2V1CC

Crystal structure and mutational study of recor provide insight into its role in dna repair
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
234
structure length
229
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords RECOMBINATION PROTEIN RECR
publication title Crystal Structure and Mutational Study of Recor Provide Insight Into its Mode of DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 52
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02565 RecO_C Recombination protein O C terminal
C PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2v1cC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2v1cC01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v1cC03
3TRZA 2WB1G 3PIPA 1YJ9A 3JAMi 4JI1Q 4XIGS 2Q2TA 1OXUA 1RL2A 3UDGA 3H3VH 3OTOL 3ICEA 3S15H 4UP9A 4B3SQ 4IPHA 2IHFA 1XMQQ 1HNXQ 1VQ8A 4LFCQ 4LF9Q 4WJ3M 5AJ3Q 3GD7A 4DR6L 1VQKA 1E1OA 4AYBE 4UPAA 4LF8L 4OO1I 3F1ZA 4B3MQ 4IFDG 4L5QA 4JC0A 5M3FG 3UDIA 4IOCA 4DV4Q 3G6EA 4HIMA 1HZ9A 1NBWA 3RLFA 4LF5Q 1KAWA 3T1YQ 3S1QH 4DR7L 4GKKQ 3H15A 2RF4A 2Q2HA 1TWGH 4GNXA 2PQAA 4DK3C 4GNXB 2PNHA 2PQAB 1XPRA 3CMEA 3CXCA 1Q81C 4JV5Q 4R4IA 2ZJPA 4JI3Q 1VQEA 4DAYB 4QQBX 3L0OA 2AWOA 3B6YA 4BBRH 2R6GA 2VQFL 3NBHB 3F2DA 1BBUA 4JBMA 2UU9Q 4GNXC 5FJ8H 1SN8A 1X55A 2BA1A 1IBKQ 2NZOA 4HIOA 1CSQA 3M4PA 1VQ4A 2R7ZG 5M5YH 4JI7Q 1E22A 1EYGA 5M5WH 4C3HH 4POGA 5FJ8G 4JCVE 1BBWA 2ES2A 1HNZQ 1Q1EA 1KRSA 1VQDA 2CCZA 2H5XA 4GN3B 1HZCA 1HR0Q 1L1OA 3L2PA 2MFIA 3OW2A 1P8LA 1PYBA 3HOZH 3HOXH 4IPCA 2B63H 4OO1G 2F4VQ 2K50A 4P73A 1YHQA 3CC7A 2DUDA 3HOXG 1VQIA 1K8GA 2K75A 1B70B 1W3SA 4O0AA 2HHHL 3CD6A 3BZKA 1HZAA 1VQ5A 1N32L 2RCNA 1PH2A 4A3IG 2JA7G 3CCQA 2UUCL 1AE2A 4KHZA 4BXXH 3KFUA 2B29A 1XMOL 2VZAA 5C0XI 2EIFA 2VY3A 3KYHC 4YWKA 3E9IA 4L5RC 1HNWL 1Q7YC 4BXXG 3CC4A 1FVIA 1IL2A 2LSSA 3TS0A 