QVCA 4LNQA 2JA6H 1HZBA 5JEAJ 4BY1G 3AEVA 1XPUA 4DR4L 4DV7Q 4A3MG 1BBUA 4NXML 4LFAL 5IYDH 2K75A 4A3GH 1NY4A 2AHOB 5M5XH 1X3FA 1YJWA 1W2BA 1HNXQ 3Q8DA 1NTGA 5IP7H 1XMOL 4DK3C 2OTLA 1Q86C 4DR4Q 4JC0A 1Q82C 4BXXG 3CF5A 4GKKL 4KI0A 2HHHQ 5M3MH 2CWPA 2D0OA 1EIFA 5C4XH 3KJOA 1XMOQ 3DLLA 2ZJQA 3S17H 3PUXA 1YITA 3HOWH 1PFSA 2E2HH 1YNXA 4UY8C 4A76A 1SROA 2PQAB 2BH8A 3VDYA 4BY7G 4O0AA 3K81C 2NVYH 4JOIA 4UP9A 1E1OA 4P75A 1ASZA 3E9HA 4IO9A 4BY1H 4A3MH 1TWCH 4PG3A 1X9NA 2R6GA 1WCMG 3F2DA 5LMNQ 1VQDA 4MZ9A 1I50H 3NEMA 4X64L 4DAMA 4EX5A 1IBMQ 2PI2A 1TWGH 1YHBA 2Z6KA 1OTCA 3I4MG 1N32Q 3CCJA 3ICEA 4JI2L 1K0RA 4BXXH 1WJJA 4IOCA 4A3JH 2N49A 1T9HA 4L5RC 1G51A 3PUVA 1X6OA 2EQSA 3D0FA 3KDFB 4JI2Q 2C35B 1HNWL 4BY7H 4IFDI 1VS0A 3CCVA 1K9MC 1QZHA 1I94Q 1A0IA 2K50A 3B6YA 3T1HL 2R92G 1KC8C 3RZOH 2RCNA 1WCMH 5JJIA 1BKBA 3RN5A 4PZ8A 5E7NA 3H15A 3PSIA 1FJGQ 1XNQL 3HOYH 3I4MH 3S14H 2F4VQ 4DUYL 2UXCL 4JI8L 3GTLH 4DV1L 4X6AH 1N33Q 1VQ8A 4LF8L 3UE1A 4JBMA 3CMAA 3CPWA 1J6QA 1CSPA 2VL6A 3J80i 4AIMA 5AJ3L 5BR8L 3BJUA 1Y14B 1PH7A 2RF4A 4DUYQ 2I5HA 4JI8Q 4X66Q 1NMFA 3M85A 3LGJA 2JEAI 1IBKL 2E5LL 4ALPA 3I4NG 1D7QA 2NN6G 1HZCA 5AJ3Q 1UE1A 5M5WH 1G291 1Z47A 2R7FA 3A5ZB 2R92H 1NMGA 1WI5A 1TWHH 4OXPA 3CCQA 1VQCA 2E5LQ 3CAMA 3S16H 1JJGA 4DR5L 1UEBA 2NVXH 1IZ6A 2UUCQ 4HIOA 1K73C 1S72A 1VQIA 4X62L 4Y7NH 3I7FA 3TEHB 2LXJA 1HR0L 5ELNA 1YJNA 5C3EG 4LUOA 1MKHA 4JV5L 2QEXA 1JJ2A 2YYZA 3G71A 4LFCQ 4AQYL 1I3QH 1HZAA 3KFUA 1CKNB 3J80c 2D62A 1Z9FA 4B3RL 1Q1EA 4QY7A 4DV4Q 4LF6Q 2KCTA 3ER0A 2K14A 1X54A 2I5LX 1KHIA 1VQBA 2WP8J 3F8TA 4XTCS 3K80C 3HOXG 3I4NH 3J7A5 3M3YH 3S2DH 2IX1A 4P74A 3UDGA 2HIVA 2ZTCA 5GROA 2MNAA 1N36L 1VQ9A 5JJKA 2KHIA 3L7ZC 1PHJA 3PF4A 3PO2G 4GLVB 4OO1G 3RLOA 1C0AA 2EXDA 3L0OA 4POFA 5IYDG 4OWWB 4A3BH 4WJ3M 5C0XI 1PH5A 4A3FH 2JA7H 4DV0Q 5C3EH 1MIUA 2ZM6L 4POGA 3ZJYC 5IP7G 1VQ6A 2A8VA 1I6HH 1GO3E 5FLXc 3BZCA 3G48A 2UUBQ 1EFWA 3J7ZC 4X65L 1LYLA 5M3MG 1SN8A 1QUQA 1XMQL 3U58A 4LUVA 4TQUS 3HOXH 2GVAA 1YHAA 1O7IA 1JT8A 2JK8A 4DUZQ 3BZKA 2PI2E 4B3SL 3KOJA 3PIPA 2OQ0A 4GOPA 3ULPA 2AWOA 2HQLA 3KLWA 1MJEA 2NVTH 1Q12A 1EQQA 1XMQQ 3PO2H 3K8AA 1AE3A 4JBKA 1FGUA 1A8VA 3HFZB 4A3KH 1HNZQ 5FLMH 2GN5A 4LF7Q 1KIXA 1VQ7A 4B3SQ 3PV0A 2HHHL 1B70B 3PUZA
chains in the Genus database with same CATH superfamily
2L11A 5EPKA 5GAGC 1VQOA 1QCBD 1CT2I 2R92B 3RR5A 4B9XA 1QNKA 1TWHB 2VQEQ 3EROA 1I6VC 1EYDA 3MZ5A 3RN2A 3GTQH 3TJQA 5CGKA 2HIXA 1SBBB 2AUKA 3F2CA 5HGIA 3GTJH 1IY6A 4NW2A 2V53A 4R4IA 1TBQR 1YIJA 3CC4A 3MXNA 2F3CI 3GD7A 2OQKA 1H9KA 5LMNL 1GJXA 1Y69U 3LNNA 1U0LA 1N32L 2N3SA 5KNBA 1ZXTA 4UP7A 2JAEA 4N8X1 5FO7B 2YV5A 1PRTF 3R5AA 3M3YB 5T1GA 2ZJRA 1GUGA 3CHBD 3W5OA 2PZTA 5E3FA 3I9V1 4GN5A 1H95A 5C4HA 2K5DA 3NBHA 3T1YQ 3OIQA 2GVBA 1HRJA 1SGQI 3QWPA 1EU4A 5C6AA 2JYOA 4U68A 2RQXA 3CC2A 4QGUA 1I6HB 3FKIH 5IGFA 5C44G 1MT1A 1V1IA 2F3IA 1ESFA 4JPBW 1S5BD 2F4VL 2A1AA 2UVOA 2F52A 2XNAC 2GA4B 3HOXB 3S9WA 1MJ9A 2B3GA 2P6AC 1AH9A 2XSCA 5GAEC 1TQOA 2MHVA 1KLUD 3I4OA 1D2BA 1KAWA 4DN4M 3NTKA 1STHA 4BBRG 1ILQA 4P72A 1BR9A 2H1EA 4KY6A 2VUMG 5M5XB 1E0BA 4RMFA 1X4SA 4PV1C 4WJ4A 2KEDA 3GV6A 2UXDQ 4DV6L 4MNOA 2IWHA 1PCEA 2WB1G 5KGUA 5C44H 4NMZA 4JW0A 2UUCL 1TDPA 3D4DA 1CTMA 3CCLA 5M3MB 4DV6Q 2B8FA 4NB3A 4IUNA 3CPFA 1SNPA 4F88A 2Y0MA 4K14A 1EY4A 2B2YA 2F1MA 2UUAL 2VRWB 2LSSA 4ZUJA 1SFOH 1CHOI 4BBRH 4ZKBB 1EQVA 2JA5G 2MFIA 2VUMH 3VYUA 4APVA 3PF5A 4BA2I 2JYYA 4DV2Q 2UUAQ 1SGNI 4R4QA 1JB3A 1EY6A 4ODGA 3EBEA 5EPLA 4GNXA 1DZ1A 4O1OA 1P9GA 1F2LA 1WTWA 4A4IA 3MFGA 5IYCG 4DR2L 1QZGA 2QDLA 5FLMG 2E2JH 2EY1A 1AP0A 4CKCA 1GM5A 4AS2A 2JB2A 1SE8A 4Q5VA 2JZMA 3RZOB 4DR2Q 4KD3A 2JA5H 1KNEA 4OL7A 2IP6A 3AYHB 5EBDA 1K8MA 4NPSA 5KNCA 3PO3G 2BH2A 5IT9c 4HJ9A 4DXGA 1STEA 2VB3X 1QUQB 4N9TA 1IW7D 5FO9B 4B3TL 1TIHA 3ULJA 3O13A 2F0TA 1WTOA 1P16A 4MTNA 4A3EH 2ELIA 1VQ5A 1BNZA 3RZDB 5IYCH 4LMQD 2DKVA 3HEJA 2DGYA 4B3TQ 2LKVA 1KRSA 1Z2IA 2RIOA 3L9AX 4DK0A 1X3EA 1Q46A 4OGQC 2WVJA 3D31A 2J0TD 2JJQA 3VDUA 4L5QA 2XIWA 2NZHA 2PZWA 2WAQE 2F0MA 3PO3H 1IW4A 2PQ8A 5C5LA 4JYAL 2FEFA 1PH8A 1BUSA 1EQTA 2M00A 3CC7A 4LF9L 3FHWA 1D8LA 4OO1I 4JYAQ 1IYVA 2RSOA 2NTSA 4KKUA 3FPUB 2L0CA 1IL8A 4OHJA 1F2ZA 3S2DB 3ULLA 1VQAA 4R9WA 3VYSA 3UEYA 2CKZB 1PA6A 1YHQA 2NVQH 2YTVA 4Z7GA 1TR5A 2EDGA 3SGBI 4A3BB 1DGSA 2PZUA 2L7XA 4A3FB 3DEPA 4HN7A 2ZRRA 1SYGA 4B9WA 3Q24A 1S20A 1HFGA 1NCVA 1VQHA 1X65A 3L0IA 1MBYA 2AKWB 2UU9L 1B9MA 3V2TA 3K7UC 1XPRA 5K36G 2E8GA 1L1OB 2WAQB 4C3JG 1Q3LA 2M9VA 2ICEC 1SR3A 1Y1WB 3ERQA 2AQ3B 4J6HA 5FLXE 2KENA 2ZXRA 2K6AA 1B44D 2X6LA 5CV7A 4IPCA 4A3CG 3H0GG 3M7NA 2I07B 2ZT9C 1QG7A 3C46A 3LX0A 3PGZA 3FP9A 4L8JA 3GTQB 2ENZA 4C3JH 1HNWQ 1H9SB 4V0BA 5J3BA 1E3PA 1HDLA 4PMBA 2X52A 4L5SA 4AH6A 3NELA 1E2VA 1DONA 1PZID 1EYCA 1VQFA 1W4RA 4A93G 2A69C 4MIUA 2B39A 1XNQQ 3UFFA 1GUOA 3EVQA 5A35A 2KOLA 1VDDA 3I90A 3X3NA 2TMPA 3LJ1A 3SXHA 1H9JA 2K52A 1HQRD 2NU4I 2N17A 2F0FA 2Q2IA 3TSSA 2ALYB 5BN5A 5A2QE 2L12A 4OWXB 4R4TA 3CMEA 3CKIB 3NK9A 1WTQA 2A73B 3FKIB 3NWTA 2JQOA 3HH2C 3V96A 1CKMA 4DV5L 4A93H 2LY7A 4DR5Q 3GTOH 3I2ZA 3OSOA 3NQTA 1HPTA 3ERSX 1HR0Q 3C3LA 4LF5L 5KYIA 4LW1A 4G75A 3EA6A 4LF5Q 4B3RQ 1YJ9A 3BJIA 4GKJL 5ELBA 1DOKA 2G5DA 3AFPA 3KF6B 4HEDA 1F9RA 3QIAA 2D9UA 5C44B 4DAYB 4J15A 4JI1L 3UDXA 2JB1A 1PH4A 3Q22A 1TS4A 2LXKA 5CCMA 1VMCA 2PMZE 1Q8KA 4GN3B 5E4XA 2SGQI 2EYJA 4B6DA 4DV7L 5FLXL 4GLAC 3A0JA 3S1NH 5IYBG 5IE8A 3QR8A 1SFOB 4X65Q 4BBRB 3MTSA 4ZQ3A 3RMHA 1HA6A 4DV7Q 1MSGA 1K7TA 1EY5A 4E1PA 4G4KA 4J8QA 2NUCA 2JN4A 3QB3A 3UGDA 1BXTA 1NTGA 1XMOL 1KLGD 2OTLA 3QOLA 3OXLA 2QSBA 2E2IB 3E2IA 3S2HB 4GKKL 2K5QA 1HJAI 2HHHQ 1MI2A 3FNBA 1XMOQ 5ELCA 1K0SA 3DXJC 2E2JB 3UGLA 4BWGB 1H0ZA 2PQAB 2BH8A 2EYPA 3S1QB 2QEJC 3NP8A 1E1OA 2E76C 1ASZA 4DXFA 1RTNA 2N52A 3FSXA 1OYVI 1TWCH 4O42A 2PMZB 1C48A 2R6GA 1FYCA 1WCMG 3KP9A 1ENAA 1LR7A 5D3DA 1OTCA 1EY0A 4CBVA 5CMDA 2XVSA 2R93B 3CCJA 4U673 4JI2L 2GSCA 2CWGA 4IOCA 4A3EB 4A3JH 1T9HA 5A2QL 2ZXPA 3PUVA 4O1PA 3BS1A 3A7LA 3KDFB 4JI2Q 4F8MA 1VS0A 2KVMA 1PYWD 4BBSB 4X3UA 4EQOA 3BZDB 3T1HL 2R92G 1YNJC 4WJWA 4CDFC 1GUWA 1WCMH 5JJIA 3IAM1 2F0KA 4K6DA 5E7NA 1KMAA 1FJGQ 1TBOA 2UXCL 1P9ZA 4DUYL 4PL5A 3NPPA 4X6AH 4WRDA 1N33Q 4XQQA 4LF8L 2K05A 3T51B 1WTVA 1J6QA 4AIMA 2NWGA 5BR8L 1Y14B 2O5JC 4DUYQ 4HFVA 1NMFA 3M85A 2YUUA 2JEAI 1FGBD 3H91A 3NBIA 4G7OC 3I4NG 1R0RI 1D5MC 1UE1A 1WTJA 5C4ZA 3VA7A 1EY7A 2R92H 1NMGA 1WI5A 1TWHH 3HOWB 2E2HB 1VQCA 1PTOC 2F0QA 1IZ6A 2DJGC 3NTHA 1OMTA 5FO8B 1VQIA 2K28A 3TEHB 2RVLA 1YJNA 5C3EG 4A3MB 2YYZA 2MGSA 3KFUA 1KDBA 1I50B 3A56A 1Q1EA 3UI2A 1NAPA 4LF6Q 2KCTA 3K58A 3ER0A 2K14A 5J39A 1KHIA 3HOXG 3I4NH 3F8TA 4XTCS 4ZKCB 3M3YH 5KNDA 4P74A 4RHRA 3I72A 1VQ9A 1LTAD 3PO2G 3MXUA 3RLOA 3PDNA 4WJ3M 1PH5A 2JA7H 2R61A 5C3EH 2F0SA 2A74C 1I6HH 2B2WC 2QQEA 1GUNA 1CHPD 2J4XA 1LYLA 3VR6A 3I4MB 5M3MG 2RKSA 3S14B 5HI7A 2ORVA 3HOXH 3QTLD 1O7IA 3KOJA 1MJEA 1Q12A 3PO2H 3EFXD 1K7UA 1AE3A 2C9OA 1NXUA 4XQNA 3IL8A 4K8JA 4CDCC 1VQ7A 2F0OA 3PV0A 4PNYA 3PUZA 1SNDA 1QB5D 1PDQA 4FXKC 2ES2A 2ZW3A 4Z9CB 4JI3Q 4K6LA 3TDQA 1SLJA 3NHHA 1FNVA 4TKOB 3IAS1 1N9WA 2A20A 2Q2HA 3K5MA 1XBTA 4JVZA 1JJCB 1IBML 4DNCA 4AS3A 4HJ7A 2EY5A 1CZWA 2EJMA 2KJXA 2VZAA 1U4LA 2F0DA 4IFDJ 1EYGA 2JSOA 2AQ2B 1E7ZA 3LJ0A 1U4RA 3KK7A 3H3VC 2IHFA 3RNUA 1CT1D 1K3RA 1G2TA 2QILA 2E2DC 4FXDA 1RF2D 3T16A 1TVXA 4LAAA 1CSQA 2NYZD 5JPMC 1JMCA 1W3SA 1W6KA 2Z1CA 1BCPD 1D5ZC 3S1NB 2JBWA 2BA1A 2TSSA 5FJ8G 4AMLA 4X66L 1JQYD 2CW0D 1U4PA 1S5CD 4TVAB 3KUPA 4DAVA 3RZDH 2RADA 1B4OA 2YU9B 1A3TA 1E1TA 1XNRQ 1FVIA 2XWJB 3TQYA 2F6MB 1F9SA 2IPKD 5H1SE 5LMNW 2HDLA 1QOHA 2B29A 1VF7A 3KF8B 2AQ1B 4TRDA 4FKDA 1L0YB 4JBWA 3Q0AA 1NSNS 4LFCL 3TP8A 4QUFA 2H5XA 4YWKA 5C0XG 2B0UC 2QPOA 4A24A 4A3BG 1FL0A 2RSNA 3SDJA 5FJ8H 4A3FG 1QILA 2K5VA 1TBNA 3OWFA 1BCPC 1S3OA 1JB7A 1J8IA 2GVIA 3VDPA 4CJ2C 1UHAA 2E73A 4JI0L 4HIDA 1Q7YC 2WAQG 3H6MA 1QVGA 4HGUA 1Y1WG 1HUMA 3SVMA 4A3JB 3MXPA 1JOQA 4JI0Q 1YBYA 4C2MB 1B1ZA 5C0XH 3MC0B 1U9RA 3CCSA 2UUBL 4LK1C 2A6ED 4QQBX 3B4VC 1V1PA 1JC7A 1KAAA 3P75A 2L15A 2JA8G 3B55A 1IYJB 1NNXA 2PCFB 2XTRA 5CC4A 3MEFA 2YTYA 4IURA 1EIHA 2KBNA 1N34L 2MJ8A 4IPHA 1EWIA 2CFMA 5KYLA 1Y1WH 4OVOA 1SE3A 1LM0A 4DNIA 4ME3A 2OEOA 1GKHA 3E9IA 3HOZB 1ASYA 1SGRI 3DHQA 1S5FD 3TMEA 1DOMA 4ILWA 1JWSD 5DM73 1X56A 4ZYSA 4GOPB 1N34Q 3J81j 2VQEL 1EZ6A 2K1BA 4Z7HA 2JA8H 1YO7A 2L1LB 2DUDA 3CCRA 2QKIC 4YHHL 4H02A 3HRZC 4JBJA 3WWVA 1IL2A 4H44C 2A6EC 3NENA 2NU2I 1WD1A 4JI5L 1CI3M 4R4OA 4YHHQ 4LFBQ 1IBLQ 5GQOA 4I1TA 3FKIG 3DUZA 3FVVA 3HKSA 3BYYB 4JI5Q 3M9BA 1X3PA 2R7DA 1PTRA 2O4XA 3I4NB 2RHSB 2IHEA 3T1YL 2CAZB 2SGFI 4F87A 3R2TA 4Y52H 4OONA 1A3UA 1B8AA 4HSPA 1CSOI 1KXLA 1L1OC 2QZGA 3TOAA 4G7HC 3I56A 2CQAA 5IY0A 2NZOA 1TIID 1WTPA 3HOUG 4A3LG 4GS3A 2JA7B 2WFWA 1A2UA 1EEFD 5C3EB 1RKNA 3A5UA 4E1RA 1YEZA 4DK6C 1TURA 2RCFA 4HAEA 1G2SA 1FAQA 1KRTA 4ZUIA 4LUZA 1XXGA 1YZ6A 2Q2TA 3D00A 2Q2UA 4U6RA 1T5EA 1CM9A 3HKZE 2AMCB 3SK8A 5I2YA 5JJZA 2WV6D 4PL4A 1I5FA 5I6WA 1OXXK 2PYKA 2N8NA 3FRPB 4GLXA 5GADC 1Y1CA 2UXDL 1NR2A 3PO2B 3EJIA 2D0PA 3K7AH 3E6ZX 2BE5D 4A3LH 3HOUH 4SGBI 1G8ZD 3HZXA 2E75C 3GOXA 2DIPA 3JSBA 3KBXA 4DAPA 3I73A 5FUXA 4FNFA 4ZAIA 2R3ZA 1A62A 4R4CA 3U4VA 5EPJA 3PMFA 4FDBA 4GN4B 1HXYD 1A3VA 4PL3A 2FJ2A 5LHY1 3TZDA 2ASBA 4RGTA 3I3CA 4P73A 4DV2L 3M4QA 1YTPA 4LWCA 2A19A 4DV1Q 1IKLA 3AB9A 3HKZB 3K0XA 1UNSA 2SOBA 4IJLA 1L0WA 3CXCA 5C0XJ 5ISRA 3R8BA 3K5LA 2R93G 2BE5C 2Z4IA 4HJAA 2E2IH 3S2HH 4UP8A 1FNWA 4A3EG 2B2TA 4I7AA 5T1IA 2XTQA 1TWAB 4KKSA 3UDFA 1MJBA 4IOAA 3V05A 1GVPA 3S1MB 3S1QH 1CA5A 5JPNC 4DFAA 4P71A 1IYUA 2C5CA 4BBSG 4X62Q 2VS1A 2CHBD 4JV5Q 1HHVA 1OXTA 2EJFC 2PNRC 3PUYA 4CHTB 3R93A 1KBFA 2R93H 2DB6A 2G9DA 1XPOA 1EOTA 1PYSB 1KDCA 4XIGS 1II3A 3LJ2A 1SE2A 4G57A 5FUYA 1P8LA 2F0WA 3I70A 2ENBA 4BBSH 5FOBB 3CD6A 5JAVA 3GTPB 1EOVA 3FEWX 5C4XG 2KA7A 1VF5C 1RD9D 3TBIB 3HOWG 1WGCA 1V43A 3ZYYX 1V1QA 1RJTA 1HNXL 3L2PA 2K5HA 2B2WA 1QVCA 5JEAJ 5D14A 1XPUA 4KJNA 5I9PA 4A3MG 4UXHA 1HTPA 5IYDH 2K75A 1HNXQ 1YJWA 4X3TA 2A2DA 4DK3C 3CRLC 2ETDA 1AFPA 1Q86C 3N52A 5IODA 3N6RA 4BXXG 5J8FA 2CWPA 1EIFA 5C4XH 3NQIA 2UZ3A 3OXGA 2ZJQA 1YITA 3HOWH 2E2HH 1DD2A 2X69A 4A76A 1V1OA 2GIVA 3VR3A 4RGMA 2NVYH 4P75A 3E9HA 4I65A 1A15A 4A3MH 4A3DB 1XWEA 2NTTA 1ULNA 5DM63 2A69D 1SNMA 3MXGA 3OOCA 5JOBA 1VQDA 2K33A 1I50H 2KKMA 1SAPA 4MZ9A 1C4QA 3I4MG 3ICEA 4BXXH 2KQ3A 1BCPF 3BG3A 2N49A 4L5RC 1O78A 4OAVB 1G51A 4LJZC 3D0FA 1HNWL 2JA8B 3MEHA 3P23A 1KABA 1ET6A 5CV6A 3K59A 3CCVA 1I94Q 3FSYA 1A0IA 2K50A 3AJFA 4FP5D 2FNFX 1K3BC 3FBVA 1F2YA 1Y1VB 3P1HA 4CDDC 1BMOA 3HOYH 1XNQL 3P7JA 3I4MH 3S14H 4UXJA 1V8QA 4JI8L 3PIO3 3DEOA 1JR0D 4FF2A 4JBMA 1TY0A 2EJGC 3CPWA 1QNUA 1HPCA 1SYFA 4A3GB 5AJ3L 1X74A 1NR4A 1SGYI 1JICA 2EY2A 2VB2X 3D8GA 4JI8Q 1LTBD 1DCZA 2J9RA 5IGGA 2E5LL 2CJSC 2SDFA 2NN6G 5AJ3Q 5K5PA 1Z47A 3A5ZB 3OPOA 3DWAA 3T13A 3S17B 5IIFA 4OXPA 1SJED 3CCQA 2E5LQ 1K28A 3S16H 1JOOA 4DR5L 3OHXC 1Z7TA 1K73C 3UITA 1E2ZA 1HR0L 1J9OA 2LXJA 1XX6A 3D6CA 1JJ2A 3G71A 2WKDA 2RC4A 5HGTA 2RA4A 1HZAA 1CKNB 1MHWC 1CQFA 2D62A 1Z9FA 2KCCA 4B3RL 4R8NA 4DV4Q 2NN6H 3J7A5 4ZK9B 1DXMA 1EEID 2IX1A 3K7AB 1NUCA 1CT0I 2HIVA 1BDOA 2OXPA 3ONAB 1TT2A 1PHJA 3HOUB 1HEVA 1C0AA 4BY7B 3DO9A 2PQEA 2L8EA 4DV0Q 1GHJA 3R3OA 1OMUA 1VQ6A 1TY2A 3G48A 3MEKA 4X65L 1STAA 3J7YW 3K57A 1SN8A 4YIJA 1QUQA 3GTLB 4LUVA 1CA6A 1YHAA 1JOKA 2EY6A 3DMUA 4KK7A 4DUZQ 2PI2E 2XRSD 4B3SL 3I4LA 3ULPA 1NUBA 1EQQA 2FUG1 4IZ8A 1BO0A 4A3KH 1HNZQ 2A6HD 4LF7Q 2XWBB 4EVOA 4B3SQ 1LT3D 2HHHL 4IPGA 3Q6SA 5M5WB 5HY6A 1SYEA 2AUJD 2YU9H 4DNTB 3STBC 1SNCA 2LUYA 4A3JG 1EUJA 3IFTA 1YNJD 1Q1BA 3OW2A 3ND9A 5EKIA 3DWPA 4IFDG 1SJHD 4NDXA 2OF1A 5NUCA 1VQEA 4Q0FA 1VQLA 3TREA 3L3OC 1TS5A 3QJYA 4HJ8A 1Q81C 1SDFA 4K0KQ 3DM1A 5JVH3 1EU3A 1ESRA 5KEEA 3RD4A 5IGEA 3W1BA 3TP6A 1UE5A 3HOZG 2A6HC 3I55A 2Z9HA 3IRBA 5E3QA 4C2MH 2EIFA 3TS0A 4QL5A 4IFDH 1PTOD 3A74A 3UDIA 3K5OA 1PRTD 2HCIA 5JVG3 4KHPQ 1L1OA 2KMQA 2F0IA 2MQHA 3EN2A 4IUTA 1B7YB 4PZ6A 3NXWA 1FJGL 2KMOA 3E59A 1YVCA 1K7VA 1N33L 2QQDA 5IP9G 1LTSD 3A8JE 1WYDA 2EYHA 2G9HD 4JI4Q 2Y0SE 1E24A 5KRUA 3CCUA 1ULMA 2O5IC 1VQPA 3RU0A 3VA9A 2EE1A 3HOZH 4TSSA 5LL6S 3M4PA 5CV5A 2B63G 1OVOA 3TN2A 2SNSA 2PNHA 2CVRA 2B2TC 4ABNA 1M8AA 4CJ1B 1UWVA 3UGIA 2F0LA 2IY5B 2JE6I 3GO5A 5ELEA 4HJ5A 1G91A 2KMRA 5C4XB 1ENCA 5IP9H 1YU6C 1R4PB 3W2DA 3SK4A 3EQLC 2WINB 4JG2A 1PRTC 2NVYB 2NBFA 4L63B 3OXFA 1RTOA 3OMCA 1JE5A 2K32A 2OT2A 4LF4Q 2JA7G 3M4OB 3MA2B 5TSSA 4LF6L 5ELDA 5HURA 4YZCA 2B63H 1B3AA 1STYA 4HTHA 1F9QA 2RDHA 2ZTDA 3CQZB 5C3WA 1CT4I 2J7ZA 4UPAA 2Y0SB 3J7AV 3VE5A 2F0NA 3J81c 3GQBA 3R2IA 5EX3A 1K8AC 1FR3A 4GZYC 1AN1I 4XT1B 3GTGB 3QWNA 2JXDA 1STGA 2R7ZH 2MO0A 3PIP3 3CP0A 2RHQB 4BS9A 2UXBQ 1JORA 1WGTA 5C5MA 2IW3A 1CE3A 4E6IA 1TBRR 2MJFB 4DWLA 1B9NA 4DR6L 1KL9A 3JAMc 2JW6A 4JCVE 1KDAA 1D6EC 4C56C 2YQPA 2K4KA 4RKBA 3QO2A 3HOYB 3S24A 1A6XA 2SNMA 4DR6Q 2MO1A 5C3XA 2NZ1D 3GV3A 1SMYC 3DWQA 4B3MQ 3C1FA 3GTMB 3KF6A 1ZEQX 2JXMB 2CWFA 1OXSC 4CKBA 2OU2A 3F2BA 1EQRA 1D5XC 3SR1A 1ZYRC 2ORWA 4PQXA 3VR4A 4JI3L 3HKZG 1RIPA 4EQPA 1X3GA 4J1MA 2K9HA 1UE6A 4KV6A 3S16B 2B2VC 3U50C 3T4AC 3PCOB 4A75A 1PYBA 3SGIA 3AQQA 4JI6Q 1WTHA 4AYBE 4RHSA 2K04A 4IJHA 3E5SA 5EAYA 1D1KA 4HEA1 2IL8A 1IXRA 3MXNB 1HH2P 5CR3A 1ICFB 1DYQA 1VMPA 2RLDA 3FC3A 1J5EQ 4H7BA 2LMCB 3F2UA 1XTDA 1PXUA 5FUVA 3VYRA 4HR7B 4NXMQ 4LFAQ 2VW9A 5M3FH 1PZKD 2L5TA 1NJIC 4OX9L 3UEJA 4ULLA 2KCXA 2PQAA 2ZXOA 3NBHB 1KQSA 1PV4A 2F0VA 4OX9Q 4OWTB 1GUSA 1TWAH 1SNQA 2F3VA 3S1MH 1PH1A 1IKMA 2N1AB 3S1RB 1X55A 4AYBB 1K8GA 2ARPF 4RFBA 1VDZA 3HOVG 5E4WC 2V1CC 4X64Q 2X6GA 4O2DA 2ZJPA 1XNRL 1PFNA 3KDFA 2DNCA 4A3KB 4RA8A 1CGJI 2ENNA 1OXVA 3TRZA 3K5NA 3K6OA 2SGPI 2EYFA 3TS2A 4HCSA 3MHBA 4DR7L 1Q9BA 3U9OA 3W1GA 3GDEA 4BA1I 1M8CA 2XRCA 3VR5A 1PH3A 3GTPH 3CU7A 2B8TA 5I6YA 2HCCA 2NU1I 4YWLA 3HOVH 4DR7Q 4QF4A 2OD1A 3A55A 2MUYA 2RBMA 4G7ZC 5E3PA 1TS3A 4C3IG 1SRUA 4DV3L 1M4VA 2QCPX 4A3DG 2BOSA 3HP3A 3SK6A 5JJLA 2Q8IB 2CH4W 7WGAA 5EBCA 2VNUD 3MFYA 4DV3Q 2CQOA 3FVQA 4A3IB 3AMUA 1C9OA 1IBKQ 4B08A 1RODA 4GNXB 1HTLD 5DAUA 2IT1A 1LT5D 5I4DA 2ICIA 1DM0B 2JA1A 2YFAA 4IALA 1HA5A 1O7LA 3IFDA 2VY3A 4PMCA 3GTKH 4C3IH 3D4WA 3VA5A 2OWOA 1CUKA 1ET9A 1UE7A 4FF4A 4A3DH 4F7XA 2K03A 4AQYQ 1Y1VG 4HIMA 4YCUA 5IGCA 1UUPA 2XRQD 1Y8OB 4MTKA 1PTQA 2H4OA 3OL0A 3U4ZA 4YZDA 5HGQA 1TUSA 4P2CB 5CBEE 1LR8A 1S40A 4A3GG 4C1NI 1XYIA 1GOZA 1N36Q 2DN8A 4CGYB 5JEAG 3S15B 4QJFA 5EX0A 3RUZA 1E22A 3ITPA 3CCMA 4LFBL 2WIIB 4C3HB 2O2LD 4MHEA 1PFBA 4H0LC 2ZM6Q 4HMJA 1IBLL 1G6PA 1PH2A 5G3LD 4DA2A 2EYOA 2J87A 2K19A 3R5DA 1Y1VH 2KEEA 2ZTEA 3LWUA 2RIJA 1B3QA 3CW2C 1AEXA 3KBGA 3I91A 1PFMA 4KY7A 3H3VI 2B63B 1WKXA 2HD3A 2FHTA 3AEVA 4BY1G 4DR4L 4OO1H 1Z7KB 4OIJA 1SSOA 2PO4A 2WACA 1IHZA 4A3GH 3R5BA 1NY4A 2AHOB 1W2BA 1X3FA 3TO7A 5IP7H 3OMGA 5JEAH 4ID6A 2F0UA 4DR4Q 3KLSX 4JC0A 1Q82C 2K7VA 1RDPD 5C4JB 4KI0A 2R7ZB 3I8ZA 3J81E 3KJOA 3DLLA 3S17H 1ENFA 4EGVA 4UY8C 1SROA 4BY7G 1BOSA 4O0AA 3K81C 4UP9A 4IO9A 4BY1H 5D3IB 3MAQA 3C2PA 2F0PA 2SEBD 1CFMA 1PTOF 1X9NA 3HG9A 2Q8TA 5LMNQ 2NB0A 3NEMA 5BN3A 3JAME 4EX5A 4IN3A 4KMUC 2F0JA 1N32Q 3TZUA 2LB7A 2HDMA 1K0RA 1WJJA 3OVOA 1A2TA 1HFNA 3MWYW 3E0JA 4BY7H 4OAUC 2FINB 4DF7A 2IJ0A 1FD7D 1K9MC 1QZHA 4RGOS 2EZVA 1QJOA 2RCNA 4KD4A 1BKBA 2PW5A 3TOBA 3SDZA 3FMCA 4OEMB 1WTXA 2F4VQ 2WCYA 2JA6B 4GXTA 4DV1L 3GTLH 1Y8FA 4YZ9A 5HQ8A 3NE5B 1PH7A 2I5HA 3LGJA 4OIKA 3P20A 1D7QA 5CYUA 5M3FB 1HZCA 2P5ZX 3KF8A 5CV8A 5M5WH 1G291 2D5DA 2XMXA 2K5WA 2N71A 1I4GA 2ODDA 4CKEA 4GI3C 1LT6D 2UUCQ 1CQVA 1S72A 3T53B 4X62L 1N13A 1EYAA 2LEOA 1O80A 5CORA 2V4DA 4JV5L 2KECA 2Z8LA 4H13C 3J80c 3KY9A 5EKKA 1TWGB 2PPBC 4KTAA 1SYBA 5FUWA 1AZQA 3OIPA 2DY8A 3UDGA 5GROA 2ZTCA 2MNAA 3J81L 5JJKA 3L7ZC 1BCPB 3GP7A 3PF4A 2QDBA 1EWCA 3J7AF 1MGSA 3OWEB 5IYDG 5AFWA 1OO9B 5C0XI 1PZJD 1PPFI 4KJOA 1MIUA 1B50A 3ZJYC 1W6JA 2A8VA 4NV5A 1TKWB 1LV9A 1FYBA 1EFWA 4KN7C 3VR2A 5FKAC 3JAML 2EPBA 4O1NA 1XMQL 3U58A 5COYA 1LTRD 4TQUS 1GHKA 1RHPA 2CH4A 3A7AB 3HOVB 5M9OA 3BZKA 2OQ0A 2SGEI 3G6JB 4GOPA 2AWOA 1XMQQ 3H09A 1D1IA 4JBKA 1FGUA 3HFZB 1TOTA 2EYLA 5FLMH 2GN5A 5DEHA 1KIXA 4FO2A 1HR0W 3QG1A 4JOIC 2ATWA 3BDOA 5BN4A 2Y0SG 5E3RA 4IUUA 3NUCA 5J22A 4QMGA 1LT4D 1BBXC 2NVXB 2Q8RE 4EQNA 3IAYA 5LMUL 1JWUD 4Y7NB 3OYYA 1LTTD 4S3SA 1YI2A 3KYHC 2Z6KC 4MN3A 5IOCA 1I3QB 2VQFL 5LMUQ 3G4SA 3M4OH 2B2VA 3GTKB 4C3IB 3BYTB 2MPMA 4DU9A 2EXZA 4K5VA 1IW7C 5I9OA 1QVFA 2VQFQ 1F77A 3CQZH 4LF9Q 1OXUA 4ZLTF 4IPDA 3HOYG 1O7YA 4DKAC 3HS0C 1ML0D 2YTXA 1T5XD 5FK9C 3A8KE 9WGAA 1KD1C 4XT3B 1S5DD 2Z0SA 1I94L 3GTGH 1L2FA 4RH6A 1C8CA 1TWFH 3SEBA 2F3WA 3AFQA 4KHVA 1S4ZA 2P22B 4YWMA 5CCLA 2BDNA 2IX3A 2OVOA 5CV4A 1CKOA 4IUVA 1LLRD 3X3MA 1SYCA 2KCMA 2HT1A 4DR1L 1LO5D 2UU9Q 1PH6A 1SGPI 1EL0A 3SEKC 1JCKB 1X3QA 3SE0A 2NVTB 4NXNL 2KUMA 3HGBA 2JEBI 4DR1Q 3GTMH 2NU3I 2A2CA 3WOFA 2XGTA 4NXNQ 3J81i 3F1ZA 1EZ8A 1ULKA 1XTCD 5K36H 1HUNA 2V1CA 3KLSA 5IGDA 2BA0A 3KJPA 2ROWA 3GTJB 1XX8A 5EJWA 1H9MA 4WP4A 1SJ8A 4XXEA 1SYDA 5JHWC 2MP1A 1LACA 4RAUC 4BY1B 3JAMi 1JQOA 2F03A 2WKCA 4DV4L 3OW7A 1SMXA 4A3CH 3H0GH 1O7ZA 1L0XB 3OTOL 1LTLA 2VXWA 4QIWE 4OELB 3FPPA 1ICWA 3TP5A 2B2UC 1U4MA 1K83H 3OTOQ 1M8BA 4DNRB 2FFKB 2QGMA 4R1JA 4AYBG 4DV0L 3PQIA 3DA3A 3STBD 4A3KG 5M5YH 1V1HA 1WOCA 1STNA 3LWEA 2PW7A 3BVGA 4KHZA 4UXIA 4YCWA 1U5KA 4DUZL 4KKTA 1DJRD 1RL2A 2WB1E 4DV5Q 1FY7A 4YY3L 2CWHA 3F4MA 3D3RA 4KLKA 2N78A 5IWAL 5DLQE 3S1RH 2F0HA 4CDEC 1HNZL 4LF7L 2GKRI 1LTGD 3RLNA 2OTJA 4V190 5G3LF 4YY3Q 4M8AA 1C7YA 2YFBA 2RDFA 3E0EA 5IWAQ 3DM3A 1CHQD 4NV2A 4QIWB 4JI7L 4GKJQ 4KN4C 1MJAA 2LFNA 1XJVA 2IX0A 3BDLA 4N9PA 4RG1A 4HMIA 3SHLA 4JK1C 2XTIA 4JI7Q 1CGII 2Z4HA 2ID0A 4A3IG 4JI1Q 3PUWA 4ZCKA 3WDNA 1JWMD 1VQNA 4FF3A 4K8IA 5J8CA 2X3TA 1VQ4A 4K0KL 1PVOA 2QGQA 1HQMC 1UUCA 1UVFA 1WVLA 4UAIA 5CBAE 4FYDA 2VUMB 3URYA 1BBWA 1A63A 2QW7A 1M1KC 1M90C 3DA4A 2WB1B 1UAPA 3KLRA 5D65A 4K2LA 4HIKA 4DR3L 4XQJA 1EIGA 2CWAA 3J80E 4EQ5A 1I4RA 1NBWA 2KHJA 3K0YA 1GXDC 3IKJA 1SGEI 4DR3Q 2RDGA 4A3IH 2ERWA 4KHPL 5IYBH 1H9RA 1DS2I 1PH9A 4GKKQ 3UE0A 3TO9A 1PMRA 2JA5B 2NU0I 2K5NA 1WD0A 4JI4L 4K2KA 1TXYA 1MD2D 2HGKA 2F66B 1VCIA 1Y8PB 3BU2A 2QQ0A 4DPGA 2KMPA 3W3AA 2OCEA 4C3HG 4WFN3 2EOTA 1PTOH 1BF4A 2M2LA 2CCZA 4C1NK 3M4YA 1DOLA 1ILPA 3RLFA 1ZKOA 5IT9E 3BVMA 3NTIA 4QB4A 2E5RA 5DAEA 1LUZA 1SEBD 2JP1A 1SE4A 1R9TH 2GKTI 4XYOA 1BVSA 4ZRZA 3SK5A 2B2YC 1EFID 1YNND 4R8IA 2KCNA 1VQJA 1AE2A 1KNAA 1H9SA 3EIVA 2KHSA 2I0QA 3D6WA 3S15H 3PO3B 4LF4L 2F4IA 5ELOA 2QQCA 3NSWA 1UVGA 4C3HH 2R7ZG 5GAHC 1VQKA 1I4XA 1EY9A 3CCEA 3T1HQ 3TO6A 2W0TA 2EYMA 1SMYD 4GNXC 2UXCQ 1SXTA 1FNUA 1E2WA 4LF8Q 4HCEA 3Q23A 3JC66 1XA6A 1HJPA 1F2MA 5BR8Q 2NVQB 1ZYRD 4PZ7A 1N8RC 2UXBL 4RCNA 1VQGA 4RGNA 2BL7A 2N55A 1TGSI 3D4RA 3PIOA 1EIYB 1K8OA 5C4JH 5I2XA 5DNFA 4QCLA 1TWFB 1YNNC 2E74C 3UOEA 1NE3A 1X32A 1CKNA 3U9SA 1MJCA 1V1PB 4QUCA 4X3KA 2BCOA 4GOPC 1BUVT 5J1ZA 5L37A 4B3ML 2JA9A 1LR9A 2AWNA 2I5MX 2XN9C 2D2CC 4HSVA 3J80L 1V9PA 3G6EA 2F0EA 2NN6I 4K5XA 1WFQA 2JA6G 1JE4A 4RCOA 1MSHA 4YCVA 2F0GA 4L5TA 4DAYA 1GD7A 4CJ0B 1KBEA 2FXQA 2L9HA 4K5WA 4C3JB 1HZ9A 1VQMA 4JI6L 4M1UB 4N8FA 4PMWA 1QE6A 5M3FG 1DS3I 1B53A 2GKVA 4MPIA 4X3SA 1WTRA 3A54A 1I4PA 3H3VH 4NKLA 1J5EL 5IT9L 1RFHA 2QA4A 4LNQA 4IQZA 3H0GB 2JA6H 1HZBA 4NP5A 1Y8NB 1AZPA 2DY7A 1BBUA 1CZGA 2BDOA 4UDUC 4LFAL 2BL8A 4NXML 2EVBA 5M5XH 3TP7A 3Q8DA 1K83B 2WGCA 2L55A 1S5ED 2LS01 4UHVA 4FXGC 3CF5A 3QAHA 5M3MH 2D0OA 3PUXA 1PFSA 1YNXA 5M5YB 4A93B 4WORA 3VDYA 3GTOB 4ME5A 4JOIA 5LL6X 3T56B 1PLFA 4PG3A 1SGDI 3F2DA 1F9PA 4X64L 1TS2A 5EQ0A 2FMMA 4DAMA 1IBMQ 1TWGH 1YHBA 2PI2A 2Z6KA 4RKLA 3CRKC 4IUQA 3M7GA 3BDCA 1EWHA 1X6OA 2JB3A 1RCVD 2EQSA 2C35B 2OZUA 1I4HA 4IFDI 1STBA 4Q9VA 3B6YA 3C1EA 3RZOH 1KC8C 3CXLA 3RN5A 1GUTA 2QF7A 4PZ8A 3H15A 5F2DA 4XDXA 1KTKA 5IGBA 3PSIA 1Y1BA 2M5XA 1CK1A 1VQ8A 3E3XA 1EY8A 3UE1A 2DJFC 1IY5A 3CMAA 1CSPA 2VL6A 4FF1A 3J80i 3BJUA 4IUPA 4L9MA 1SNOA 2RF4A 4X66Q 3G7LA 1IBKL 4ALPA 1Z6HA 1TU2B 1QWYA 2R7FA 4G76A 4KY5A 2FMCA 2BUSA 1Q8IA 3CAMA 1JJGA 5CV9A 1UEBA 2NVXH 2Z6BA 4HIOA 1Q90A 4Y7NH 3I7FA 5ELNA 5ELFA 4LUOA 1MKHA 5LNK1 1TWCB 2QEXA 2K01A 4LFCQ 4AQYL 2V6EA 1I3QH 4L6TB 1HCZA 2SGDI 4XYQA 4QY7A 3FDTA 1I4QA 3AU7A 1PTOB 4RWSC 1X54A 2I5LX 1VQBA 3MVVA 1PRTB 2WP8J 3K80C 2CW0C 2A68D 3ND8A 1UEAB 1G6ZA 1LABA 4DGZA 3S2DH 1N36L 2A5HA 4I7ZC 2KHIA 3A8IE 4GLVB 1AN8A 3WOEA 4OO1G 1B2TA 1R9TB 1PJUA 2EXDA 3L0OA 1BQQT 4POFA 4OWWB 4A3BH 3R5CA 3NWSA 4A3FH 2B2UA 1R4QB 2ZM6L 4POGA 5IP7G 2L4NA 2DNEA 1WCMB 2L1BA 2N88A 1GO3E 3BVZA 5EGTA 5FLXc 3BZCA 2B8GA 2UUBQ 4FVMA 2HQEA 3J7ZC 2I46A 3QOJA 5E1FA 1LTID 2HUGA 2GVAA 1JT8A 2JK8A 2FU2A 1R79A 4DK1A 3PIPA 2NVTH 2HQLA 3KLWA 1ONLA 3K8AA 1A8VA 1FARA 3SGQI 5KIXA 3VYTA 5EKLA 2A68C 1B70B 1AW7A 3H94A