4JYAQ 1FGUA 1CKMA 2NZHA 1RIPA 2YYZA 3FKIH 2PI2E 1K9MC 3U4VA 1E1TA 4GOPB 2JQOA 4A4IA 1EQQA 1XNRQ 3GTOH 4GKJL 4R4CA 3KJOA 1AE3A 1GVPA 3FKIG 1N34Q 1JMCA 3TS2A 3M9BA 4K0KQ 3CCMA 4A3LH 1AH9A 3I56A 2UUAQ 5FLMH 1EWIA 4BA2I 1WCMG 4A3DG 4GOPC 2MO1A 1QZGA 4A3LG 3M4OH 3RZDH 1G6PA 4PMWA 4NXMQ 3HFZB 5FLMG 1GM5A 5LMUQ 4LFAL 2JE6I 1D7QA 4JOIA 5LMNW 1I50H 5IP9H 1QVGA 1SROA 2VL6A 5IWAL 4HJ5A 1MJEA 3E0EA 3F2CA 4X65Q 5HY6A 5IP9G 4X62L 4TVAB 1Q8KA 2JA6G 4DUYQ 1LM0A 2GN5A 5E7NA 2I5LX 3S16H 4IFDI 5IWAQ 2MNAA 4X64Q 1J5EQ 1DGSA 1WFQA 3PO2H 4PG3A 1I94L 3BU2A 2FXQA 1MIUA 4C3IH 5HGQA 2NVTH 4XTCS 3S1RH 4P72A 1VQLA 4LF6L 3CCJA 1WI5A 4DV6L 3PO2G 4NXNQ 3Q8DA 4YCUA 2R93G 2Y0SG 3PO3H 2IHEA 3H0GH 1G291 4A76A 1WYDA 4JI2Q 3HKZE 1OTCA 4DR5L 1JJCB 3PUYA 2CWPA 2NVYH 1ASYA 4A93H 4KHPL 2HQLA 2KHJA 4DV6Q 1PHJA 1Y1WH 2LXKA 1PVOA 1YJNA 1Z47A 2ALYB 1S72A 2VUMG 4B3SL 4LFCL 2I5HA 4GLAC 3CPWA 1XMQL 1HNXL 5AJ3L 2HT1A 4MNOA 2CFMA 3I55A 2EQSA 2A1AA 3CCSA 1P16A 1GO3E 3J81i 1VQJA 5JEAG 3JAMc 5JJKA 4RMFA 3ULLA 1UE6A 2MO0A 2QEXA 4OWXB 1PH4A 2A19A 2NVXH 4B3ML 2BH2A 1EIFA 4B3TL 3A5ZB 3DM3A 1X54A 4OWTB 4DV4L 4R4QA 5EAYA 4DV0L 5M3FH 2KCTA 1N36Q 4LF5L 3UDFA 1CSPA 3J7ZC 3CCLA 4POFA 5IT9c 3T1YL 3D31A 3J7A5 3AFQA 5H1SE 4GKKL 2N49A 3EBEA 3PUWA 4DR2L 4DV0Q 4GS3A 1X9NA 4DV5Q 3RZOH 2F52A 4JV5L 4AYBG 4JI3L 1C7YA 3M85A 1A62A 4UP8A 1Q1BA 1PH6A 1W2BA 1JJGA 1XNQQ 2R7DA 4LW1A 1VQFA 4NPSA 2ZTEA 3D0FA 2YTVA 5IYCH 4DR2Q 2UU9L 4JI6L 1LTLA 2Q2UA 4OX9L 1JT8A 2EXDA 4YHHL 1IBKL 3S14H 4DV3Q 4LF4L 4B3RL 5IYCG 1GKHA 4JI7L 4KI0A 1HZBA 1VQOA 1X6OA 4YY3Q 2R7ZH 1HR0W 1KIXA 3GO5A 1OXTA 1HNZL 4JI6Q 4OX9Q 4YHHQ 4A3CH 1QVCA 1HR0L 4LF4Q 4B3RQ 1C9OA 2D62A 5GQOA 4BA1I 3L7ZC 4P71A 2JA5H 1YHBA 2K5HA 4L5TA 3WWVA 2D0OA 3G71A 1B8AA 3K0XA 4YWMA 4A3CG 2F4VL 1VQCA 5M5XH 2JA5G 3EIVA 4Y52H 4IO9A 1L1OB 1XPOA 2N3SA 2LXJA 2Z6KA 