chains in the Genus database with same CATH topology
1VQOA 5GAGC 1CT2I 3RR5A 2VQEQ 3GTQH 3RN2A 3TJQA 2HIXA 3F2CA 5HGIA 3GTJH 1IY6A 2V53A 4R4IA 1TBQR 1YIJA 3CC4A 2F3CI 3GD7A 2OQKA 5LMNL 1U0LA 1N32L 2N3SA 4UP7A 2JAEA 2YV5A 2ZJRA 3W5OA 3I9V1 4GN5A 1H95A 3T1YQ 1SGQI 2GVBA 3QWPA 3CC2A 4QGUA 3FKIH 5C44G 1MT1A 1V1IA 2F3IA 2F4VL 2A1AA 2F52A 2B3GA 2P6AC 1AH9A 5GAEC 3I4OA 1KAWA 4BBRG 4P72A 2VUMG 4RMFA 1X4SA 4WJ4A 2UXDQ 4DV6L 4MNOA 1PCEA 2WB1G 5C44H 2UUCL 3CCLA 4DV6Q 4NB3A 3CPFA 2UUAL 2VRWB 2LSSA 1SFOH 1CHOI 4BBRH 2JA5G 2MFIA 2VUMH 4APVA 3PF5A 4BA2I 2JYYA 4DV2Q 2UUAQ 1SGNI 4R4QA 3EBEA 4GNXA 4O1OA 4A4IA 5IYCG 4DR2L 1QZGA 5FLMG 2E2JH 1GM5A 4AS2A 2JB2A 1SE8A 2JZMA 4DR2Q 2JA5H 2IP6A 3AYHB 4NPSA 3PO3G 2BH2A 5IT9c 4HJ9A 1QUQB 4B3TL 1TIHA 3ULJA 1P16A 4MTNA 4A3EH 2ELIA 1VQ5A 5IYCH 2DGYA 4B3TQ 1KRSA 2RIOA 1X3EA 1Q46A 2WVJA 3D31A 2JJQA 3VDUA 4L5QA 2NZHA 2WAQE 3PO3H 1IW4A 4JYAL 1PH8A 1BUSA 3CC7A 4LF9L 3FHWA 1D8LA 4OO1I 4JYAQ 3ULLA 1VQAA 3UEYA 2CKZB 1PA6A 1YHQA 2NVQH 2YTVA 4Z7GA 3SGBI 1DGSA 2L7XA 2ZRRA 1VQHA 1X65A 3L0IA 2AKWB 2UU9L 3K7UC 1XPRA 5K36G 2E8GA 1L1OB 1SR3A 2KENA 4IPCA 4A3CG 3H0GG 3M7NA 3PGZA 3FP9A 2ENZA 4C3JH 1HNWQ 5J3BA 1E3PA 1HDLA 4L5SA 4AH6A 3NELA 1VQFA 1W4RA 4A93G 1XNQQ 3UFFA 1VDDA 3LJ1A 2K52A 2NU4I 2N17A 2Q2IA 2ALYB 4OWXB 4R4TA 3CMEA 2JQOA 3HH2C 1CKMA 4DV5L 4A93H 4DR5Q 3GTOH 3I2ZA 1HPTA 3ERSX 1HR0Q 4LF5L 4LW1A 4G75A 4LF5Q 4B3RQ 1YJ9A 3BJIA 4GKJL 3AFPA 3KF6B 4DAYB 4J15A 4JI1L 3UDXA 2JB1A 1PH4A 2LXKA 5CCMA 2PMZE 1Q8KA 4GN3B 2SGQI 4B6DA 4DV7L 4GLAC 3A0JA 3S1NH 5IYBG 5IE8A 4X65Q 4DV7Q 4E1PA 3UGDA 1NTGA 1XMOL 2OTLA 3OXLA 3E2IA 4GKKL 1HJAI 2HHHQ 1XMOQ 1H0ZA 3UGLA 2PQAB 2BH8A 1E1OA 1ASZA 2N52A 1OYVI 1TWCH 2R6GA 1WCMG 3KP9A 1LR7A 1OTCA 3CCJA 4JI2L 4IOCA 4A3JH 1T9HA 3PUVA 4O1PA 3KDFB 4JI2Q 1VS0A 3T1HL 2R92G 1WCMH 5JJIA 3IAM1 5E7NA 1KMAA 1FJGQ 1TBOA 2UXCL 4DUYL 4PL5A 4X6AH 1N33Q 4LF8L 1J6QA 4AIMA 5BR8L 1Y14B 4DUYQ 4HFVA 1NMFA 3M85A 2YUUA 2JEAI 3I4NG 1R0RI 1UE1A 2R92H 1NMGA 1WI5A 1TWHH 1VQCA 1IZ6A 1OMTA 1VQIA 3TEHB 1YJNA 5C3EG 2YYZA 3KFUA 1Q1EA 4LF6Q 2KCTA 3ER0A 2K14A 1KHIA 3HOXG 3I4NH 3F8TA 4XTCS 3M3YH 4P74A 1VQ9A 3PO2G 3RLOA 3PDNA 4WJ3M 1PH5A 2JA7H 5C3EH 1I6HH 2QQEA 1LYLA 5HI7A 5M3MG 2ORVA 3HOXH 3QTLD 1O7IA 3KOJA 1MJEA 1Q12A 3PO2H 1AE3A 1VQ7A 3PV0A 3PUZA 2ES2A 4JI3Q 1SLJA 3IAS1 1N9WA 2A20A 2Q2HA 1XBTA 1JJCB 1IBML 4AS3A 4HJ7A 2VZAA 4IFDJ 1EYGA 1E7ZA 3LJ0A 2IHFA 3RNUA 1K3RA 1CSQA 1JMCA 1W3SA 2BA1A 5FJ8G 4X66L 4TVAB 3RZDH 1E1TA 1XNRQ 1FVIA 3TQYA 2F6MB 5H1SE 5LMNW 2B29A 3KF8B 4FKDA 4JBWA 4LFCL 2H5XA 4YWKA 5C0XG 2B0UC 2QPOA 4A24A 4A3BG 1FL0A 3SDJA 5FJ8H 4A3FG 2K5VA 1TBNA 1S3OA 1JB7A 2GVIA 3VDPA 2E73A 4JI0L 4HIDA 1Q7YC 2WAQG 1QVGA 4HGUA 1Y1WG 4JI0Q 1YBYA 3CCSA 2UUBL 4QQBX 3B4VC 2L15A 2JA8G 1IYJB 2XTRA 3MEFA 2YTYA 2KBNA 1N34L 4IPHA 1EWIA 2CFMA 1Y1WH 4OVOA 1LM0A 4DNIA 4ME3A 1GKHA 3E9IA 1ASYA 1SGRI 1X56A 1N34Q 4GOPB 3J81j 2VQEL 4Z7HA 2JA8H 1YO7A 2L1LB 2DUDA 3CCRA 4YHHL 4H02A 4JBJA 3WWVA 1IL2A 3NENA 2NU2I 4JI5L 4R4OA 4YHHQ 4LFBQ 1IBLQ 5GQOA 4I1TA 3FKIG 3HKSA 4JI5Q 3M9BA 2R7DA 1PTRA 2RHSB 2IHEA 3T1YL 2CAZB 2SGFI 4Y52H 4OONA 1B8AA 1CSOI 1KXLA 1L1OC 3I56A 5IY0A 2NZOA 4A3LG 3HOUG 4GS3A 2WFWA 4E1RA 3A5UA 1YEZA 4DK6C 1TURA 1FAQA 1KRTA 4LUZA 1YZ6A 2Q2TA 3D00A 2Q2UA 4U6RA 3HKZE 2AMCB 4PL4A 1I5FA 1OXXK 2N8NA 4GLXA 5GADC 1Y1CA 2UXDL 2D0PA 3K7AH 4SGBI 4A3LH 3HOUH 3GOXA 2DIPA 3JSBA 5FUXA 1A62A 4R4CA 3U4VA 4FDBA 4GN4B 4PL3A 2ASBA 4P73A 4DV2L 3M4QA 1YTPA 4LWCA 2A19A 4DV1Q 3K0XA 4IJLA 1L0WA 3CXCA 5C0XJ 2R93G 4HJAA 2E2IH 3S2HH 4UP8A 4A3EG 2XTQA 3UDFA 4IOAA 1GVPA 3S1QH 4P71A 4BBSG 4X62Q 2VS1A 4JV5Q 1OXTA 3PUYA 1KBFA 2R93H 2DB6A 1XPOA 1PYSB 4XIGS 3LJ2A 5FUYA 1P8LA 4BBSH 3CD6A 1EOVA 5C4XG 3HOWG 1V43A 1V1QA 1HNXL 3L2PA 2K5HA 1QVCA 5JEAJ 1XPUA 4A3MG 4UXHA 5IYDH 2K75A 1HNXQ 1YJWA 2A2DA 4DK3C 1Q86C 4BXXG 2CWPA 1EIFA 5C4XH 2UZ3A 3OXGA 2ZJQA 1YITA 3HOWH 2E2HH 4A76A 2NVYH 4P75A 3E9HA 4A3MH 1VQDA 4MZ9A 1I50H 2KKMA 3I4MG 3ICEA 4BXXH 2N49A 4L5RC 4OAVB 1G51A 3D0FA 1HNWL 3P23A 3CCVA 1I94Q 1A0IA 2K50A 3AJFA 2FNFX 3FBVA 1BMOA 3HOYH 1XNQL 3I4MH 3S14H 4UXJA 4JI8L 4JBMA 3CPWA 5AJ3L 1X74A 1SGYI 4JI8Q 2J9RA 2E5LL 2CJSC 2NN6G 5AJ3Q 1Z47A 3A5ZB 4OXPA 3CCQA 2E5LQ 3S16H 4DR5L 1K73C 3UITA 1HR0L 1XX6A 2LXJA 1JJ2A 3G71A 1HZAA 1CKNB 2D62A 1Z9FA 4B3RL 4DV4Q 3J7A5 2IX1A 1CT0I 2HIVA 1PHJA 1C0AA 3DO9A 2L8EA 4DV0Q 1OMUA 1VQ6A 3G48A 3MEKA 4X65L 1SN8A 1QUQA 4LUVA 1YHAA 4DUZQ 2PI2E 4B3SL 3ULPA 1NUBA 1EQQA 2FUG1 4A3KH 1HNZQ 4LF7Q 4B3SQ 2HHHL 4IPGA 5HY6A 2YU9H 3STBC 2LUYA 4A3JG 1EUJA 1Q1BA 3OW2A 4IFDG 1VQEA 1VQLA 3TREA 4HJ8A 1Q81C 4K0KQ 3W1BA 1UE5A 3HOZG 3I55A 3IRBA 4C2MH 2EIFA 3TS0A 4QL5A 3A74A 3UDIA 4KHPQ 1L1OA 2KMQA 2MQHA 3EN2A 1FJGL 1B7YB 4PZ6A 3E59A 2KMOA 1YVCA 1N33L 2QQDA 5IP9G 1WYDA 4JI4Q 2Y0SE 1E24A 3CCUA 1VQPA 3RU0A 3VA9A 3HOZH 2B63G 3M4PA 1OVOA 2PNHA 1UWVA 3UGIA 2IY5B 2JE6I 3GO5A 4HJ5A 2KMRA 5IP9H 1YU6C 4JG2A 3OXFA 2JA7G 1JE5A 4LF4Q 4LF6L 4YZCA 2B63H 1CT4I 2ZTDA 4UPAA 3VE5A 3J81c 5EX3A 1K8AC 1AN1I 2JXDA 2R7ZH 2MO0A 3CP0A 2RHQB 2UXBQ 1CE3A 1TBRR 2MJFB 4DWLA 4DR6L 1KL9A 3JAMc 2JW6A 4JCVE 2YQPA 2K4KA 3S24A 4DR6Q 2MO1A 4B3MQ 3KF6A 1OXSC 3F2BA 1EQRA 2ORWA 4JI3L 3HKZG 1RIPA 1X3GA 2K9HA 1UE6A 3U50C 3PCOB 4A75A 1PYBA 3SGIA 3AQQA 4JI6Q 4AYBE 4IJHA 5EAYA 4HEA1 1IXRA 3MXNB 1HH2P 3FC3A 1J5EQ 1XTDA 5FUVA 4NXMQ 4LFAQ 2VW9A 5M3FH 4OX9L 1NJIC 3UEJA 2KCXA 2PQAA 3NBHB 1KQSA 1PV4A 4OX9Q 4OWTB 1TWAH 3S1MH 1PH1A 2N1AB 1X55A 1K8GA 2ARPF 3HOVG 2V1CC 4X64Q 4O2DA 2ZJPA 1XNRL 3KDFA 1CGJI 2ENNA 1OXVA 3TRZA 2SGPI 3TS2A 4DR7L 3W1GA 3GDEA 4BA1I 1M8CA 2XRCA 1PH3A 3GTPH 2B8TA 2NU1I 4YWLA 3HOVH 4DR7Q 2OD1A 4DV3L 1SRUA 4A3DG 5JJLA 2VNUD 4DV3Q 2CQOA 1C9OA 1IBKQ 4GNXB 2IT1A 2JA1A 2YFAA 2VY3A 3GTKH 4C3IH 2OWOA 1CUKA 1UE7A 4A3DH 4AQYQ 1Y1VG 4HIMA 4YCUA 1PTQA 3OL0A 3U4ZA 4YZDA 5HGQA 1TUSA 1LR8A 1S40A 4A3GG 1N36Q 5JEAG 4QJFA 5EX0A 1E22A 3CCMA 4LFBL 1IBLL 2ZM6Q 1G6PA 2QQ0A 1PH2A 2J87A 2K19A 1Y1VH 2ZTEA 3CW2C 3H3VI 3AEVA 4BY1G 4DR4L 1Z7KB 4A3GH 1NY4A 2AHOB 1W2BA 1X3FA 5IP7H 4DR4Q 4JC0A 1Q82C 4KI0A 3KJOA 3DLLA 3S17H 4UY8C 1SROA 4BY7G 4O0AA 3K81C 4UP9A 4IO9A 4BY1H 1X9NA 5LMNQ 3NEMA 4EX5A 1N32Q 1K0RA 1WJJA 3OVOA 4BY7H 4OAUC 1K9MC 1QZHA 2RCNA 1BKBA 2F4VQ 2WCYA 3GTLH 4GXTA 4DV1L 1Y8FA 4YZ9A 5HQ8A 1PH7A 2I5HA 3LGJA 1D7QA 1HZCA 5M5WH 1G291 2XMXA 2N71A 2ODDA 4GI3C 2UUCQ 1S72A 4X62L 1N13A 2LEOA 4JV5L 3J80c 3KY9A 5FUWA 3UDGA 5GROA 2ZTCA 2MNAA 5JJKA 3L7ZC 3PF4A 5IYDG 5C0XI 1PPFI 1MIUA 3ZJYC 2A8VA 4NV5A 1FYBA 1EFWA 1XMQL 3U58A 4TQUS 3BZKA 2OQ0A 2SGEI 4GOPA 2AWOA 1XMQQ 4JBKA 1FGUA 3HFZB 1TOTA 5FLMH 2GN5A 1KIXA 1HR0W 4JOIC 2ATWA 2Y0SG 5LMUL 3OYYA 1YI2A 3KYHC 2Z6KC 2VQFL 5LMUQ 3G4SA 3M4OH 1QVFA 2VQFQ 3CQZH 4LF9Q 1OXUA 4IPDA 3HOYG 4DKAC 2YTXA 1KD1C 2Z0SA 1I94L 3GTGH 1L2FA 1TWFH 3AFQA 2P22B 4YWMA 5CCLA 2OVOA 1CKOA 2KCMA 2HT1A 4DR1L 2UU9Q 1PH6A 1SGPI 3SEKC 4NXNL 2JEBI 4DR1Q 3GTMH 2NU3I 2A2CA 2XGTA 4NXNQ 3J81i 3F1ZA 2V1CA 2BA0A 3KJPA 2ROWA 1SJ8A 5JHWC 3JAMi 4DV4L 1SMXA 4A3CH 3H0GH 3OTOL 1LTLA 4QIWE 1K83H 3OTOQ 1M8BA 4R1JA 4AYBG 4DV0L 3DA3A 3STBD 4A3KG 5M5YH 1V1HA 1WOCA 4KHZA 4UXIA 4YCWA 1U5KA 4DUZL 4DV5Q 1RL2A 2WB1E 4YY3L 3F4MA 4KLKA 2N78A 5IWAL 5DLQE 3S1RH 1HNZL 4LF7L 2GKRI 3RLNA 2OTJA 4YY3Q 1C7YA 2YFBA 3E0EA 5IWAQ 3DM3A 4NV2A 4JI7L 4GKJQ 1XJVA 2IX0A 4RG1A 2XTIA 4JI7Q 1CGII 2ID0A 4A3IG 4JI1Q 3PUWA 1VQNA 1VQ4A 4K0KL 1PVOA 2QGQA 1UUCA 1UVFA 1BBWA 1A63A 1M1KC 1M90C 3DA4A 4HIKA 4DR3L 2CWAA 4EQ5A 1NBWA 2KHJA 1SGEI 4DR3Q 4A3IH 2ERWA 4KHPL 5IYBH 1DS2I 1PH9A 4GKKQ 3UE0A 2NU0I 2K5NA 4JI4L 1TXYA 1VCIA 2F66B 3BU2A 4DPGA 2KMPA 2OCEA 2CCZA 3RLFA 2E5RA 5DAEA 1LUZA 1R9TH 2GKTI 1BVSA 1VQJA 1AE2A 3EIVA 2I0QA 3S15H 4LF4L 5ELOA 2QQCA 1UVGA 4C3HH 2R7ZG 5GAHC 1VQKA 3CCEA 3T1HQ 2W0TA 4GNXC 2UXCQ 4LF8Q 3JC66 1XA6A 1HJPA 5BR8Q 4PZ7A 1N8RC 2UXBL 1VQGA 1TGSI 3PIOA 1EIYB 5C4JH 1NE3A 1CKNA 1MJCA 4GOPC 4B3ML 2JA9A 1LR9A 2AWNA 2I5MX 1V9PA 3G6EA 2NN6I 1WFQA 2JA6G 4YCVA 4L5TA 1GD7A 1KBEA 2FXQA 1VQMA 1HZ9A 4JI6L 4PMWA 5M3FG 2GKVA 1DS3I 3H3VH 1J5EL 1RFHA 2QA4A 4LNQA 2JA6H 1HZBA 1BBUA 4NXML 4LFAL 5M5XH 3Q8DA 3CF5A 5M3MH 2D0OA 3PUXA 1PFSA 1YNXA 3VDYA 4JOIA 4PG3A 1SGDI 3F2DA 4X64L 4DAMA 1IBMQ 1TWGH 1YHBA 2PI2A 2Z6KA 1X6OA 2JB3A 2EQSA 2C35B 4IFDI 4Q9VA 3B6YA 3RZOH 1KC8C 3CXLA 3RN5A 4PZ8A 3H15A 1Y1BA 3PSIA 2M5XA 1VQ8A 3UE1A 1IY5A 3CMAA 1CSPA 2VL6A 3J80i 3BJUA 4L9MA 2RF4A 4X66Q 1IBKL 4ALPA 2R7FA 4G76A 2BUSA 3CAMA 1JJGA 1UEBA 2NVXH 4HIOA 4Y7NH 3I7FA 5ELNA 4LUOA 1MKHA 5LNK1 2QEXA 4LFCQ 4AQYL 2V6EA 1I3QH 2SGDI 4QY7A 1X54A 2I5LX 1VQBA 2WP8J 3K80C 3S2DH 1N36L 2KHIA 4GLVB 4OO1G 1PJUA 2EXDA 3L0OA 4POFA 4A3BH 4OWWB 4A3FH 2ZM6L 4POGA 5IP7G 1GO3E 5FLXc 3BZCA 2UUBQ 3J7ZC 2GVAA 1JT8A 2JK8A 1R79A 3PIPA 2NVTH 2HQLA 3KLWA 3K8AA 1A8VA 1FARA 3SGQI 1B70B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO A;  5GAG C;  5HY6 A;  1HR0 W;  2YU9 H;  4JOI C;  2ATW A;  3RR5 A;  2Y0S G;  2ES2 A;  3STB C;  2VQE Q;  3GTQ H;  3RN2 A;  4A3J G;  5LMU L;  4JI3 Q;  2HIX A;  1EUJ A;  3F2C A;  1SLJ A;  3OYY A;  1Q1B A;  3GTJ H;  3OW2 A;  1YI2 A;  1N9W A;  4R4I A;  4IFD G;  2Q2H A;  3KYH C;  2Z6K C;  1YIJ A;  3CC4 A;  3GD7 A;  2OQK A;  5LMN L;  2VQF L;  5LMU Q;  3G4S A;  1U0L A;  1JJC B;  1IBM L;  1VQE A;  3M4O H;  1VQL A;  1N32 L;  2N3S A;  3TRE A;  4UP7 A;  4HJ8 A;  1Q81 C;  4K0K Q;  4HJ7 A;  2YV5 A;  2VZA A;  1QVF A;  2VQF Q;  3CQZ H;  4LF9 Q;  1OXU A;  2ZJR A;  4IPD A;  3HOY G;  4IFD J;  4DKA C;  3W5O A;  1EYG A;  4GN5 A;  1H95 A;  2YTX A;  1E7Z A;  3W1B A;  1UE5 A;  3HOZ G;  3T1Y Q;  