3KF8B 2E2JH 1YBYA 4EQ5A 4JBWA 1YNXA 1VCIA 2AWNA 4O2DA 4DR4Q 3PSIA 4JG2A 3STBC 1L1OC 1X56A 1IBLQ 2IX0A 2A8VA 2K5NA 4GLVB 2Z6KC 4GLXA 4R4OA 1NE3A 4A3IH 2JA7H 3ER0A 4PZ8A 1VS0A 3VDYA 3S1NH 3HKSA 3ULPA 1XJVA 3F2BA 3HOVG 2UXCQ 1MJCA 1PYSB 4X66Q 4JYAL 1Q12A 2PI2A 2R92H 4DR1Q 4JI0Q 1CKNA 3MXNB 1CKNB 2VW9A 1M90C 3CF5A 1FJGQ 4DV7Q 5BR8Q 4AQYQ 1XNRL 2UXDQ 2ATWA 1N34L 4K0KL 3M7NA 2R92G 3EN2A 1GD7A 2UUAL 2OTLA 2IX1A 1NY4A 1U0LA 1UE5A 3HOYG 1J6QA 4IPGA 1N33Q 1WCMH 5C4XH 4A3DH 4NXML 2I5MX 3I7FA 5LMUL 3K7UC 2D0PA 3TEHB 1X3FA 2QGQA 3I2ZA 5C4XG 1QUQA 1QUQB 1N9WA 4X65L 1V43A 3GTJH 3JC66 4GN4B 5IYBH 2NN6G 3MEFA 3PUXA 4DAMA 4P75A 2VQEQ 4DUYL 2YU9H 5GROA 2JEAI 2B3GA 2RHSB 1EIYB 2JA6H 1VQBA 1K3RA 3ULJA 4X64L 2K14A 1J5EL 5IYBG 1E24A 2UXBQ 2ZM6L 4AIMA 1M1KC 1PH1A 1QVFA 4JOIC 1JB7A 4DR3L 1XTDA 2MQHA 3IRBA 1VQ9A 2JA9A 1R9TH 4NXNL 2WAQE 1FL0A 2K52A 1NJIC 1HJPA 4IPDA 3A0JA 3S24A 1X65A 5FLXc 2ZM6Q 4ALPA 1YI2A 2R93H 4JI2L 3UDXA 3CC2A 4DR3Q 2IT1A 3TQYA 4JI4L 4A3BG 1PFSA 3HOUH 1U5KA 5IY0A 1YVCA 1E3PA 1TWHH 4LNQA 2KBNA 2NVQH 2I0QA 4DV2Q 1K0RA 2YTYA 3GTMH 3HOUG 2VUMH 4UP7A 1NMFA 1OXVA 3K81C 1OXSC 2N8NA 2OCEA 3CCEA 1UE7A 1V1QA 1K8AC 4JI5Q 2JK8A 2PMZE 4YWLA 3K80C 5LMNQ 2CKZB 4LUOA 1NMGA 3HKZG 3J80i 3U4ZA 4A3KH 1VQNA 2XGTA 3J80c 1QZHA 3U58A 4A3EH 3GTLH 4MZ9A 1N36L 4OWWB 5GADC 3J81c 1XPUA 2Z0SA 1BVSA 3G48A 1I5FA 3FP9A 5ELNA 1SRUA 2E8GA 4DUZQ 2BH8A 4A3KG 1IBMQ 2UUBQ 1VQGA 1Y1VH 1NTGA 1S3OA 4P74A 2KHIA 3CCVA 4A3EG 3K7AH 3NEMA 1A8VA 1TWFH 2CQOA 4DV5L 1Y14B 1UE1A 4Y7NH 5M3MH 3T1HQ 1TWCH 4YCWA 3CW2C 1Y1VG 2WB1E 1XNQL 1TWAH 3W1GA 5C44G 1PH9A 5IYDH 5M3MG 1A0IA 4DNIA 3CQZH 3BJUA 2K4KA 4H02A 4QY7A 1IYJB 1O7IA 1PH8A 4DV3L 2HIXA 1VQ7A 4JI8Q 3W1BA 5IYDG 4IFDJ 3KF6A 3I4NH 1A63A 1YHAA 2ZTCA 2N78A 1BKBA 3KF6B 1S40A 1UEBA 4YY3L 1PV4A 4LFBQ 1KXLA 2OTJA 4DV1Q 4B3TQ 5IE8A 4JI4Q 3I4NG 3RLOA 2ZTDA 2R7FA 2ID0A 4QL5A 1Q82C 3AYHB 1KL9A 4IJLA 4R1JA 5J3BA 1MKHA 3OTOQ 4DKAC 4YCVA 5C3EH 4DK6C 4DR6Q 3W5OA 3KDFA 3KLWA 3KDFB 1ASZA 2OWOA 5JJIA 1KD1C 1KQSA 1Q86C 2WFWA 2CWAA 5C3EG 4LF8Q 4ME3A 3RLNA 3CMAA 4DR4L 4HIDA 2QA4A 4KLKA 1IBLL 3NENA 2AHOB 4MTNA 2F3IA 2NN6I 3CCRA 4DR7Q 1K83H 1VQ6A 2WP8J 3S1MH 3RN2A 4LUZA 1YITA 2UXCL 3I4OA 2ZJRA 3E9HA 4X66L 3CCUA 5DLQE 3UE1A 3HOVH 1V9PA 1X3EA 3PF4A 4DR1L 4JI0L 1FJGL 4QIWE 4BBRG 1LUZA 4DV7L 5BR8L 2YV5A 4C3JH 4AQYL 1UWVA 2JEBI 4IJHA 2E2HH 2VQFQ 3S2DH 2UXDL 4OONA 4APVA 4JBJA 1B7YB 3K8AA 5ELOA 3GTGH 1PH7A 3DLLA 1H95A 2HIVA 3RR5A 3M4QA 1OXXK 1SR3A 2C35B 2KENA 1N33L 4HJ7A 2V1CC 4RG1A 1G51A 1KC8C 4LWCA 1WOCA 2KCMA 3CAMA 2ZJQA 3HOYH 1SFOH 2JJQA 3CP0A 3CPFA 3HOZG 3OYYA 2B63G 3KOJA 2K5VA 4R4TA 4TQUS 1N8RC 4BY1H 3RN5A 2DGYA 1VQAA 1SE8A 1JE5A 2VNUD 4AH6A 2VQEL 3TREA 4BY1G 1VQHA 2GVAA 2L15A 1EFWA 4EX5A 1WJJA 3A5UA 2E5LL 2UXBL 4A3JH 2OQ0A 3ZJYC 2HHHQ 1CUKA 1X3GA 1N32Q 3RNUA 2E5LQ 4FDBA 2UUCQ 4KHPQ 4A3JG 1VQPA 4LF7L 1E7ZA 4DPGA 1XMOQ 3AQQA 4WJ4A 4X6AH 4A3MH 3AFPA 3S17H 4GOPA 5K36G 1L0WA 1VQMA 4OXPA 4A3FH 1Q46A 1HNWQ 1YEZA 4QJFA 2VS1A 4BBSH 1I6HH 4A3BH 4A3MG 5IP7H 5GAGC 3GTKH 4LF7Q 2RHQB 3PUVA 3PIOA 4A3FG 3PCOB 3A74A 5GAEC 4DV2L 3ERSX 1KRTA 4HIKA 4BBSG 1Z9FA 3I4MH 4GKJQ 4QGUA 5IP7G 1EUJA 3M3YH 2AKWB 5C4JH 3KJPA 1PH5A 1KHIA 2WAQG 3PV0A 4JI5L 2E2IH 3I4MG 2AMCB 4JBKA 5LMNL 3GTQH 1T9HA 3NELA 5C0XJ 2YTXA 2IY5B 1YIJA 3UE0A 3H3VI 1PH3A 1C0AA 3AEVA 4LFAQ 1LYLA 3BZCA 4LUVA 3SGIA 1I3QH 1SMXA 2UUBL 2XTIA 4GN5A 4DUZL 1TXYA 2Y0SE 1IBML 3LGJA 5JJLA 3HOWH 2JA8H 1L2FA 4X62Q 5C0XG 4PZ7A 4J15A 1EOVA 3T1HL 1SLJA 4L5SA 2ASBA 2OQKA 3PGZA 3GTPH 3HOWG 2JA8G 1D8LA 4UY8C 1IZ6A 4C2MH 3STBD 4HJAA 2BA0A 1IXRA 1I94Q 4A3GH 2GVBA 3FHWA 5C44H 3PF5A 4BY7H 4NB3A 4HJ9A 1YJWA 1YZ6A 4IOAA 3S2HH 2Q2IA 5JEAJ 3J81j 4LF6Q 3PO3G 4JI8L 3H0GG 1HH2P 3GDEA 1EQRA 4JI1L 3U50C 4HJ8A 4A3GG 4BY7G 4LFBL 3F8TA 4A75A 4A93G 4PZ6A 1K73C 4LF9L 1PA6A 3PUZA 1CKOA 4DR5Q 1Y1WG 4DV1L 3G4SA 5GAHC 1JJ2A