3I55 A;  2GVB A;  1KD1 C;  3IRB A;  2Z0S A;  1I94 L;  2IHF A;  3GTG H;  3RNU A;  4C2M H;  1K3R A;  1L2F A;  2EIF A;  4QL5 A;  3TS0 A;  1TWF H;  3CC2 A;  3A74 A;  4QGU A;  3UDI A;  3FKI H;  3AFQ A;  5C44 G;  4YWM A;  1CSQ A;  1L1O A;  4KHP Q;  2F3I A;  2MQH A;  3EN2 A;  1FJG L;  1JMC A;  1B7Y B;  4PZ6 A;  2F4V L;  1YVC A;  2A1A A;  1W3S A;  1N33 L;  1CKO A;  2F52 A;  5IP9 G;  2B3G A;  1WYD A;  2KCM A;  4DR1 L;  2HT1 A;  1AH9 A;  4JI4 Q;  2UU9 Q;  2Y0S E;  1PH6 A;  1E24 A;  5GAE C;  2BA1 A;  3I4O A;  3CCU A;  5FJ8 G;  1KAW A;  4X66 L;  4NXN L;  1VQP A;  3HOZ H;  2JEB I;  2B63 G;  3M4P A;  4BBR G;  4DR1 Q;  4P72 A;  3GTM H;  2VUM G;  4TVA B;  4RMF A;  4WJ4 A;  2PNH A;  2XGT A;  3RZD H;  2UXD Q;  4NXN Q;  1E1T A;  3J81 i;  4DV6 L;  4MNO A;  1XNR Q;  3F1Z A;  1FVI A;  1UWV A;  2WB1 G;  5C44 H;  3TQY A;  2UUC L;  3CCL A;  2IY5 B;  5H1S E;  2JE6 I;  3GO5 A;  5LMN W;  4HJ5 A;  2B29 A;  3KF8 B;  2BA0 A;  3KJP A;  5IP9 H;  4JBW A;  4DV6 Q;  4NB3 A;  4LFC L;  3CPF A;  2H5X A;  4YWK A;  4JG2 A;  5C0X G;  4A3B G;  1FL0 A;  5FJ8 H;  2UUA L;  4A3F G;  2JA7 G;  1JE5 A;  4LF4 Q;  3JAM i;  2LSS A;  1SFO H;  4DV4 L;  4LF6 L;  1SMX A;  2K5V A;  4BBR H;  3H0G H;  2B63 H;  4A3C H;  3OTO L;  2JA5 G;  1LTL A;  1S3O A;  1JB7 A;  2MFI A;  2VUM H;  4APV A;  3PF5 A;  4BA2 I;  4DV2 Q;  4JI0 L;  4QIW E;  4HID A;  2ZTD A;  1Q7Y C;  2UUA Q;  4R4Q A;  2WAQ G;  4UPA A;  1QVG A;  1K83 H;  3EBE A;  3J81 c;  1Y1W G;  3OTO Q;  1K8A C;  4JI0 Q;  4R1J A;  4AYB G;  4DV0 L;  4GNX A;  1YBY A;  4A4I A;  2R7Z H;  2MO0 A;  3STB D;  5IYC G;  4DR2 L;  3CP0 A;  2RHQ B;  1QZG A;  2UXB Q;  4A3K G;  3CCS A;  5FLM G;  2E2J H;  2UUB L;  5M5Y H;  4QQB X;  1WOC A;  1GM5 A;  2L15 A;  2JA8 G;  4KHZ A;  4DR6 L;  1IYJ B;  1KL9 A;  1SE8 A;  3JAM c;  4YCW A;  4JCV E;  4DR2 Q;  2JA5 H;  3MEF A;  1U5K A;  2YTY A;  4DUZ L;  3AYH B;  4NPS A;  1RL2 A;  2WB1 E;  4DV5 Q;  2KBN A;  2K4K A;  4YY3 L;  3PO3 G;  3S24 A;  1N34 L;  4KLK A;  5IT9 c;  2N78 A;  5IWA L;  2MO1 A;  1EWI A;  2CFM A;  4IPH A;  5DLQ E;  4HJ9 A;  3S1R H;  1QUQ B;  1Y1W H;  1LM0 A;  4DNI A;  4ME3 A;  1HNZ L;  4B3T L;  1GKH A;  3E9I A;  3ULJ A;  1ASY A;  4B3M Q;  4LF7 L;  3RLN A;  1P16 A;  3KF6 A;  2OTJ A;  4MTN A;  4YY3 Q;  4A3E H;  1C7Y A;  3E0E A;  1X56 A;  1N34 Q;  4GOP B;  5IWA Q;  1VQ5 A;  1OXS C;  3DM3 A;  5IYC H;  3J81 j;  2DGY A;  3F2B A;  4B3T Q;  2VQE L;  1EQR A;  1KRS A;  4JI7 L;  4GKJ Q;  1X3E A;  1Q46 A;  4JI3 L;  3HKZ G;  2JA8 H;  1RIP A;  3D31 A;  1XJV A;  2IX0 A;  1X3G A;  2DUD A;  2JJQ A;  4RG1 A;  4L5Q A;  1UE6 A;  3CCR A;  2NZH A;  4YHH L;  2XTI A;  4JI7 Q;  2WAQ E;  4H02 A;  3U50 C;  2ID0 A;  3PO3 H;  4JBJ A;  3WWV A;  3PCO B;  4A3I G;  4JI1 Q;  1IL2 A;  4DR6 Q;  3PUW A;  3NEN A;  1PYB A;  3SGI A;  3AQQ A;  4A75 A;  1VQN A;  4JI6 Q;  4JYA L;  4JI5 L;  4AYB E;  4IJH A;  4R4O A;  4YHH Q;  5EAY A;  1VQ4 A;  1IBL Q;  1PH8 A;  4LFB Q;  5GQO A;  2QGQ A;  4K0K L;  1PVO A;  3FKI G;  1IXR A;  3MXN B;  1BBW A;  1HH2 P;  3CC7 A;  4LF9 L;  1A63 A;  3FHW A;  1D8L A;  3HKS A;  1M1K C;  4OO1 I;  1M90 C;  4JYA Q;  1J5E Q;  4JI5 Q;  3M9B A;  2R7D A;  1XTD A;  4HIK A;  2RHS B;  4DR3 L;  2IHE A;  3T1Y L;  4NXM Q;  4LFA Q;  2CWA A;  3ULL A;  4Y52 H;  1VQA A;  4OON A;  4EQ5 A;  1B8A A;  1NBW A;  2CKZ B;  2KHJ A;  2VW9 A;  5M3F H;  1L1O C;  1YHQ A;  1PA6 A;  4OX9 L;  1NJI C;  2NVQ H;  2YTV A;  1KXL A;  3I56 A;  4DR3 Q;  5IY0 A;  4A3I H;  1DGS A;  2NZO A;  2PQA A;  4A3L G;  3HOU G;  4KHP L;  3NBH B;  4GS3 A;  5IYB H;  2WFW A;  1PV4 A;  1KQS A;  3A5U A;  1YEZ A;  4DK6 C;  1PH9 A;  4GKK Q;  3UE0 A;  4OX9 Q;  4OWT B;  1KRT A;  1TWA H;  1VQH A;  1X65 A;  2K5N A;  2AKW B;  4LUZ A;  2UU9 L;  4JI4 L;  3S1M H;  1YZ6 A;  3K7U C;  1XPR A;  1PH1 A;  2Q2T A;  1L1O B;  1TXY A;  2E8G A;  2Q2U A;  5K36 G;  1VCI A;  3HKZ E;  1SR3 A;  2AMC B;  3BU2 A;  4DPG A;  1X55 A;  2OCE A;  1I5F A;  2KEN A;  1K8G A;  2CCZ A;  1OXX K;  3HOV G;  2N8N A;  4GLX A;  3RLF A;  5GAD C;  2UXD L;  2V1C C;  4X64 Q;  4O2D A;  2ZJP A;  2D0P A;  1XNR L;  3K7A H;  3KDF A;  4IPC A;  4A3C G;  3H0G G;  4A3L H;  3HOU H;  3M7N A;  1LUZ A;  1R9T H;  1BVS A;  1OXV A;  3TRZ A;  3PGZ A;  3FP9 A;  1VQJ A;  1AE2 A;  3TS2 A;  3EIV A;  2I0Q A;  4C3J H;  3S15 H;  4DR7 L;  1HNW Q;  1A62 A;  3GDE A;  4R4C A;  3U4V A;  3W1G A;  5ELO A;  5J3B A;  4BA1 I;  4LF4 L;  1E3P A;  4FDB A;  4GN4 B;  1PH3 A;  4C3H H;  2R7Z G;  5GAH C;  1VQK A;  4L5S A;  3GTP H;  3CCE A;  4AH6 A;  3T1H Q;  3NEL A;  2ASB A;  4YWL A;  3HOV H;  4DR7 Q;  4P73 A;  4DV2 L;  1VQF A;  3M4Q A;  4A93 G;  4LWC A;  4GNX C;  1XNQ Q;  2UXC Q;  2A19 A;  4DV1 Q;  4DV3 L;  1SRU A;  4LF8 Q;  3K0X A;  4A3D G;  3JC6 6;  4IJL A;  1HJP A;  1L0W A;  5BR8 Q;  3CXC A;  5JJL A;  5C0X J;  4PZ7 A;  1N8R C;  2UXB L;  2VNU D;  2K52 A;  4DV3 Q;  2CQO A;  1VQG A;  4HJA A;  2R93 G;  1C9O A;  2E2I H;  1IBK Q;  2Q2I A;  3S2H H;  4IPG A;  2ALY B;  4UP8 A;  3PIO A;  4A3E G;  1EIY B;  5C4J H;  4GNX B;  4OWX B;  4R4T A;  3CME A;  2IT1 A;  2JQO A;  1NE3 A;  1CKM A;  3UDF A;  4DV5 L;  4IOA A;  1GVP A;  4A93 H;  3S1Q H;  4DR5 Q;  1CKN A;  3GTO H;  3I2Z A;  1MJC A;  4P71 A;  2VY3 A;  4X62 Q;  3ERS X;  4GOP C;  1HR0 Q;  4BBS G;  3GTK H;  4C3I H;  2VS1 A;  2OWO A;  4B3M L;  4LF5 L;  1CUK A;  1UE7 A;  2JA9 A;  4A3D H;  4JV5 Q;  2AWN A;  2I5M X;  4LW1 A;  4AQY Q;  1Y1V G;  1OXT A;  3PUY A;  4HIM A;  1V9P A;  4YCU A;  2NN6 I;  3G6E A;  4LF5 Q;  4B3R Q;  1YJ9 A;  2R93 H;  4GKJ L;  1WFQ A;  2JA6 G;  1XPO A;  3U4Z A;  1PYS B;  3AFP A;  3KF6 B;  4YCV A;  5HGQ A;  1S40 A;  4A3G G;  4L5T A;  4XIG S;  1N36 Q;  1GD7 A;  4DAY B;  4J15 A;  5JEA G;  4JI1 L;  2FXQ A;  3UDX A;  1VQM A;  1HZ9 A;  1P8L A;  1PH4 A;  4QJF A;  2LXK A;  4JI6 L;  4BBS H;  2BH2 A;  1E22 A;  2PMZ E;  4PMW A;  5M3F G;  3CCM A;  3CD6 A;  4LFB L;  1Q8K A;  4GN3 B;  2ZM6 Q;  1IBL L;  1G6P A;  1EOV A;  5C4X G;  1PH2 A;  4DV7 L;  4GLA C;  1Y1V H;  2ZTE A;  3HOW G;  3A0J A;  1V43 A;  3S1N H;  5IYB G;  5IE8 A;  3H3V H;  3CW2 C;  1V1Q A;  1J5E L;  1HNX L;  3H3V I;  4X65 Q;  2K5H A;  3L2P A;  2QA4 A;  1QVC A;  4LNQ A;  2JA6 H;  1HZB A;  5JEA J;  4BY1 G;  3AEV A;  1XPU A;  4DR4 L;  4DV7 Q;  4A3M G;  1BBU A;  4NXM L;  4LFA L;  5IYD H;  2K75 A;  4A3G H;  1NY4 A;  2AHO B;  5M5X H;  1X3F A;  1YJW A;  1W2B A;  1HNX Q;  3Q8D A;  1NTG A;  5IP7 H;  1XMO L;  4DK3 C;  2OTL A;  1Q86 C;  4DR4 Q;  4JC0 A;  1Q82 C;  4BXX G;  3CF5 A;  4GKK L;  4KI0 A;  2HHH Q;  5M3M H;  2CWP A;  2D0O A;  1EIF A;  5C4X H;  3KJO A;  1XMO Q;  3DLL A;  2ZJQ A;  3S17 H;  3PUX A;  1YIT A;  3HOW H;  1PFS A;  2E2H H;  1YNX A;  4UY8 C;  4A76 A;  1SRO A;  2PQA B;  2BH8 A;  3VDY A;  4BY7 G;  4O0A A;  3K81 C;  2NVY H;  4JOI A;  4UP9 A;  1E1O A;  4P75 A;  1ASZ A;  3E9H A;  4IO9 A;  4BY1 H;  4A3M H;  1TWC H;  4PG3 A;  1X9N A;  2R6G A;  1WCM G;  3F2D A;  5LMN Q;  1VQD A;  4MZ9 A;  1I50 H;  3NEM A;  4X64 L;  4DAM A;  4EX5 A;  1IBM Q;  2PI2 A;  1TWG H;  1YHB A;  2Z6K A;  1OTC A;  3I4M G;  1N32 Q;  3CCJ A;  3ICE A;  4JI2 L;  1K0R A;  4BXX H;  1WJJ A;  4IOC A;  4A3J H;  2N49 A;  1T9H A;  4L5R C;  1G51 A;  3PUV A;  1X6O A;  2EQS A;  3D0F A;  3KDF B;  4JI2 Q;  2C35 B;  1HNW L;  4BY7 H;  4IFD I;  1VS0 A;  3CCV A;  1K9M C;  1QZH A;  1I94 Q;  1A0I A;  2K50 A;  3B6Y A;  3T1H L;  2R92 G;  1KC8 C;  3RZO H;  2RCN A;  1WCM H;  5JJI A;  1BKB A;  3RN5 A;  4PZ8 A;  5E7N A;  3H15 A;  3PSI A;  1FJG Q;  1XNQ L;  3HOY H;  3I4M H;  3S14 H;  2F4V Q;  4DUY L;  2UXC L;  4JI8 L;  3GTL H;  4DV1 L;  4X6A H;  1N33 Q;  1VQ8 A;  4LF8 L;  3UE1 A;  4JBM A;  3CMA A;  3CPW A;  1J6Q A;  1CSP A;  2VL6 A;  3J80 i;  4AIM A;  5AJ3 L;  5BR8 L;  3BJU A;  1Y14 B;  1PH7 A;  2RF4 A;  4DUY Q;  2I5H A;  4JI8 Q;  4X66 Q;  1NMF A;  3M85 A;  3LGJ A;  2JEA I;  1IBK L;  2E5L L;  4ALP A;  3I4N G;  1D7Q A;  2NN6 G;  1HZC A;  5AJ3 Q;  1UE1 A;  5M5W H;  1G29 1;  1Z47 A;  2R7F A;  3A5Z B;  2R92 H;  1NMG A;  1WI5 A;  1TWH H;  4OXP A;  3CCQ A;  1VQC A;  2E5L Q;  3CAM A;  3S16 H;  1JJG A;  4DR5 L;  1UEB A;  2NVX H;  1IZ6 A;  2UUC Q;  4HIO A;  1K73 C;  1S72 A;  1VQI A;  4X62 L;  4Y7N H;  3I7F A;  3TEH B;  2LXJ A;  1HR0 L;  5ELN A;  1YJN A;  5C3E G;  4LUO A;  1MKH A;  4JV5 L;  2QEX A;  1JJ2 A;  2YYZ A;  3G71 A;  4LFC Q;  4AQY L;  1I3Q H;  1HZA A;  3KFU A;  1CKN B;  3J80 c;  2D62 A;  1Z9F A;  4B3R L;  1Q1E A;  4QY7 A;  4DV4 Q;  4LF6 Q;  2KCT A;  3ER0 A;  2K14 A;  1X54 A;  2I5L X;  1KHI A;  1VQB A;  2WP8 J;  3F8T A;  4XTC S;  3K80 C;  3HOX G;  3I4N H;  3J7A 5;  3M3Y H;  3S2D H;  2IX1 A;  4P74 A;  3UDG A;  2HIV A;  2ZTC A;  5GRO A;  2MNA A;  1N36 L;  1VQ9 A;  5JJK A;  2KHI A;  3L7Z C;  1PHJ A;  3PF4 A;  3PO2 G;  4GLV B;  4OO1 G;  3RLO A;  1C0A A;  2EXD A;  3L0O A;  4POF A;  5IYD G;  4OWW B;  4A3B H;  4WJ3 M;  5C0X I;  1PH5 A;  4A3F H;  2JA7 H;  4DV0 Q;  5C3E H;  1MIU A;  2ZM6 L;  4POG A;  3ZJY C;  5IP7 G;  1VQ6 A;  2A8V A;  1I6H H;  1GO3 E;  5FLX c;  3BZC A;  3G48 A;  2UUB Q;  1EFW A;  3J7Z C;  4X65 L;  1LYL A;  5M3M G;  1SN8 A;  1QUQ A;  1XMQ L;  3U58 A;  4LUV A;  4TQU S;  3HOX H;  2GVA A;  1YHA A;  1O7I A;  1JT8 A;  2JK8 A;  4DUZ Q;  3BZK A;  2PI2 E;  4B3S L;  3KOJ A;  3PIP A;  2OQ0 A;  4GOP A;  3ULP A;  2AWO A;  2HQL A;  3KLW A;  1MJE A;  2NVT H;  1Q12 A;  1EQQ A;  1XMQ Q;  3PO2 H;  3K8A A;  1AE3 A;  4JBK A;  1FGU A;  1A8V A;  3HFZ B;  4A3K H;  1HNZ Q;  5FLM H;  2GN5 A;  4LF7 Q;  1KIX A;  1VQ7 A;  4B3S Q;  3PV0 A;  2HHH L;  1B70 B;  3PUZ A; 
#chains in the Genus database with same CATH topology