chains in the Genus database with same CATH superfamily
5J8FA 1SEBD 2OU2A 2LMCB 4XIGS 4K5XA 3IAS1 3H3VH 1K7VA 3S15H 4UP9A 4IPHA 4LF9Q 2XRSD 3GD7A 4IN3A 5AJ3Q 4DR6L 1SE4A 2K05A 4IFDH 1C8CA 1CQFA 1LR9A 2K1BA 4CJ2C 5EQ0A 3BS1A 1O80A 3RLFA 2HDLA 2C9OA 1B50A 4L9MA 1EIHA 3T1YQ 2NYZD 3TN2A 3S1QH 4DR7L 1WTJA 4IUTA 3CRKC 5C5LA 3NWTA 4DK3C 2EDGA 1Q81C 2J4XA 4R4IA 2ZJPA 1VQEA 1HCZA 3DMUA 3B6YA 2B2YA 2R6GA 4XYQA 3NBHB 3F2DA 1PYWD 2UU9Q 5D14A 2KCXA 4TKOB 1IBKQ 4RGMA 2NZOA 3RMHA 3URYA 1CSQA 2LFNA 1I4RA 2R7ZG 4JI7Q 4C3HH 4POGA 4JCVE 1BBWA 4FXKC 1FR3A 2XN9C 1VQDA 2F0JA 4A3IB 2JA7B 2P6AC 1PFMA 1HR0Q 2MFIA 1WKXA 3OW2A 1P8LA 3SK4A 3J7YW 2BOSA 2CWGA 4UXJA 3JSBA 4NV2A 2F4VQ 2NUCA 1KMAA 3HOXG 4BWGB 4K8JA 1KABA 2IL8A 3SE0A 3QG1A 5T1GA 1HZAA 1EY0A 2RCNA 1PH2A 5KNDA 5FLXL 2UUCL 4KHZA 3W3AA 2GSCA 1DCZA 4FXGC 3PDNA 5JVG3 2Q8RE 2VZAA 1WTOA 1XWEA 3TOAA 3KYHC 4YWKA 5FLXE 3E9IA 1SMYC 1Q7YC 2GKRI 2K19A 2PYKA 1Y8PB 1O78A 3M4OB 2PI2E 3V96A 1FNVA 1F2YA 2JQOA 1EQQA 4R4CA 3KJOA 1ZYRC 3FKIG 1KNEA 1AH9A 3EJIA 2J87A 1A2TA 2XRCA 4BA2I 1WCMG 4A3DG 4DAVA 1IW7C 4C1NK 1U4MA 4AS3A 2E73A 1G6PA 2B39A 4NXMQ 3S16B 5LMNW 2NWGA 1EIGA 2YUUA 2KEDA 1SROA 1H9SB 3PO2B 1JOQA 2Y0SB 4X3SA 5HY6A 3C1EA 5IP9G 2PW5A 1Q8KA 4DUYQ 5CV9A 4Z7GA 3D8GA 1HHVA 1WD0A 1ENFA 4PG3A 4C3IH 1BUSA 3HZXA 4P72A 1TY2A 3CCJA 4LF6L 4OL7A 4DV6L 2JYOA 3DWQA 3PO3H 2IHEA 1ET6A 3H0GH 4A76A 1S5ED 1TT2A 3PUYA 2NVYH 4DV6Q 2KHJA 2LXKA 1PVOA 1Y1VB 1Z47A 1YJNA 1B1ZA 3K7AB 4GLAC 3CPWA 1HNXL 4Y7NB 5M3MB 3FSXA 3I55A 4HN7A 3J81i 3BJIA 4WORA 3SDZA 1LV9A 1M8BA 4OWXB 2A19A 1EL0A 3UI2A 4B3ML 2MPMA 4RA8A 1CT1D 2N88A 3A5ZB 5CR3A 2PZWA 4KY5A 4R4QA 4DV4L 1Y1CA 2V53A 4BS9A 4Z7HA 1N36Q 4LF5L 2LS01 4XQJA 1PMRA 2ICIA 2EYHA 1X74A 3AFQA 5H1SE 1ICFB 2N49A 1YO7A 3S14B 3PUWA 4GS3A 5A2QL 4DV5Q 3RZOH 2F52A 3BVGA 4UP8A 1PFNA 1Q1BA 1EY5A 1PH6A 1JJGA 4NP5A 1XNQQ 2R7DA 2GIVA 2A6HC 3VA5A 5IYCG 3MFYA 1HZBA 5KYLA 1EYCA 2V4DA 3OHXC 4IALA 2HUGA 2W0TA 1HNZL 1HRJA 1ULKA 1GUSA 2JA5H 3GQBA 1YHBA 2ORWA 5I2XA 3F2UA 7WGAA 4PL4A 4IO9A 2N3SA 4KJOA 3S2DB 5E3RA 4JBWA 2AWNA 4PL5A 4JG2A 3HG9A 1L1OC 1IBLQ 1AZPA 2A8VA 4TRDA 4GLXA 1I6VC 4A3IH 2JA7H 3HKSA 2UVOA 2L12A 3ULPA 2F3WA 3FC3A 3F2BA 2FFKB 1DM0B 1MJCA 3A55A 1XBTA 4BY1B 1X3PA 4JI0Q 2YFAA 1WTRA 1STEA 1M90C 3T51B 4K0KL 1X32A 2R92G 2K5QA 4H7BA 2BE5D 3K0YA 2DNEA 3KY9A 1U0LA 3H94A 1WTWA 1IY6A 2D9UA 3K7UC 2NU0I 1NR4A 4PQXA 2OD1A 4RWSC 4SGBI 1BOSA 1QUQA 4OAVB 1RTNA 4LAAA 4X65L 1V43A 1HFGA 4B9XA 1RD9D 4A3BB 4N8FA 1LTSD 4DAMA 2JEAI 2YU9H 5JHWC 5GROA 2X6LA 2B3GA 2RHSB 1ZXTA 4N8X1 1K3RA 5ELCA 4X64L 5IGGA 2UXBQ 3M3YB 4JOIC 4DR3L 2X3TA 3A0JA 2F0VA 4ALPA 1YNNC 5D65A 1H9MA 3NWSA 3UDXA 4DR3Q 1XX6A 2IT1A 3EFXD 3TQYA 2KEEA 3BYTB 1GJXA 1U5KA 3T53B 4XQNA 5IY0A 4FYDA 1G2TA 2JA8B 4LNQA 2KBNA 2I0QA 4M1UB 4DV2Q 3OXFA 3VDPA 4A3EB 5KIXA 4RGOS 1NMFA 1HFNA 3A8JE 3CCEA 1YTPA 4E1PA 5C44B 5LMNQ 2RA4A 1SXTA 1ICWA 1D1IA 1NMGA 2PZTA 5G3LF 3U4ZA 1VQNA 3J80c 4KY6A 3U58A 3GTLH 2JZMA 3GTPH 3J81c 1Z7KB 1SRUA 4A3KG 5FO9B 1LLRD 4RGTA 1Y1VH 1PTRA 3KLSA 3I9V1 4P74A 2KHIA 3K7AH 2CQOA 1JWUD 4KHVA 1UE1A 4Y7NH 5I6WA 5M3MH 3T1HQ 1DZ1A 5FUYA 3FEWX 4AMLA 1B53A 2QW7A 2Z4IA 1PH9A 5IYDH 5JOBA 1A0IA 4EGVA 5EBDA 3CQZH 2XRQD 4C1NI 1IYJB 1MBYA 4JI8Q 4IFDJ 1BCPB 1S40A 4U68A 2KUMA 4A24A 4ZKCB 1CE3A 4CKEA 3RLOA 2R61A 3C3LA 1Q82C 3AYHB 1D5XC 5JPMC 4DKAC 3TO9A 4YCVA 1TWGB 1Q3LA 2EYPA 1VMPA 4RFBA 3KDFB 1KQSA 4LF8Q 3H91A 4BBRB 2F0SA 2AUJD 3RU0A 3IFDA 2QA4A 3SHLA 1LTTD 1O7LA 5EKIA 5AFWA 4ZK9B 5M5YB 4C3JB 3WOFA 2CW0D 2PCFB 2KVMA 1VQ6A 3RN2A 4X66L 2N52A 4X3TA 