 2L11 A;  5EPK A;  5GAG C;  1VQO A;  1QCB D;  1CT2 I;  2R92 B;  3RR5 A;  4B9X A;  1QNK A;  1TWH B;  2VQE Q;  3ERO A;  1I6V C;  1EYD A;  3MZ5 A;  3RN2 A;  3GTQ H;  3TJQ A;  5CGK A;  2HIX A;  1SBB B;  2AUK A;  3F2C A;  5HGI A;  3GTJ H;  1IY6 A;  4NW2 A;  2V53 A;  4R4I A;  1TBQ R;  1YIJ A;  3CC4 A;  3MXN A;  2F3C I;  3GD7 A;  2OQK A;  1H9K A;  5LMN L;  1GJX A;  1Y69 U;  3LNN A;  1U0L A;  1N32 L;  2N3S A;  5KNB A;  1ZXT A;  4UP7 A;  2JAE A;  4N8X 1;  5FO7 B;  2YV5 A;  1PRT F;  3R5A A;  3M3Y B;  5T1G A;  2ZJR A;  1GUG A;  3CHB D;  3W5O A;  2PZT A;  5E3F A;  3I9V 1;  4GN5 A;  1H95 A;  5C4H A;  2K5D A;  3NBH A;  3T1Y Q;  3OIQ A;  2GVB A;  1HRJ A;  1SGQ I;  3QWP A;  1EU4 A;  5C6A A;  2JYO A;  4U68 A;  2RQX A;  3CC2 A;  4QGU A;  1I6H B;  3FKI H;  5IGF A;  5C44 G;  1MT1 A;  1V1I A;  2F3I A;  1ESF A;  4JPB W;  1S5B D;  2F4V L;  2A1A A;  2UVO A;  2F52 A;  2XNA C;  2GA4 B;  3HOX B;  3S9W A;  1MJ9 A;  2B3G A;  2P6A C;  1AH9 A;  2XSC A;  5GAE C;  1TQO A;  2MHV A;  1KLU D;  3I4O A;  1D2B A;  1KAW A;  4DN4 M;  3NTK A;  1STH A;  4BBR G;  1ILQ A;  4P72 A;  1BR9 A;  2H1E A;  4KY6 A;  2VUM G;  5M5X B;  1E0B A;  4RMF A;  1X4S A;  4PV1 C;  4WJ4 A;  2KED A;  3GV6 A;  2UXD Q;  4DV6 L;  4MNO A;  2IWH A;  1PCE A;  2WB1 G;  5KGU A;  5C44 H;  4NMZ A;  4JW0 A;  2UUC L;  1TDP A;  3D4D A;  1CTM A;  3CCL A;  5M3M B;  4DV6 Q;  2B8F A;  4NB3 A;  4IUN A;  3CPF A;  1SNP A;  4F88 A;  2Y0M A;  4K14 A;  1EY4 A;  2B2Y A;  2F1M A;  2UUA L;  2VRW B;  2LSS A;  4ZUJ A;  1SFO H;  1CHO I;  4BBR H;  4ZKB B;  1EQV A;  2JA5 G;  2MFI A;  2VUM H;  3VYU A;  4APV A;  3PF5 A;  4BA2 I;  2JYY A;  4DV2 Q;  2UUA Q;  1SGN I;  4R4Q A;  1JB3 A;  1EY6 A;  4ODG A;  3EBE A;  5EPL A;  4GNX A;  1DZ1 A;  4O1O A;  1P9G A;  1F2L A;  1WTW A;  4A4I A;  3MFG A;  5IYC G;  4DR2 L;  1QZG A;  2QDL A;  5FLM G;  2E2J H;  2EY1 A;  1AP0 A;  4CKC A;  1GM5 A;  4AS2 A;  2JB2 A;  1SE8 A;  4Q5V A;  2JZM A;  3RZO B;  4DR2 Q;  4KD3 A;  2JA5 H;  1KNE A;  4OL7 A;  2IP6 A;  3AYH B;  5EBD A;  1K8M A;  4NPS A;  5KNC A;  3PO3 G;  2BH2 A;  5IT9 c;  4HJ9 A;  4DXG A;  1STE A;  2VB3 X;  1QUQ B;  4N9T A;  1IW7 D;  5FO9 B;  4B3T L;  1TIH A;  3ULJ A;  3O13 A;  2F0T A;  1WTO A;  1P16 A;  4MTN A;  4A3E H;  2ELI A;  1VQ5 A;  1BNZ A;  3RZD B;  5IYC H;  4LMQ D;  2DKV A;  3HEJ A;  2DGY A;  4B3T Q;  2LKV A;  1KRS A;  1Z2I A;  2RIO A;  3L9A X;  4DK0 A;  1X3E A;  1Q46 A;  4OGQ C;  2WVJ A;  3D31 A;  2J0T D;  2JJQ A;  3VDU A;  4L5Q A;  2XIW A;  2NZH A;  2PZW A;  2WAQ E;  2F0M A;  3PO3 H;  1IW4 A;  2PQ8 A;  5C5L A;  4JYA L;  2FEF A;  1PH8 A;  1BUS A;  1EQT A;  2M00 A;  3CC7 A;  4LF9 L;  3FHW A;  1D8L A;  4OO1 I;  4JYA Q;  1IYV A;  2RSO A;  2NTS A;  4KKU A;  3FPU B;  2L0C A;  1IL8 A;  4OHJ A;  1F2Z A;  3S2D B;  3ULL A;  1VQA A;  4R9W A;  3VYS A;  3UEY A;  2CKZ B;  1PA6 A;  1YHQ A;  2NVQ H;  2YTV A;  4Z7G A;  1TR5 A;  2EDG A;  3SGB I;  4A3B B;  1DGS A;  2PZU A;  2L7X A;  4A3F B;  3DEP A;  4HN7 A;  2ZRR A;  1SYG A;  4B9W A;  3Q24 A;  1S20 A;  1HFG A;  1NCV A;  1VQH A;  1X65 A;  3L0I A;  1MBY A;  2AKW B;  2UU9 L;  1B9M A;  3V2T A;  3K7U C;  1XPR A;  5K36 G;  2E8G A;  1L1O B;  2WAQ B;  4C3J G;  1Q3L A;  2M9V A;  2ICE C;  1SR3 A;  1Y1W B;  3ERQ A;  2AQ3 B;  4J6H A;  5FLX E;  2KEN A;  2ZXR A;  2K6A A;  1B44 D;  2X6L A;  5CV7 A;  4IPC A;  4A3C G;  3H0G G;  3M7N A;  2I07 B;  2ZT9 C;  1QG7 A;  3C46 A;  3LX0 A;  3PGZ A;  3FP9 A;  4L8J A;  3GTQ B;  2ENZ A;  4C3J H;  1HNW Q;  1H9S B;  4V0B A;  5J3B A;  1E3P A;  1HDL A;  4PMB A;  2X52 A;  4L5S A;  4AH6 A;  3NEL A;  1E2V A;  1DON A;  1PZI D;  1EYC A;  1VQF A;  1W4R A;  4A93 G;  2A69 C;  4MIU A;  2B39 A;  1XNQ Q;  3UFF A;  1GUO A;  3EVQ A;  5A35 A;  2KOL A;  1VDD A;  3I90 A;  3X3N A;  2TMP A;  3LJ1 A;  3SXH A;  1H9J A;  2K52 A;  1HQR D;  2NU4 I;  2N17 A;  2F0F A;  2Q2I A;  3TSS A;  2ALY B;  5BN5 A;  5A2Q E;  2L12 A;  4OWX B;  4R4T A;  3CME A;  3CKI B;  3NK9 A;  1WTQ A;  2A73 B;  3FKI B;  3NWT A;  2JQO A;  3HH2 C;  3V96 A;  1CKM A;  4DV5 L;  4A93 H;  2LY7 A;  4DR5 Q;  3GTO H;  3I2Z A;  3OSO A;  3NQT A;  1HPT A;  3ERS X;  1HR0 Q;  3C3L A;  4LF5 L;  5KYI A;  4LW1 A;  4G75 A;  3EA6 A;  4LF5 Q;  4B3R Q;  1YJ9 A;  3BJI A;  4GKJ L;  5ELB A;  1DOK A;  2G5D A;  3AFP A;  3KF6 B;  4HED A;  1F9R A;  3QIA A;  2D9U A;  5C44 B;  4DAY B;  4J15 A;  4JI1 L;  3UDX A;  2JB1 A;  1PH4 A;  3Q22 A;  1TS4 A;  2LXK A;  5CCM A;  1VMC A;  2PMZ E;  1Q8K A;  4GN3 B;  5E4X A;  2SGQ I;  2EYJ A;  4B6D A;  4DV7 L;  5FLX L;  4GLA C;  3A0J A;  3S1N H;  5IYB G;  5IE8 A;  3QR8 A;  1SFO B;  4X65 Q;  4BBR B;  3MTS A;  4ZQ3 A;  3RMH A;  1HA6 A;  4DV7 Q;  1MSG A;  1K7T A;  1EY5 A;  4E1P A;  4G4K A;  4J8Q A;  2NUC A;  2JN4 A;  3QB3 A;  3UGD A;  1BXT A;  1NTG A;  1XMO L;  1KLG D;  2OTL A;  3QOL A;  3OXL A;  2QSB A;  2E2I B;  3E2I A;  3S2H B;  4GKK L;  2K5Q A;  1HJA I;  2HHH Q;  1MI2 A;  3FNB A;  1XMO Q;  5ELC A;  1K0S A;  3DXJ C;  2E2J B;  3UGL A;  4BWG B;  1H0Z A;  2PQA B;  2BH8 A;  2EYP A;  3S1Q B;  2QEJ C;  3NP8 A;  1E1O A;  2E76 C;  1ASZ A;  4DXF A;  1RTN A;  2N52 A;  3FSX A;  1OYV I;  1TWC H;  4O42 A;  2PMZ B;  1C48 A;  2R6G A;  1FYC A;  1WCM G;  3KP9 A;  1ENA A;  1LR7 A;  5D3D A;  1OTC A;  1EY0 A;  4CBV A;  5CMD A;  2XVS A;  2R93 B;  3CCJ A;  4U67 3;  4JI2 L;  2GSC A;  2CWG A;  4IOC A;  4A3E B;  4A3J H;  1T9H A;  5A2Q L;  2ZXP A;  3PUV A;  4O1P A;  3BS1 A;  3A7L A;  3KDF B;  4JI2 Q;  4F8M A;  1VS0 A;  2KVM A;  1PYW D;  4BBS B;  4X3U A;  4EQO A;  3BZD B;  3T1H L;  2R92 G;  1YNJ C;  4WJW A;  4CDF C;  1GUW A;  1WCM H;  5JJI A;  3IAM 1;  2F0K A;  4K6D A;  5E7N A;  1KMA A;  1FJG Q;  1TBO A;  2UXC L;  1P9Z A;  4DUY L;  4PL5 A;  3NPP A;  4X6A H;  4WRD A;  1N33 Q;  4XQQ A;  4LF8 L;  2K05 A;  3T51 B;  1WTV A;  1J6Q A;  4AIM A;  2NWG A;  5BR8 L;  1Y14 B;  2O5J C;  4DUY Q;  4HFV A;  1NMF A;  3M85 A;  2YUU A;  2JEA I;  1FGB D;  3H91 A;  3NBI A;  4G7O C;  3I4N G;  1R0R I;  1D5M C;  1UE1 A;  1WTJ A;  5C4Z A;  3VA7 A;  1EY7 A;  2R92 H;  1NMG A;  1WI5 A;  1TWH H;  3HOW B;  2E2H B;  1VQC A;  1PTO C;  2F0Q A;  1IZ6 A;  2DJG C;  3NTH A;  1OMT A;  5FO8 B;  1VQI A;  2K28 A;  3TEH B;  2RVL A;  1YJN A;  5C3E G;  4A3M B;  2YYZ A;  2MGS A;  3KFU A;  1KDB A;  1I50 B;  3A56 A;  1Q1E A;  3UI2 A;  1NAP A;  4LF6 Q;  2KCT A;  3K58 A;  3ER0 A;  2K14 A;  5J39 A;  1KHI A;  3HOX G;  3I4N H;  3F8T A;  4XTC S;  4ZKC B;  3M3Y H;  5KND A;  4P74 A;  4RHR A;  3I72 A;  1VQ9 A;  1LTA D;  3PO2 G;  3MXU A;  3RLO A;  3PDN A;  4WJ3 M;  1PH5 A;  2JA7 H;  2R61 A;  5C3E H;  2F0S A;  2A74 C;  1I6H H;  2B2W C;  2QQE A;  1GUN A;  1CHP D;  2J4X A;  1LYL A;  3VR6 A;  3I4M B;  5M3M G;  2RKS A;  3S14 B;  5HI7 A;  2ORV A;  3HOX H;  3QTL D;  1O7I A;  3KOJ A;  1MJE A;  1Q12 A;  3PO2 H;  3EFX D;  1K7U A;  1AE3 A;  2C9O A;  1NXU A;  4XQN A;  3IL8 A;  4K8J A;  4CDC C;  1VQ7 A;  2F0O A;  3PV0 A;  4PNY A;  3PUZ A;  1SND A;  1QB5 D;  1PDQ A;  4FXK C;  2ES2 A;  2ZW3 A;  4Z9C B;  4JI3 Q;  4K6L A;  3TDQ A;  1SLJ A;  3NHH A;  1FNV A;  4TKO B;  3IAS 1;  1N9W A;  2A20 A;  2Q2H A;  3K5M A;  1XBT A;  4JVZ A;  1JJC B;  1IBM L;  4DNC A;  4AS3 A;  4HJ7 A;  2EY5 A;  1CZW A;  2EJM A;  2KJX A;  2VZA A;  1U4L A;  2F0D A;  4IFD J;  1EYG A;  2JSO A;  2AQ2 B;  1E7Z A;  3LJ0 A;  1U4R A;  3KK7 A;  3H3V C;  2IHF A;  3RNU A;  1CT1 D;  1K3R A;  1G2T A;  2QIL A;  2E2D C;  4FXD A;  1RF2 D;  3T16 A;  1TVX A;  4LAA A;  1CSQ A;  2NYZ D;  5JPM C;  1JMC A;  1W3S A;  1W6K A;  2Z1C A;  1BCP D;  1D5Z C;  3S1N B;  2JBW A;  2BA1 A;  2TSS A;  5FJ8 G;  4AML A;  4X66 L;  1JQY D;  2CW0 D;  1U4P A;  1S5C D;  4TVA B;  3KUP A;  4DAV A;  3RZD H;  2RAD A;  1B4O A;  2YU9 B;  1A3T A;  1E1T A;  1XNR Q;  1FVI A;  2XWJ B;  3TQY A;  2F6M B;  1F9S A;  2IPK D;  5H1S E;  5LMN W;  2HDL A;  1QOH A;  2B29 A;  1VF7 A;  3KF8 B;  2AQ1 B;  4TRD A;  4FKD A;  1L0Y B;  4JBW A;  3Q0A A;  1NSN S;  4LFC L;  3TP8 A;  4QUF A;  2H5X A;  4YWK A;  5C0X G;  2B0U C;  2QPO A;  4A24 A;  4A3B G;  1FL0 A;  2RSN A;  3SDJ A;  5FJ8 H;  4A3F G;  1QIL A;  2K5V A;  1TBN A;  3OWF A;  1BCP C;  1S3O A;  1JB7 A;  1J8I A;  2GVI A;  3VDP A;  4CJ2 C;  1UHA A;  2E73 A;  4JI0 L;  4HID A;  1Q7Y C;  2WAQ G;  3H6M A;  1QVG A;  4HGU A;  1Y1W G;  1HUM A;  3SVM A;  4A3J B;  3MXP A;  1JOQ A;  4JI0 Q;  1YBY A;  4C2M B;  1B1Z A;  5C0X H;  3MC0 B;  1U9R A;  3CCS A;  2UUB L;  4LK1 C;  2A6E D;  4QQB X;  3B4V C;  1V1P A;  1JC7 A;  1KAA A;  3P75 A;  2L15 A;  2JA8 G;  3B55 A;  1IYJ B;  1NNX A;  2PCF B;  2XTR A;  5CC4 A;  3MEF A;  2YTY A;  4IUR A;  1EIH A;  2KBN A;  1N34 L;  2MJ8 A;  4IPH A;  1EWI A;  2CFM A;  5KYL A;  1Y1W H;  4OVO A;  1SE3 A;  1LM0 A;  4DNI A;  4ME3 A;  2OEO A;  1GKH A;  3E9I A;  3HOZ B;  1ASY A;  1SGR I;  3DHQ A;  1S5F D;  3TME A;  1DOM A;  4ILW A;  1JWS D;  5DM7 3;  1X56 A;  4ZYS A;  4GOP B;  1N34 Q;  3J81 j;  2VQE L;  1EZ6 A;  2K1B A;  4Z7H A;  2JA8 H;  1YO7 A;  2L1L B;  2DUD A;  3CCR A;  2QKI C;  4YHH L;  4H02 A;  3HRZ C;  4JBJ A;  3WWV A;  1IL2 A;  4H44 C;  2A6E C;  3NEN A;  2NU2 I;  1WD1 A;  4JI5 L;  1CI3 M;  4R4O A;  4YHH Q;  4LFB Q;  1IBL Q;  5GQO A;  4I1T A;  3FKI G;  3DUZ A;  3FVV A;  3HKS A;  3BYY B;  4JI5 Q;  3M9B A;  1X3P A;  2R7D A;  1PTR A;  2O4X A;  3I4N B;  2RHS B;  2IHE A;  3T1Y L;  2CAZ B;  2SGF I;  4F87 A;  3R2T A;  4Y52 H;  4OON A;  1A3U A;  1B8A A;  4HSP A;  1CSO I;  1KXL A;  1L1O C;  2QZG A;  3TOA A;  4G7H C;  3I56 A;  2CQA A;  5IY0 A;  2NZO A;  1TII D;  1WTP A;  3HOU G;  4A3L G;  4GS3 A;  2JA7 B;  2WFW A;  1A2U A;  1EEF D;  5C3E B;  1RKN A;  3A5U A;  4E1R A;  1YEZ A;  4DK6 C;  1TUR A;  2RCF A;  4HAE A;  1G2S A;  1FAQ A;  1KRT A;  4ZUI A;  4LUZ A;  1XXG A;  1YZ6 A;  2Q2T A;  3D00 A;  2Q2U A;  4U6R A;  1T5E A;  1CM9 A;  3HKZ E;  2AMC B;  3SK8 A;  5I2Y A;  5JJZ A;  2WV6 D;  4PL4 A;  1I5F A;  5I6W A;  1OXX K;  2PYK A;  2N8N A;  3FRP B;  4GLX A;  5GAD C;  1Y1C A;  2UXD L;  1NR2 A;  3PO2 B;  3EJI A;  2D0P A;  3K7A H;  3E6Z X;  2BE5 D;  4A3L H;  3HOU H;  4SGB I;  1G8Z D;  3HZX A;  2E75 C;  3GOX A;  2DIP A;  3JSB A;  3KBX A;  4DAP A;  3I73 A;  5FUX A;  4FNF A;  4ZAI A;  2R3Z A;  1A62 A;  4R4C A;  3U4V A;  5EPJ A;  3PMF A;  4FDB A;  4GN4 B;  1HXY D;  1A3V A;  4PL3 A;  2FJ2 A;  5LHY 1;  3TZD A;  2ASB A;  4RGT A;  3I3C A;  4P73 A;  4DV2 L;  3M4Q A;  1YTP A;  4LWC A;  2A19 A;  4DV1 Q;  1IKL A;  3AB9 A;  3HKZ B;  3K0X A;  1UNS A;  2SOB A;  4IJL A;  1L0W A;  3CXC A;  5C0X J;  5ISR A;  3R8B A;  3K5L A;  2R93 G;  2BE5 C;  2Z4I A;  4HJA A;  2E2I H;  3S2H H;  4UP8 A;  1FNW A;  4A3E G;  2B2T A;  4I7A A;  5T1I A;  2XTQ A;  1TWA B;  4KKS A;  3UDF A;  1MJB A;  4IOA A;  3V05 A;  1GVP A;  3S1M B;  3S1Q H;  1CA5 A;  5JPN C;  4DFA A;  4P71 A;  1IYU A;  2C5C A;  4BBS G;  4X62 Q;  2VS1 A;  2CHB D;  4JV5 Q;  1HHV A;  1OXT A;  2EJF C;  2PNR C;  3PUY A;  4CHT B;  3R93 A;  1KBF A;  2R93 H;  2DB6 A;  2G9D A;  1XPO A;  1EOT A;  1PYS B;  1KDC A;  4XIG S;  1II3 A;  3LJ2 A;  1SE2 A;  4G57 A;  5FUY A;  1P8L A;  2F0W A;  3I70 A;  2ENB A;  4BBS H;  5FOB B;  3CD6 A;  5JAV A;  3GTP B;  1EOV A;  3FEW X;  5C4X G;  2KA7 A;  1VF5 C;  1RD9 D;  3TBI B;  3HOW G;  1WGC A;  1V43 A;  3ZYY X;  1V1Q A;  1RJT A;  1HNX L;  3L2P A;  2K5H A;  2B2W A;  1QVC A;  5JEA J;  5D14 A;  1XPU A;  4KJN A;  5I9P A;  4A3M G;  4UXH A;  1HTP A;  5IYD H;  2K75 A;  1HNX Q;  1YJW A;  4X3T A;  2A2D A;  4DK3 C;  3CRL C;  2ETD A;  1AFP A;  1Q86 C;  3N52 A;  5IOD A;  3N6R A;  4BXX G;  5J8F A;  2CWP A;  1EIF A;  5C4X H;  3NQI A;  2UZ3 A;  3OXG A;  2ZJQ A;  1YIT A;  3HOW H;  2E2H H;  1DD2 A;  2X69 A;  4A76 A;  1V1O A;  2GIV A;  3VR3 A;  4RGM A;  2NVY H;  4P75 A;  3E9H A;  4I65 A;  1A15 A;  4A3M H;  4A3D B;  1XWE A;  2NTT A;  1ULN A;  5DM6 3;  2A69 D;  1SNM A;  3MXG A;  3OOC A;  5JOB A;  1VQD A;  2K33 A;  1I50 H;  2KKM A;  1SAP A;  4MZ9 A;  1C4Q A;  3I4M G;  3ICE A;  4BXX H;  2KQ3 A;  1BCP F;  3BG3 A;  2N49 A;  4L5R C;  1O78 A;  4OAV B;  1G51 A;  4LJZ C;  3D0F A;  1HNW L;  2JA8 B;  3MEH A;  3P23 A;  1KAB A;  1ET6 A;  5CV6 A;  3K59 A;  3CCV A;  1I94 Q;  3FSY A;  1A0I A;  2K50 A;  3AJF A;  4FP5 D;  2FNF X;  1K3B C;  3FBV A;  1F2Y A;  1Y1V B;  3P1H A;  4CDD C;  1BMO A;  3HOY H;  1XNQ L;  3P7J A;  3I4M H;  3S14 H;  4UXJ A;  1V8Q A;  4JI8 L;  3PIO 3;  3DEO A;  1JR0 D;  4FF2 A;  4JBM A;  1TY0 A;  2EJG C;  3CPW A;  1QNU A;  1HPC A;  1SYF A;  4A3G B;  5AJ3 L;  1X74 A;  1NR4 A;  1SGY I;  1JIC A;  2EY2 A;  2VB2 X;  3D8G A;  4JI8 Q;  1LTB D;  1DCZ A;  2J9R A;  5IGG A;  2E5L L;  2CJS C;  2SDF A;  2NN6 G;  5AJ3 Q;  5K5P A;  1Z47 A;  3A5Z B;  3OPO A;  3DWA A;  3T13 A;  3S17 B;  5IIF A;  4OXP A;  1SJE D;  3CCQ A;  2E5L Q;  1K28 A;  3S16 H;  1JOO A;  4DR5 L;  3OHX C;  1Z7T A;  1K73 C;  3UIT A;  1E2Z A;  1HR0 L;  1J9O A;  2LXJ A;  1XX6 A;  3D6C A;  1JJ2 A;  3G71 A;  2WKD A;  2RC4 A;  5HGT A;  2RA4 A;  1HZA A;  1CKN B;  1MHW C;  1CQF A;  2D62 A;  1Z9F A;  2KCC A;  4B3R L;  4R8N A;  4DV4 Q;  2NN6 H;  3J7A 5;  4ZK9 B;  1DXM A;  1EEI D;  2IX1 A;  3K7A B;  1NUC A;  1CT0 I;  2HIV A;  1BDO A;  2OXP A;  3ONA B;  1TT2 A;  1PHJ A;  3HOU B;  1HEV A;  1C0A A;  4BY7 B;  3DO9 A;  2PQE A;  2L8E A;  4DV0 Q;  1GHJ A;  3R3O A;  1OMU A;  1VQ6 A;  1TY2 A;  3G48 A;  3MEK A;  4X65 L;  1STA A;  3J7Y W;  3K57 A;  1SN8 A;  4YIJ A;  1QUQ A;  3GTL B;  4LUV A;  1CA6 A;  1YHA A;  1JOK A;  2EY6 A;  3DMU A;  4KK7 A;  4DUZ Q;  2PI2 E;  2XRS D;  4B3S L;  3I4L A;  3ULP A;  1NUB A;  1EQQ A;  2FUG 1;  4IZ8 A;  1BO0 A;  4A3K H;  1HNZ Q;  2A6H D;  4LF7 Q;  2XWB B;  4EVO A;  4B3S Q;  1LT3 D;  2HHH L;  4IPG A;  3Q6S A;  5M5W B;  5HY6 A;  1SYE A;  2AUJ D;  2YU9 H;  4DNT B;  3STB C;  1SNC A;  2LUY A;  4A3J G;  1EUJ A;  3IFT A;  1YNJ D;  1Q1B A;  3OW2 A;  3ND9 A;  5EKI A;  3DWP A;  4IFD G;  1SJH D;  4NDX A;  2OF1 A;  5NUC A;  1VQE A;  4Q0F A;  1VQL A;  3TRE A;  3L3O C;  1TS5 A;  3QJY A;  4HJ8 A;  1Q81 C;  1SDF A;  4K0K Q;  3DM1 A;  5JVH 3;  1EU3 A;  1ESR A;  5KEE A;  3RD4 A;  5IGE A;  3W1B A;  3TP6 A;  1UE5 A;  3HOZ G;  2A6H C;  3I55 A;  2Z9H A;  3IRB A;  5E3Q A;  4C2M H;  2EIF A;  3TS0 A;  4QL5 A;  4IFD H;  1PTO D;  3A74 A;  3UDI A;  3K5O A;  1PRT D;  2HCI A;  5JVG 3;  4KHP Q;  1L1O A;  2KMQ A;  2F0I A;  2MQH A;  3EN2 A;  4IUT A;  1B7Y B;  4PZ6 A;  3NXW A;  1FJG L;  2KMO A;  3E59 A;  1YVC A;  1K7V A;  1N33 L;  2QQD A;  5IP9 G;  1LTS D;  3A8J E;  1WYD A;  2EYH A;  2G9H D;  4JI4 Q;  2Y0S E;  1E24 A;  5KRU A;  3CCU A;  1ULM A;  2O5I C;  1VQP A;  3RU0 A;  3VA9 A;  2EE1 A;  3HOZ H;  4TSS A;  5LL6 S;  3M4P A;  5CV5 A;  2B63 G;  1OVO A;  3TN2 A;  2SNS A;  2PNH A;  2CVR A;  2B2T C;  4ABN A;  1M8A A;  4CJ1 B;  1UWV A;  3UGI A;  2F0L A;  2IY5 B;  2JE6 I;  3GO5 A;  5ELE A;  4HJ5 A;  1G91 A;  2KMR A;  5C4X B;  1ENC A;  5IP9 H;  1YU6 C;  1R4P B;  3W2D A;  3SK4 A;  3EQL C;  2WIN B;  4JG2 A;  1PRT C;  2NVY B;  2NBF A;  4L63 B;  3OXF A;  1RTO A;  3OMC A;  1JE5 A;  2K32 A;  2OT2 A;  4LF4 Q;  2JA7 G;  3M4O B;  3MA2 B;  5TSS A;  4LF6 L;  5ELD A;  5HUR A;  4YZC A;  2B63 H;  1B3A A;  1STY A;  4HTH A;  1F9Q A;  2RDH A;  2ZTD A;  3CQZ B;  5C3W A;  1CT4 I;  2J7Z A;  4UPA A;  2Y0S B;  3J7A V;  3VE5 A;  2F0N A;  3J81 c;  3GQB A;  3R2I A;  5EX3 A;  1K8A C;  1FR3 A;  4GZY C;  1AN1 I;  4XT1 B;  3GTG B;  3QWN A;  2JXD A;  1STG A;  2R7Z H;  2MO0 A;  3PIP 3;  3CP0 A;  2RHQ B;  4BS9 A;  2UXB Q;  1JOR A;  1WGT A;  5C5M A;  2IW3 A;  1CE3 A;  4E6I A;  1TBR R;  2MJF B;  4DWL A;  1B9N A;  4DR6 L;  1KL9 A;  3JAM c;  2JW6 A;  4JCV E;  1KDA A;  1D6E C;  4C56 C;  2YQP A;  2K4K A;  4RKB A;  3QO2 A;  3HOY B;  3S24 A;  1A6X A;  2SNM A;  4DR6 Q;  2MO1 A;  5C3X A;  2NZ1 D;  3GV3 A;  1SMY C;  3DWQ A;  4B3M Q;  3C1F A;  3GTM B;  3KF6 A;  1ZEQ X;  2JXM B;  2CWF A;  1OXS C;  4CKB A;  2OU2 A;  3F2B A;  1EQR A;  1D5X C;  3SR1 A;  1ZYR C;  2ORW A;  4PQX A;  3VR4 A;  4JI3 L;  3HKZ G;  1RIP A;  4EQP A;  1X3G A;  4J1M A;  2K9H A;  1UE6 A;  4KV6 A;  3S16 B;  2B2V C;  3U50 C;  3T4A C;  3PCO B;  4A75 A;  1PYB A;  3SGI A;  3AQQ A;  4JI6 Q;  1WTH A;  4AYB E;  4RHS A;  2K04 A;  4IJH A;  3E5S A;  5EAY A;  1D1K A;  4HEA 1;  2IL8 A;  1IXR A;  3MXN B;  1HH2 P;  5CR3 A;  1ICF B;  1DYQ A;  1VMP A;  2RLD A;  3FC3 A;  1J5E Q;  4H7B A;  2LMC B;  3F2U A;  1XTD A;  1PXU A;  5FUV A;  3VYR A;  4HR7 B;  4NXM Q;  4LFA Q;  2VW9 A;  5M3F H;  1PZK D;  2L5T A;  1NJI C;  4OX9 L;  3UEJ A;  4ULL A;  2KCX A;  2PQA A;  2ZXO A;  3NBH B;  1KQS A;  1PV4 A;  2F0V A;  4OX9 Q;  4OWT B;  1GUS A;  1TWA H;  1SNQ A;  2F3V A;  3S1M H;  1PH1 A;  1IKM A;  2N1A B;  3S1R B;  1X55 A;  4AYB B;  1K8G A;  2ARP F;  4RFB A;  1VDZ A;  3HOV G;  5E4W C;  2V1C C;  4X64 Q;  2X6G A;  4O2D A;  2ZJP A;  1XNR L;  1PFN A;  3KDF A;  2DNC A;  4A3K B;  4RA8 A;  1CGJ I;  2ENN A;  1OXV A;  3TRZ A;  3K5N A;  3K6O A;  2SGP I;  2EYF A;  3TS2 A;  4HCS A;  3MHB A;  4DR7 L;  1Q9B A;  3U9O A;  3W1G A;  3GDE A;  4BA1 I;  1M8C A;  2XRC A;  3VR5 A;  1PH3 A;  3GTP H;  3CU7 A;  2B8T A;  5I6Y A;  2HCC A;  2NU1 I;  4YWL A;  3HOV H;  4DR7 Q;  4QF4 A;  2OD1 A;  3A55 A;  2MUY A;  2RBM A;  4G7Z C;  5E3P A;  1TS3 A;  4C3I G;  1SRU A;  4DV3 L;  1M4V A;  2QCP X;  4A3D G;  2BOS A;  3HP3 A;  3SK6 A;  5JJL A;  2Q8I B;  2CH4 W;  7WGA A;  5EBC A;  2VNU D;  3MFY A;  4DV3 Q;  2CQO A;  3FVQ A;  4A3I B;  3AMU A;  1C9O A;  1IBK Q;  4B08 A;  1ROD A;  4GNX B;  1HTL D;  5DAU A;  2IT1 A;  1LT5 D;  5I4D A;  2ICI A;  1DM0 B;  2JA1 A;  2YFA A;  4IAL A;  1HA5 A;  1O7L A;  3IFD A;  2VY3 A;  4PMC A;  3GTK H;  4C3I H;  3D4W A;  3VA5 A;  2OWO A;  1CUK A;  1ET9 A;  1UE7 A;  4FF4 A;  4A3D H;  4F7X A;  2K03 A;  4AQY Q;  1Y1V G;  4HIM A;  4YCU A;  5IGC A;  1UUP A;  2XRQ D;  1Y8O B;  4MTK A;  1PTQ A;  2H4O A;  3OL0 A;  3U4Z A;  4YZD A;  5HGQ A;  1TUS A;  4P2C B;  5CBE E;  1LR8 A;  1S40 A;  4A3G G;  4C1N I;  1XYI A;  1GOZ A;  1N36 Q;  2DN8 A;  4CGY B;  5JEA G;  3S15 B;  4QJF A;  5EX0 A;  3RUZ A;  1E22 A;  3ITP A;  3CCM A;  4LFB L;  2WII B;  4C3H B;  2O2L D;  4MHE A;  1PFB A;  4H0L C;  2ZM6 Q;  4HMJ A;  1IBL L;  1G6P A;  1PH2 A;  5G3L D;  4DA2 A;  2EYO A;  2J87 A;  2K19 A;  3R5D A;  1Y1V H;  2KEE A;  2ZTE A;  3LWU A;  2RIJ A;  1B3Q A;  3CW2 C;  1AEX A;  3KBG A;  3I91 A;  1PFM A;  4KY7 A;  3H3V I;  2B63 B;  1WKX A;  2HD3 A;  2FHT A;  3AEV A;  4BY1 G;  4DR4 L;  4OO1 H;  1Z7K B;  4OIJ A;  1SSO A;  2PO4 A;  2WAC A;  1IHZ A;  4A3G H;  3R5B A;  1NY4 A;  2AHO B;  1W2B A;  1X3F A;  3TO7 A;  5IP7 H;  3OMG A;  5JEA H;  4ID6 A;  2F0U A;  4DR4 Q;  3KLS X;  4JC0 A;  1Q82 C;  2K7V A;  1RDP D;  5C4J B;  4KI0 A;  2R7Z B;  3I8Z A;  3J81 E;  3KJO A;  3DLL A;  3S17 H;  1ENF A;  4EGV A;  4UY8 C;  1SRO A;  4BY7 G;  1BOS A;  4O0A A;  3K81 C;  4UP9 A;  4IO9 A;  4BY1 H;  5D3I B;  3MAQ A;  3C2P A;  2F0P A;  2SEB D;  1CFM A;  1PTO F;  1X9N A;  3HG9 A;  2Q8T A;  5LMN Q;  2NB0 A;  3NEM A;  5BN3 A;  3JAM E;  4EX5 A;  4IN3 A;  4KMU C;  2F0J A;  1N32 Q;  3TZU A;  2LB7 A;  2HDM A;  1K0R A;  1WJJ A;  3OVO A;  1A2T A;  1HFN A;  3MWY W;  3E0J A;  4BY7 H;  4OAU C;  2FIN B;  4DF7 A;  2IJ0 A;  1FD7 D;  1K9M C;  1QZH A;  4RGO S;  2EZV A;  1QJO A;  2RCN A;  4KD4 A;  1BKB A;  2PW5 A;  3TOB A;  3SDZ A;  3FMC A;  4OEM B;  1WTX A;  2F4V Q;  2WCY A;  2JA6 B;  4GXT A;  4DV1 L;  3GTL H;  1Y8F A;  4YZ9 A;  5HQ8 A;  3NE5 B;  1PH7 A;  2I5H A;  3LGJ A;  4OIK A;  3P20 A;  1D7Q A;  5CYU A;  5M3F B;  1HZC A;  2P5Z X;  3KF8 A;  5CV8 A;  5M5W H;  1G29 1;  2D5D A;  2XMX A;  2K5W A;  2N71 A;  1I4G A;  2ODD A;  4CKE A;  4GI3 C;  1LT6 D;  2UUC Q;  1CQV A;  1S72 A;  3T53 B;  4X62 L;  1N13 A;  1EYA A;  2LEO A;  1O80 A;  5COR A;  2V4D A;  4JV5 L;  2KEC A;  2Z8L A;  4H13 C;  3J80 c;  3KY9 A;  5EKK A;  1TWG B;  2PPB C;  4KTA A;  1SYB A;  5FUW A;  1AZQ A;  3OIP A;  2DY8 A;  3UDG A;  5GRO A;  2ZTC A;  2MNA A;  3J81 L;  5JJK A;  3L7Z C;  1BCP B;  3GP7 A;  3PF4 A;  2QDB A;  1EWC A;  3J7A F;  1MGS A;  3OWE B;  5IYD G;  5AFW A;  1OO9 B;  5C0X I;  1PZJ D;  1PPF I;  4KJO A;  1MIU A;  1B50 A;  3ZJY C;  1W6J A;  2A8V A;  4NV5 A;  1TKW B;  1LV9 A;  1FYB A;  1EFW A;  4KN7 C;  3VR2 A;  5FKA C;  3JAM L;  2EPB A;  4O1N A;  1XMQ L;  3U58 A;  5COY A;  1LTR D;  4TQU S;  1GHK A;  1RHP A;  2CH4 A;  3A7A B;  3HOV B;  5M9O A;  3BZK A;  2OQ0 A;  2SGE I;  3G6J B;  4GOP A;  2AWO A;  1XMQ Q;  3H09 A;  1D1I A;  4JBK A;  1FGU A;  3HFZ B;  1TOT A;  2EYL A;  5FLM H;  2GN5 A;  5DEH A;  1KIX A;  4FO2 A;  1HR0 W;  3QG1 A;  4JOI C;  2ATW A;  3BDO A;  5BN4 A;  2Y0S G;  5E3R A;  4IUU A;  3NUC A;  5J22 A;  4QMG A;  1LT4 D;  1BBX C;  2NVX B;  2Q8R E;  4EQN A;  3IAY A;  5LMU L;  1JWU D;  4Y7N B;  3OYY A;  1LTT D;  4S3S A;  1YI2 A;  3KYH C;  2Z6K C;  4MN3 A;  5IOC A;  1I3Q B;  2VQF L;  5LMU Q;  3G4S A;  3M4O H;  2B2V A;  3GTK B;  4C3I B;  3BYT B;  2MPM A;  4DU9 A;  2EXZ A;  4K5V A;  1IW7 C;  5I9O A;  1QVF A;  2VQF Q;  1F77 A;  3CQZ H;  4LF9 Q;  1OXU A;  4ZLT F;  4IPD A;  3HOY G;  1O7Y A;  4DKA C;  3HS0 C;  1ML0 D;  2YTX A;  1T5X D;  5FK9 C;  3A8K E;  9WGA A;  1KD1 C;  4XT3 B;  1S5D D;  2Z0S A;  1I94 L;  3GTG H;  1L2F A;  4RH6 A;  1C8C A;  1TWF H;  3SEB A;  2F3W A;  3AFQ A;  4KHV A;  1S4Z A;  2P22 B;  4YWM A;  5CCL A;  2BDN A;  2IX3 A;  2OVO A;  5CV4 A;  1CKO A;  4IUV A;  1LLR D;  3X3M A;  1SYC A;  2KCM A;  2HT1 A;  4DR1 L;  1LO5 D;  2UU9 Q;  1PH6 A;  1SGP I;  1EL0 A;  3SEK C;  1JCK B;  1X3Q A;  3SE0 A;  2NVT B;  4NXN L;  2KUM A;  3HGB A;  2JEB I;  4DR1 Q;  3GTM H;  2NU3 I;  2A2C A;  3WOF A;  2XGT A;  4NXN Q;  3J81 i;  3F1Z A;  1EZ8 A;  1ULK A;  1XTC D;  5K36 H;  1HUN A;  2V1C A;  3KLS A;  5IGD A;  2BA0 A;  3KJP A;  2ROW A;  3GTJ B;  1XX8 A;  5EJW A;  1H9M A;  4WP4 A;  1SJ8 A;  4XXE A;  1SYD A;  5JHW C;  2MP1 A;  1LAC A;  4RAU C;  4BY1 B;  3JAM i;  1JQO A;  2F03 A;  2WKC A;  4DV4 L;  3OW7 A;  1SMX A;  4A3C H;  3H0G H;  1O7Z A;  1L0X B;  3OTO L;  1LTL A;  2VXW A;  4QIW E;  4OEL B;  3FPP A;  1ICW A;  3TP5 A;  2B2U C;  1U4M A;  1K83 H;  3OTO Q;  1M8B A;  4DNR B;  2FFK B;  2QGM A;  4R1J A;  4AYB G;  4DV0 L;  3PQI A;  3DA3 A;  3STB D;  4A3K G;  5M5Y H;  1V1H A;  1WOC A;  1STN A;  3LWE A;  2PW7 A;  3BVG A;  4KHZ A;  4UXI A;  4YCW A;  1U5K A;  4DUZ L;  4KKT A;  1DJR D;  1RL2 A;  2WB1 E;  4DV5 Q;  1FY7 A;  4YY3 L;  2CWH A;  3F4M A;  3D3R A;  4KLK A;  2N78 A;  5IWA L;  5DLQ E;  3S1R H;  2F0H A;  4CDE C;  1HNZ L;  4LF7 L;  2GKR I;  1LTG D;  3RLN A;  2OTJ A;  4V19 0;  5G3L F;  4YY3 Q;  4M8A A;  1C7Y A;  2YFB A;  2RDF A;  3E0E A;  5IWA Q;  3DM3 A;  1CHQ D;  4NV2 A;  4QIW B;  4JI7 L;  4GKJ Q;  4KN4 C;  1MJA A;  2LFN A;  1XJV A;  2IX0 A;  3BDL A;  4N9P A;  4RG1 A;  4HMI A;  3SHL A;  4JK1 C;  2XTI A;  4JI7 Q;  1CGI I;  2Z4H A;  2ID0 A;  4A3I G;  4JI1 Q;  3PUW A;  4ZCK A;  3WDN A;  1JWM D;  1VQN A;  4FF3 A;  4K8I A;  5J8C A;  2X3T A;  1VQ4 A;  4K0K L;  1PVO A;  2QGQ A;  1HQM C;  1UUC A;  1UVF A;  1WVL A;  4UAI A;  5CBA E;  4FYD A;  2VUM B;  3URY A;  1BBW A;  1A63 A;  2QW7 A;  1M1K C;  1M90 C;  3DA4 A;  2WB1 B;  1UAP A;  3KLR A;  5D65 A;  4K2L A;  4HIK A;  4DR3 L;  4XQJ A;  1EIG A;  2CWA A;  3J80 E;  4EQ5 A;  1I4R A;  1NBW A;  2KHJ A;  3K0Y A;  1GXD C;  3IKJ A;  1SGE I;  4DR3 Q;  2RDG A;  4A3I H;  2ERW A;  4KHP L;  5IYB H;  1H9R A;  1DS2 I;  1PH9 A;  4GKK Q;  3UE0 A;  3TO9 A;  1PMR A;  2JA5 B;  2NU0 I;  2K5N A;  1WD0 A;  4JI4 L;  4K2K A;  1TXY A;  1MD2 D;  2HGK A;  2F66 B;  1VCI A;  1Y8P B;  3BU2 A;  2QQ0 A;  4DPG A;  2KMP A;  3W3A A;  2OCE A;  4C3H G;  4WFN 3;  2EOT A;  1PTO H;  1BF4 A;  2M2L A;  2CCZ A;  4C1N K;  3M4Y A;  1DOL A;  1ILP A;  3RLF A;  1ZKO A;  5IT9 E;  3BVM A;  3NTI A;  4QB4 A;  2E5R A;  5DAE A;  1LUZ A;  1SEB D;  2JP1 A;  1SE4 A;  1R9T H;  2GKT I;  4XYO A;  1BVS A;  4ZRZ A;  3SK5 A;  2B2Y C;  1EFI D;  1YNN D;  4R8I A;  2KCN A;  1VQJ A;  1AE2 A;  1KNA A;  1H9S A;  3EIV A;  2KHS A;  2I0Q A;  3D6W A;  3S15 H;  3PO3 B;  4LF4 L;  2F4I A;  5ELO A;  2QQC A;  3NSW A;  1UVG A;  4C3H H;  2R7Z G;  5GAH C;  1VQK A;  1I4X A;  1EY9 A;  3CCE A;  3T1H Q;  3TO6 A;  2W0T A;  2EYM A;  1SMY D;  4GNX C;  2UXC Q;  1SXT A;  1FNU A;  1E2W A;  4LF8 Q;  4HCE A;  3Q23 A;  3JC6 6;  1XA6 A;  1HJP A;  1F2M A;  5BR8 Q;  2NVQ B;  1ZYR D;  4PZ7 A;  1N8R C;  2UXB L;  4RCN A;  1VQG A;  4RGN A;  2BL7 A;  2N55 A;  1TGS I;  3D4R A;  3PIO A;  1EIY B;  1K8O A;  5C4J H;  5I2X A;  5DNF A;  4QCL A;  1TWF B;  1YNN C;  2E74 C;  3UOE A;  1NE3 A;  1X32 A;  1CKN A;  3U9S A;  1MJC A;  1V1P B;  4QUC A;  4X3K A;  2BCO A;  4GOP C;  1BUV T;  5J1Z A;  5L37 A;  4B3M L;  2JA9 A;  1LR9 A;  2AWN A;  2I5M X;  2XN9 C;  2D2C C;  4HSV A;  3J80 L;  1V9P A;  3G6E A;  2F0E A;  2NN6 I;  4K5X A;  1WFQ A;  2JA6 G;  1JE4 A;  4RCO A;  1MSH A;  4YCV A;  2F0G A;  4L5T A;  4DAY A;  1GD7 A;  4CJ0 B;  1KBE A;  2FXQ A;  2L9H A;  4K5W A;  4C3J B;  1HZ9 A;  1VQM A;  4JI6 L;  4M1U B;  4N8F A;  4PMW A;  1QE6 A;  5M3F G;  1DS3 I;  1B53 A;  2GKV A;  4MPI A;  4X3S A;  1WTR A;  3A54 A;  1I4P A;  3H3V H;  4NKL A;  1J5E L;  5IT9 L;  1RFH A;  2QA4 A;  4LNQ A;  4IQZ A;  3H0G B;  2JA6 H;  1HZB A;  4NP5 A;  1Y8N B;  1AZP A;  2DY7 A;  1BBU A;  1CZG A;  2BDO A;  4UDU C;  4LFA L;  2BL8 A;  4NXM L;  2EVB A;  5M5X H;  3TP7 A;  3Q8D A;  1K83 B;  2WGC A;  2L55 A;  1S5E D;  2LS0 1;  4UHV A;  4FXG C;  3CF5 A;  3QAH A;  5M3M H;  2D0O A;  3PUX A;  1PFS A;  1YNX A;  5M5Y B;  4A93 B;  4WOR A;  3VDY A;  3GTO B;  4ME5 A;  4JOI A;  5LL6 X;  3T56 B;  1PLF A;  4PG3 A;  1SGD I;  3F2D A;  1F9P A;  4X64 L;  1TS2 A;  5EQ0 A;  2FMM A;  4DAM A;  1IBM Q;  1TWG H;  1YHB A;  2PI2 A;  2Z6K A;  4RKL A;  3CRK C;  4IUQ A;  3M7G A;  3BDC A;  1EWH A;  1X6O A;  2JB3 A;  1RCV D;  2EQS A;  2C35 B;  2OZU A;  1I4H A;  4IFD I;  1STB A;  4Q9V A;  3B6Y A;  3C1E A;  3RZO H;  1KC8 C;  3CXL A;  3RN5 A;  1GUT A;  2QF7 A;  4PZ8 A;  3H15 A;  5F2D A;  4XDX A;  1KTK A;  5IGB A;  3PSI A;  1Y1B A;  2M5X A;  1CK1 A;  1VQ8 A;  3E3X A;  1EY8 A;  3UE1 A;  2DJF C;  1IY5 A;  3CMA A;  1CSP A;  2VL6 A;  4FF1 A;  3J80 i;  3BJU A;  4IUP A;  4L9M A;  1SNO A;  2RF4 A;  4X66 Q;  3G7L A;  1IBK L;  4ALP A;  1Z6H A;  1TU2 B;  1QWY A;  2R7F A;  4G76 A;  4KY5 A;  2FMC A;  2BUS A;  1Q8I A;  3CAM A;  1JJG A;  5CV9 A;  1UEB A;  2NVX H;  2Z6B A;  4HIO A;  1Q90 A;  4Y7N H;  3I7F A;  5ELN A;  5ELF A;  4LUO A;  1MKH A;  5LNK 1;  1TWC B;  2QEX A;  2K01 A;  4LFC Q;  4AQY L;  2V6E A;  1I3Q H;  4L6T B;  1HCZ A;  2SGD I;  4XYQ A;  4QY7 A;  3FDT A;  1I4Q A;  3AU7 A;  1PTO B;  4RWS C;  1X54 A;  2I5L X;  1VQB A;  3MVV A;  1PRT B;  2WP8 J;  3K80 C;  2CW0 C;  2A68 D;  3ND8 A;  1UEA B;  1G6Z A;  1LAB A;  4DGZ A;  3S2D H;  1N36 L;  2A5H A;  4I7Z C;  2KHI A;  3A8I E;  4GLV B;  1AN8 A;  3WOE A;  4OO1 G;  1B2T A;  1R9T B;  1PJU A;  2EXD A;  3L0O A;  1BQQ T;  4POF A;  4OWW B;  4A3B H;  3R5C A;  3NWS A;  4A3F H;  2B2U A;  1R4Q B;  2ZM6 L;  4POG A;  5IP7 G;  2L4N A;  2DNE A;  1WCM B;  2L1B A;  2N88 A;  1GO3 E;  3BVZ A;  5EGT A;  5FLX c;  3BZC A;  2B8G A;  2UUB Q;  4FVM A;  2HQE A;  3J7Z C;  2I46 A;  3QOJ A;  5E1F A;  1LTI D;  2HUG A;  2GVA A;  1JT8 A;  2JK8 A;  2FU2 A;  1R79 A;  4DK1 A;  3PIP A;  2NVT H;  2HQL A;  3KLW A;  1ONL A;  3K8A A;  1A8V A;  1FAR A;  3SGQ I;  5KIX A;  3VYT A;  5EKL A;  2A68 C;  1B70 B;  1AW7 A;  3H94 A; 
#chains in the Genus database with same CATH homology
 1VQO A;  5GAG C;  1CT2 I;  3RR5 A;  2VQE Q;  3GTQ H;  3RN2 A;  3TJQ A;  2HIX A;  3F2C A;  5HGI A;  3GTJ H;  1IY6 A;  2V53 A;  4R4I A;  1TBQ R;  1YIJ A;  3CC4 A;  2F3C I;  3GD7 A;  2OQK A;  5LMN L;  1U0L A;  1N32 L;  2N3S A;  4UP7 A;  2JAE A;  2YV5 A;  2ZJR A;  3W5O A;  3I9V 1;  4GN5 A;  1H95 A;  3T1Y Q;  1SGQ I;  2GVB A;  3QWP A;  3CC2 A;  4QGU A;  3FKI H;  5C44 G;  1MT1 A;  1V1I A;  2F3I A;  2F4V L;  2A1A A;  2F52 A;  2B3G A;  2P6A C;  1AH9 A;  5GAE C;  3I4O A;  1KAW A;  4BBR G;  4P72 A;  2VUM G;  4RMF A;  1X4S A;  4WJ4 A;  2UXD Q;  4DV6 L;  4MNO A;  1PCE A;  2WB1 G;  5C44 H;  2UUC L;  3CCL A;  4DV6 Q;  4NB3 A;  3CPF A;  2UUA L;  2VRW B;  2LSS A;  1SFO H;  1CHO I;  4BBR H;  2JA5 G;  2MFI A;  2VUM H;  4APV A;  3PF5 A;  4BA2 I;  2JYY A;  4DV2 Q;  2UUA Q;  1SGN I;  4R4Q A;  3EBE A;  4GNX A;  4O1O A;  4A4I A;  5IYC G;  4DR2 L;  1QZG A;  5FLM G;  2E2J H;  1GM5 A;  4AS2 A;  2JB2 A;  1SE8 A;  2JZM A;  4DR2 Q;  2JA5 H;  2IP6 A;  3AYH B;  4NPS A;  3PO3 G;  2BH2 A;  5IT9 c;  4HJ9 A;  1QUQ B;  4B3T L;  1TIH A;  3ULJ A;  1P16 A;  4MTN A;  4A3E H;  2ELI A;  1VQ5 A;  5IYC H;  2DGY A;  4B3T Q;  1KRS A;  2RIO A;  1X3E A;  1Q46 A;  2WVJ A;  3D31 A;  2JJQ A;  3VDU A;  4L5Q A;  2NZH A;  2WAQ E;  3PO3 H;  1IW4 A;  4JYA L;  1PH8 A;  1BUS A;  3CC7 A;  4LF9 L;  3FHW A;  1D8L A;  4OO1 I;  4JYA Q;  3ULL A;  1VQA A;  3UEY A;  2CKZ B;  1PA6 A;  1YHQ A;  2NVQ H;  2YTV A;  4Z7G A;  3SGB I;  1DGS A;  2L7X A;  2ZRR A;  1VQH A;  1X65 A;  3L0I A;  2AKW B;  2UU9 L;  3K7U C;  1XPR A;  5K36 G;  2E8G A;  1L1O B;  1SR3 A;  2KEN A;  4IPC A;  4A3C G;  3H0G G;  3M7N A;  3PGZ A;  3FP9 A;  2ENZ A;  4C3J H;  1HNW Q;  5J3B A;  1E3P A;  1HDL A;  4L5S A;  4AH6 A;  3NEL A;  1VQF A;  1W4R A;  4A93 G;  1XNQ Q;  3UFF A;  1VDD A;  3LJ1 A;  2K52 A;  2NU4 I;  2N17 A;  2Q2I A;  2ALY B;  4OWX B;  4R4T A;  3CME A;  2JQO A;  3HH2 C;  1CKM A;  4DV5 L;  4A93 H;  4DR5 Q;  3GTO H;  3I2Z A;  1HPT A;  3ERS X;  1HR0 Q;  4LF5 L;  4LW1 A;  4G75 A;  4LF5 Q;  4B3R Q;  1YJ9 A;  3BJI A;  4GKJ L;  3AFP A;  3KF6 B;  4DAY B;  4J15 A;  4JI1 L;  3UDX A;  2JB1 A;  1PH4 A;  2LXK A;  5CCM A;  2PMZ E;  1Q8K A;  4GN3 B;  2SGQ I;  4B6D A;  4DV7 L;  4GLA C;  3A0J A;  3S1N H;  5IYB G;  5IE8 A;  4X65 Q;  4DV7 Q;  4E1P A;  3UGD A;  1NTG A;  1XMO L;  2OTL A;  3OXL A;  3E2I A;  4GKK L;  1HJA I;  2HHH Q;  1XMO Q;  1H0Z A;  3UGL A;  2PQA B;  2BH8 A;  1E1O A;  1ASZ A;  2N52 A;  1OYV I;  1TWC H;  2R6G A;  1WCM G;  3KP9 A;  1LR7 A;  1OTC A;  3CCJ A;  4JI2 L;  4IOC A;  4A3J H;  1T9H A;  3PUV A;  4O1P A;  3KDF B;  4JI2 Q;  1VS0 A;  3T1H L;  2R92 G;  1WCM H;  5JJI A;  3IAM 1;  5E7N A;  1KMA A;  1FJG Q;  1TBO A;  2UXC L;  4DUY L;  4PL5 A;  4X6A H;  1N33 Q;  4LF8 L;  1J6Q A;  4AIM A;  5BR8 L;  1Y14 B;  4DUY Q;  4HFV A;  1NMF A;  3M85 A;  2YUU A;  2JEA I;  3I4N G;  1R0R I;  1UE1 A;  2R92 H;  1NMG A;  1WI5 A;  1TWH H;  1VQC A;  1IZ6 A;  1OMT A;  1VQI A;  3TEH B;  1YJN A;  5C3E G;  2YYZ A;  3KFU A;  1Q1E A;  