1PRTD 1D2BA 4H13C 3HOXB 3NK9A 1FJGL 2YV5A 1RKNA 3S2DH 3SGQI 1PZKD 1XTCD 1OXXK 1SR3A 2YFBA 1N33L 1S20A 1CA5A 1G51A 4LWCA 5CCLA 2JJQA 4NMZA 4XXEA 3HOZG 5IGCA 3UITA 2B63G 2K5VA 5IGDA 4R4TA 4TQUS 4BY1H 2O2LD 3SDJA 5E4WC 1V8QA 1VQAA 5CV6A 3D00A 1VQHA 1WJJA 3AJFA 1SAPA 4DGZA 4BBSB 1NUBA 3GTKB 1NNXA 1X3GA 2A6EC 5K36H 2SGPI 3RNUA 3UFFA 4FDBA 1NCVA 1VQPA 4Q9VA 5TSSA 2KMQA 1F2LA 1FYCA 3AQQA 1L0WA 4U6RA 2X52A 1I50B 2RC4A 1MSHA 2VS1A 1DD2A 2WKDA 1E0BA 4A3BH 3UGIA 3LJ1A 3L3OC 3VA7A 1CHOI 2RHQB 3PUVA 4HIKA 1Z9FA 1SBBB 3I4MH 4QGUA 5IP7G 3M3YH 1EOTA 3ZYYX 5C4JH 3OMCA 2JB2A 3VR3A 4JI5L 2E2IH 3HOWB 4ID6A 3R93A 2IY5B 1PTOD 1PRTB 2PZUA 1V1PB 3B55A 3AU7A 3SGIA 2XTIA 4DUZL 3KP9A 1IBML 5JJLA 5FUWA 2ELIA 2JA8H 4WP4A 2LUYA 1V1OA 4X62Q 2ICEC 1Y1WB 4PZ7A 2F0NA 4O1OA 2ASBA 2BL8A 1QOHA 1R4QB 3PGZA 2WB1B 3P1HA 2EYMA 4UY8C 1IZ6A 4C2MH 4HJAA 1BQQT 1I94Q 5C44H 4HJ9A 1UEAB 3E6ZX 4S3SA 5BN3A 4IUQA 1I4QA 1TQOA 3S15B 1GUGA 2LKVA 1HH2P 3U50C 4A3GG 3OWEB 4HJ8A 3F8TA 4A93G 1HQRD 2MP1A 4DR5Q 2B0UC 2CWHA 1C48A 4DV1L 3G4SA 2OEOA 1VQOA 4DNRB 2ZT9C 4K6LA 4B3SQ 4LFCQ 3SGBI 5LL6X 2SGQI 1S4ZA 4RH6A 1UVGA 5I9PA 1LTAD 2G9DA 3I70A 5M3FG 3UDIA 1BNZA 4IOCA 3G6EA 3NUCA 4RCNA 4HIMA 1WTHA 3MZ5A 2NU3I 3I91A 4IQZA 3R5AA 2WACA 1G6ZA 1K7UA 2P5ZX 4G7HC 1HEVA 1NSNS 4WFN3 1TWGH 1X9NA 2GKTI 3FVVA 2PNHA 2PQAB 1EZ8A 3CMEA 4GNXB 1VDZA 4C3HB 1OYVI 1TGSI 3HP3A 2DIPA 4BBRH 2VQFL 1BBUA 4KV6A 1CHQD 4QCLA 2E2JB 5EX3A 5CBEE 4HIOA 4HMIA 4CDCC 5M5YH 1EYGA 3SK5A 5FJ8G 1F2ZA 2SNSA 2XNAC 3MA2B 2ES2A 4R8IA 5T1IA 2CCZA 2H5XA 4KTAA 3TZUA 4NDXA 3QIAA 1AN8A 3HOXH 1B3AA 2B8FA 4K2KA 1QWYA 2CWFA 2DB6A 4OO1G 3TZDA 1R79A 4OEMB 3CD6A 4OAUC 3BZKA 1N32L 1VQ5A 1FYBA 3CCQA 2G5DA 3KFUA 1F2MA 1NAPA 1XMOL 2Y0MA 5FKAC 3VYTA 4L5RC 1HNWL 2EJMA 4KD4A 1RDPD 1FGUA 2AQ2B 2K5DA 1M4VA 1RIPA 3FKIH 2V6EA 1K8MA 4DK0A 1TR5A 1K9MC 1E1TA 