4LF6 Q;  2KCT A;  3ER0 A;  2K14 A;  1KHI A;  3HOX G;  3I4N H;  3F8T A;  4XTC S;  3M3Y H;  4P74 A;  1VQ9 A;  3PO2 G;  3RLO A;  3PDN A;  4WJ3 M;  1PH5 A;  2JA7 H;  5C3E H;  1I6H H;  2QQE A;  1LYL A;  5HI7 A;  5M3M G;  2ORV A;  3HOX H;  3QTL D;  1O7I A;  3KOJ A;  1MJE A;  1Q12 A;  3PO2 H;  1AE3 A;  1VQ7 A;  3PV0 A;  3PUZ A;  2ES2 A;  4JI3 Q;  1SLJ A;  3IAS 1;  1N9W A;  2A20 A;  2Q2H A;  1XBT A;  1JJC B;  1IBM L;  4AS3 A;  4HJ7 A;  2VZA A;  4IFD J;  1EYG A;  1E7Z A;  3LJ0 A;  2IHF A;  3RNU A;  1K3R A;  1CSQ A;  1JMC A;  1W3S A;  2BA1 A;  5FJ8 G;  4X66 L;  4TVA B;  3RZD H;  1E1T A;  1XNR Q;  1FVI A;  3TQY A;  2F6M B;  5H1S E;  5LMN W;  2B29 A;  3KF8 B;  4FKD A;  4JBW A;  4LFC L;  2H5X A;  4YWK A;  5C0X G;  2B0U C;  2QPO A;  4A24 A;  4A3B G;  1FL0 A;  3SDJ A;  5FJ8 H;  4A3F G;  2K5V A;  1TBN A;  1S3O A;  1JB7 A;  2GVI A;  3VDP A;  2E73 A;  4JI0 L;  4HID A;  1Q7Y C;  2WAQ G;  1QVG A;  4HGU A;  1Y1W G;  4JI0 Q;  1YBY A;  3CCS A;  2UUB L;  4QQB X;  3B4V C;  2L15 A;  2JA8 G;  1IYJ B;  2XTR A;  3MEF A;  2YTY A;  2KBN A;  1N34 L;  4IPH A;  1EWI A;  2CFM A;  1Y1W H;  4OVO A;  1LM0 A;  4DNI A;  4ME3 A;  1GKH A;  3E9I A;  1ASY A;  1SGR I;  1X56 A;  1N34 Q;  4GOP B;  3J81 j;  2VQE L;  4Z7H A;  2JA8 H;  1YO7 A;  2L1L B;  2DUD A;  3CCR A;  4YHH L;  4H02 A;  4JBJ A;  3WWV A;  1IL2 A;  3NEN A;  2NU2 I;  4JI5 L;  4R4O A;  4YHH Q;  4LFB Q;  1IBL Q;  5GQO A;  4I1T A;  3FKI G;  3HKS A;  4JI5 Q;  3M9B A;  2R7D A;  1PTR A;  2RHS B;  2IHE A;  3T1Y L;  2CAZ B;  2SGF I;  4Y52 H;  4OON A;  1B8A A;  1CSO I;  1KXL A;  1L1O C;  3I56 A;  5IY0 A;  2NZO A;  4A3L G;  3HOU G;  4GS3 A;  2WFW A;  4E1R A;  3A5U A;  1YEZ A;  4DK6 C;  1TUR A;  1FAQ A;  1KRT A;  4LUZ A;  1YZ6 A;  2Q2T A;  3D00 A;  2Q2U A;  4U6R A;  3HKZ E;  2AMC B;  4PL4 A;  1I5F A;  1OXX K;  2N8N A;  4GLX A;  5GAD C;  1Y1C A;  2UXD L;  2D0P A;  3K7A H;  4SGB I;  4A3L H;  3HOU H;  3GOX A;  2DIP A;  3JSB A;  5FUX A;  1A62 A;  4R4C A;  3U4V A;  4FDB A;  4GN4 B;  4PL3 A;  2ASB A;  4P73 A;  4DV2 L;  3M4Q A;  1YTP A;  4LWC A;  2A19 A;  4DV1 Q;  3K0X A;  4IJL A;  1L0W A;  3CXC A;  5C0X J;  2R93 G;  4HJA A;  2E2I H;  3S2H H;  4UP8 A;  4A3E G;  2XTQ A;  3UDF A;  4IOA A;  1GVP A;  3S1Q H;  4P71 A;  4BBS G;  4X62 Q;  2VS1 A;  4JV5 Q;  1OXT A;  3PUY A;  1KBF A;  2R93 H;  2DB6 A;  1XPO A;  1PYS B;  4XIG S;  3LJ2 A;  5FUY A;  1P8L A;  4BBS H;  3CD6 A;  1EOV A;  5C4X G;  3HOW G;  1V43 A;  1V1Q A;  1HNX L;  3L2P A;  2K5H A;  1QVC A;  5JEA J;  1XPU A;  4A3M G;  4UXH A;  5IYD H;  2K75 A;  1HNX Q;  1YJW A;  2A2D A;  4DK3 C;  1Q86 C;  4BXX G;  2CWP A;  1EIF A;  5C4X H;  2UZ3 A;  3OXG A;  2ZJQ A;  1YIT A;  3HOW H;  2E2H H;  4A76 A;  2NVY H;  4P75 A;  3E9H A;  4A3M H;  1VQD A;  4MZ9 A;  1I50 H;  2KKM A;  3I4M G;  3ICE A;  4BXX H;  2N49 A;  4L5R C;  4OAV B;  1G51 A;  3D0F A;  1HNW L;  3P23 A;  3CCV A;  1I94 Q;  1A0I A;  2K50 A;  3AJF A;  2FNF X;  3FBV A;  1BMO A;  3HOY H;  1XNQ L;  3I4M H;  3S14 H;  4UXJ A;  4JI8 L;  4JBM A;  3CPW A;  5AJ3 L;  1X74 A;  1SGY I;  4JI8 Q;  2J9R A;  2E5L L;  2CJS C;  2NN6 G;  5AJ3 Q;  1Z47 A;  3A5Z B;  4OXP A;  3CCQ A;  2E5L Q;  3S16 H;  4DR5 L;  1K73 C;  3UIT A;  1HR0 L;  1XX6 A;  2LXJ A;  1JJ2 A;  3G71 A;  1HZA A;  1CKN B;  2D62 A;  1Z9F A;  4B3R L;  4DV4 Q;  3J7A 5;  2IX1 A;  1CT0 I;  2HIV A;  1PHJ A;  1C0A A;  3DO9 A;  2L8E A;  4DV0 Q;  1OMU A;  1VQ6 A;  3G48 A;  3MEK A;  4X65 L;  1SN8 A;  1QUQ A;  4LUV A;  1YHA A;  4DUZ Q;  2PI2 E;  4B3S L;  3ULP A;  1NUB A;  1EQQ A;  2FUG 1;  4A3K H;  1HNZ Q;  4LF7 Q;  4B3S Q;  2HHH L;  4IPG A;  5HY6 A;  2YU9 H;  3STB C;  2LUY A;  4A3J G;  1EUJ A;  1Q1B A;  3OW2 A;  4IFD G;  1VQE A;  1VQL A;  3TRE A;  4HJ8 A;  1Q81 C;  4K0K Q;  3W1B A;  1UE5 A;  3HOZ G;  3I55 A;  3IRB A;  4C2M H;  2EIF A;  3TS0 A;  4QL5 A;  3A74 A;  3UDI A;  4KHP Q;  1L1O A;  2KMQ A;  2MQH A;  3EN2 A;  1FJG L;  1B7Y B;  4PZ6 A;  3E59 A;  2KMO A;  1YVC A;  1N33 L;  2QQD A;  5IP9 G;  1WYD A;  4JI4 Q;  2Y0S E;  1E24 A;  3CCU A;  1VQP A;  3RU0 A;  3VA9 A;  3HOZ H;  2B63 G;  3M4P A;  1OVO A;  2PNH A;  1UWV A;  3UGI A;  2IY5 B;  2JE6 I;  3GO5 A;  4HJ5 A;  2KMR A;  5IP9 H;  1YU6 C;  4JG2 A;  3OXF A;  2JA7 G;  1JE5 A;  4LF4 Q;  4LF6 L;  4YZC A;  2B63 H;  1CT4 I;  2ZTD A;  4UPA A;  3VE5 A;  3J81 c;  5EX3 A;  1K8A C;  1AN1 I;  2JXD A;  2R7Z H;  2MO0 A;  3CP0 A;  2RHQ B;  2UXB Q;  1CE3 A;  1TBR R;  2MJF B;  4DWL A;  4DR6 L;  1KL9 A;  3JAM c;  2JW6 A;  4JCV E;  2YQP A;  2K4K A;  3S24 A;  4DR6 Q;  2MO1 A;  4B3M Q;  3KF6 A;  1OXS C;  3F2B A;  1EQR A;  2ORW A;  4JI3 L;  3HKZ G;  1RIP A;  1X3G A;  2K9H A;  1UE6 A;  3U50 C;  3PCO B;  4A75 A;  1PYB A;  3SGI A;  3AQQ A;  4JI6 Q;  4AYB E;  4IJH A;  5EAY A;  4HEA 1;  1IXR A;  3MXN B;  1HH2 P;  3FC3 A;  1J5E Q;  1XTD A;  5FUV A;  4NXM Q;  4LFA Q;  2VW9 A;  5M3F H;  4OX9 L;  1NJI C;  3UEJ A;  2KCX A;  2PQA A;  3NBH B;  1KQS A;  1PV4 A;  4OX9 Q;  4OWT B;  1TWA H;  3S1M H;  1PH1 A;  2N1A B;  1X55 A;  1K8G A;  2ARP F;  3HOV G;  2V1C C;  4X64 Q;  4O2D A;  2ZJP A;  1XNR L;  3KDF A;  1CGJ I;  2ENN A;  1OXV A;  3TRZ A;  2SGP I;  3TS2 A;  4DR7 L;  3W1G A;  3GDE A;  4BA1 I;  1M8C A;  2XRC A;  1PH3 A;  3GTP H;  2B8T A;  2NU1 I;  4YWL A;  3HOV H;  4DR7 Q;  2OD1 A;  4DV3 L;  1SRU A;  4A3D G;  5JJL A;  2VNU D;  4DV3 Q;  2CQO A;  1C9O A;  1IBK Q;  4GNX B;  2IT1 A;  2JA1 A;  2YFA A;  2VY3 A;  3GTK H;  4C3I H;  2OWO A;  1CUK A;  1UE7 A;  4A3D H;  4AQY Q;  1Y1V G;  4HIM A;  4YCU A;  1PTQ A;  3OL0 A;  3U4Z A;  4YZD A;  5HGQ A;  1TUS A;  1LR8 A;  1S40 A;  4A3G G;  1N36 Q;  5JEA G;  4QJF A;  5EX0 A;  1E22 A;  3CCM A;  4LFB L;  1IBL L;  2ZM6 Q;  1G6P A;  2QQ0 A;  1PH2 A;  2J87 A;  2K19 A;  1Y1V H;  2ZTE A;  3CW2 C;  3H3V I;  3AEV A;  4BY1 G;  4DR4 L;  1Z7K B;  4A3G H;  1NY4 A;  2AHO B;  1W2B A;  1X3F A;  5IP7 H;  4DR4 Q;  4JC0 A;  1Q82 C;  4KI0 A;  3KJO A;  3DLL A;  3S17 H;  4UY8 C;  1SRO A;  4BY7 G;  4O0A A;  3K81 C;  4UP9 A;  4IO9 A;  4BY1 H;  1X9N A;  5LMN Q;  3NEM A;  4EX5 A;  1N32 Q;  1K0R A;  1WJJ A;  3OVO A;  4BY7 H;  4OAU C;  1K9M C;  1QZH A;  2RCN A;  1BKB A;  2F4V Q;  2WCY A;  3GTL H;  4GXT A;  4DV1 L;  1Y8F A;  4YZ9 A;  5HQ8 A;  1PH7 A;  2I5H A;  3LGJ A;  1D7Q A;  1HZC A;  5M5W H;  1G29 1;  2XMX A;  2N71 A;  2ODD A;  4GI3 C;  2UUC Q;  1S72 A;  4X62 L;  1N13 A;  2LEO A;  4JV5 L;  3J80 c;  3KY9 A;  5FUW A;  3UDG A;  5GRO A;  2ZTC A;  2MNA A;  5JJK A;  3L7Z C;  3PF4 A;  5IYD G;  5C0X I;  1PPF I;  1MIU A;  3ZJY C;  2A8V A;  4NV5 A;  1FYB A;  1EFW A;  1XMQ L;  3U58 A;  4TQU S;  3BZK A;  2OQ0 A;  2SGE I;  4GOP A;  2AWO A;  1XMQ Q;  4JBK A;  1FGU A;  3HFZ B;  1TOT A;  5FLM H;  2GN5 A;  1KIX A;  1HR0 W;  4JOI C;  2ATW A;  2Y0S G;  5LMU L;  3OYY A;  1YI2 A;  3KYH C;  2Z6K C;  2VQF L;  5LMU Q;  3G4S A;  3M4O H;  1QVF A;  2VQF Q;  3CQZ H;  4LF9 Q;  1OXU A;  4IPD A;  3HOY G;  4DKA C;  2YTX A;  1KD1 C;  2Z0S A;  1I94 L;  3GTG H;  1L2F A;  1TWF H;  3AFQ A;  2P22 B;  4YWM A;  5CCL A;  2OVO A;  1CKO A;  2KCM A;  2HT1 A;  4DR1 L;  2UU9 Q;  1PH6 A;  1SGP I;  3SEK C;  4NXN L;  2JEB I;  4DR1 Q;  3GTM H;  2NU3 I;  2A2C A;  2XGT A;  4NXN Q;  3J81 i;  3F1Z A;  2V1C A;  2BA0 A;  3KJP A;  2ROW A;  1SJ8 A;  5JHW C;  3JAM i;  4DV4 L;  1SMX A;  4A3C H;  3H0G H;  3OTO L;  1LTL A;  4QIW E;  1K83 H;  3OTO Q;  1M8B A;  4R1J A;  4AYB G;  4DV0 L;  3DA3 A;  3STB D;  4A3K G;  5M5Y H;  1V1H A;  1WOC A;  4KHZ A;  4UXI A;  4YCW A;  1U5K A;  4DUZ L;  4DV5 Q;  1RL2 A;  2WB1 E;  4YY3 L;  3F4M A;  4KLK A;  2N78 A;  5IWA L;  5DLQ E;  3S1R H;  1HNZ L;  4LF7 L;  2GKR I;  3RLN A;  2OTJ A;  4YY3 Q;  1C7Y A;  2YFB A;  3E0E A;  5IWA Q;  3DM3 A;  4NV2 A;  4JI7 L;  4GKJ Q;  1XJV A;  2IX0 A;  4RG1 A;  2XTI A;  4JI7 Q;  1CGI I;  2ID0 A;  4A3I G;  4JI1 Q;  3PUW A;  1VQN A;  1VQ4 A;  4K0K L;  1PVO A;  2QGQ A;  1UUC A;  1UVF A;  1BBW A;  1A63 A;  1M1K C;  1M90 C;  3DA4 A;  4HIK A;  4DR3 L;  2CWA A;  4EQ5 A;  1NBW A;  2KHJ A;  1SGE I;  4DR3 Q;  4A3I H;  2ERW A;  4KHP L;  5IYB H;  1DS2 I;  1PH9 A;  4GKK Q;  3UE0 A;  2NU0 I;  2K5N A;  4JI4 L;  1TXY A;  1VCI A;  2F66 B;  3BU2 A;  4DPG A;  2KMP A;  2OCE A;  2CCZ A;  3RLF A;  2E5R A;  5DAE A;  1LUZ A;  1R9T H;  2GKT I;  1BVS A;  1VQJ A;  1AE2 A;  3EIV A;  2I0Q A;  3S15 H;  4LF4 L;  5ELO A;  2QQC A;  1UVG A;  4C3H H;  2R7Z G;  5GAH C;  1VQK A;  3CCE A;  3T1H Q;  2W0T A;  4GNX C;  2UXC Q;  4LF8 Q;  3JC6 6;  1XA6 A;  1HJP A;  5BR8 Q;  4PZ7 A;  1N8R C;  2UXB L;  1VQG A;  1TGS I;  3PIO A;  1EIY B;  5C4J H;  1NE3 A;  1CKN A;  1MJC A;  4GOP C;  4B3M L;  2JA9 A;  1LR9 A;  2AWN A;  2I5M X;  1V9P A;  3G6E A;  2NN6 I;  1WFQ A;  2JA6 G;  4YCV A;  4L5T A;  1GD7 A;  1KBE A;  2FXQ A;  1VQM A;  1HZ9 A;  4JI6 L;  4PMW A;  5M3F G;  2GKV A;  1DS3 I;  3H3V H;  1J5E L;  1RFH A;  2QA4 A;  4LNQ A;  2JA6 H;  1HZB A;  1BBU A;  4NXM L;  4LFA L;  5M5X H;  3Q8D A;  3CF5 A;  5M3M H;  2D0O A;  3PUX A;  1PFS A;  1YNX A;  3VDY A;  4JOI A;  4PG3 A;  1SGD I;  3F2D A;  4X64 L;  4DAM A;  1IBM Q;  1TWG H;  1YHB A;  2PI2 A;  2Z6K A;  1X6O A;  2JB3 A;  2EQS A;  2C35 B;  4IFD I;  4Q9V A;  3B6Y A;  3RZO H;  1KC8 C;  3CXL A;  3RN5 A;  4PZ8 A;  3H15 A;  1Y1B A;  3PSI A;  2M5X A;  1VQ8 A;  3UE1 A;  1IY5 A;  3CMA A;  1CSP A;  2VL6 A;  3J80 i;  3BJU A;  4L9M A;  2RF4 A;  4X66 Q;  1IBK L;  4ALP A;  2R7F A;  4G76 A;  2BUS A;  3CAM A;  1JJG A;  1UEB A;  2NVX H;  4HIO A;  4Y7N H;  3I7F A;  5ELN A;  4LUO A;  1MKH A;  5LNK 1;  2QEX A;  4LFC Q;  4AQY L;  2V6E A;  1I3Q H;  2SGD I;  4QY7 A;  1X54 A;  2I5L X;  1VQB A;  2WP8 J;  3K80 C;  3S2D H;  1N36 L;  2KHI A;  4GLV B;  4OO1 G;  1PJU A;  2EXD A;  3L0O A;  4POF A;  4A3B H;  4OWW B;  4A3F H;  2ZM6 L;  4POG A;  5IP7 G;  1GO3 E;  5FLX c;  3BZC A;  2UUB Q;  3J7Z C;  2GVA A;  1JT8 A;  2JK8 A;  1R79 A;  3PIP A;  2NVT H;  2HQL A;  3KLW A;  3K8A A;  1A8V A;  1FAR A;  3SGQ I;  1B70 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...