1E2ZA 3CKIB 1XNRQ 4GKJL 5CC4A 4ZCKA 4H44C 1AE3A 1GVPA 2JXMB 1N34Q 1JMCA 1HA5A 3M9BA 2FMMA 4DAPA 4UXHA 1EWIA 1B3QA 3O13A 5FK9C 1TIID 4A3LG 3J80L 3OOCA 3OSOA 4PMWA 4RHSA 3HFZB 4LFAL 1D7QA 1I50H 5IP9H 3J80E 4IUVA 3K57A 1H9SA 3MAQA 4HJ5A 3J81E 5KYIA 1I4HA 4FNFA 4C3IB 1GUTA 4LMQD 3TP5A 5BN5A 1HXYD 2JA6G 1G2SA 2QGMA 2GN5A 4IFDI 2I5LX 4DXFA 1WFQA 2NVYB 2F0OA 3NSWA 3BU2A 5IOCA 1MIUA 5EPJA 1MD2D 5HGQA 2NVTH 4XTCS 5C5MA 1VQLA 1WI5A 2R93G 2ZXOA 3C46A 2ETDA 4A3KB 1G291 2DY8A 1A3UA 2F0TA 4JI2Q 1STHA 3QWNA 4KHPL 4RAUC 2Q8IB 1Y1WH 4G4KA 4HSPA 2ALYB 1RTOA 1TVXA 2VUMG 5AJ3L 2CFMA 2A1AA 3OL0A 4TSSA 1X3QA 5JJKA 4RMFA 3ULLA 5C4ZA 2MO0A 2PQEA 3EROA 3RZOB 3OXLA 3DM3A 3P20A 1VF5C 1MJAA 5EAYA 3SR1A 2EYLA 3UDFA 3T1YL 1BBXC 4OIJA 1WTQA 2PNRC 4DR2L 3SK8A 4AYBG 3VDUA 2M5XA 1OVOA 1LR8A 1W2BA 3NTHA 5EPLA 1VQFA 5IYCH 2YTVA 2EVBA 4DR2Q 2UU9L 2Q2UA 1JT8A 2JA5B 2E75C 2EXDA 1IBKL 4E1RA 4HFVA 2XWJB 3C1FA 4JI7L 4YY3Q 3SEKC 1STBA 1II3A 2NU4I 5CMDA 1SYFA 4OELB 2F0LA 4OIKA 3T56B 1HR0L 4BA1I 4P71A 1K83B 2K5HA 2B2YC 3WWVA 1PTOH 3G71A 1B8AA 1N13A 1KBFA 2JB3A 2F4VL 3HOVB 4J1MA 4Y52H 3G6JB 3D6CA 1S5BD 4FF2A 3KF8B 3C2PA 2E2JH 1YBYA 1F9QA 1YNXA 1EEID 4X3UA 4DR4Q 3PSIA 2M2LA 1UUPA 1QG7A 4R4OA 1NE3A 3MEKA 3HOYB 2X6GA 5DAEA 2V1CA 1LABA 3DO9A 1PYSB 1EY7A 1RJTA 2R92H 1IY5A 3KBGA 1STGA 5BR8Q 2UXDQ 4N9PA 2ATWA 4O42A 3M7NA 3FSYA 3EN2A 5EKKA 1BXTA 1CK1A 2KCNA 1AN1I 1SYGA 1UE5A 2RIJA 2KCCA 2YU9B 4NXML 2I5MX 2BCOA 2ZRRA 2F3VA 2Z8LA 1X3FA 3PIP3 1B9NA 4KY7A 4J8QA 1CI3M 3JC66 2Z1CA 3MEFA 3PUXA 3AB9A 2IJ0A 2VQEQ 4DUYL 2J9RA 3ULJA 1PZJD 1LT6D 5IYBG 1E24A 2F0HA 1HPTA 4U673 1LT4D 4ULLA 1R0RI 4GI3C 2JA9A 1R9TH 3GTQB 1FL0A 4FP5D 2K52A 1NJIC 2E5RA 4DF7A 1YI2A 2K03A 1XA6A 1I3QB 4G7OC 1CFMA 1E3PA 1L0XB 4LK1C 1QE6A 2JA1A 3GTMH 3HOUG 3GTLB 4DK1A 1OMUA 3GTPB 1YNJC 3K81C 2A73B 3NHHA 2N8NA 1UE7A 2PMZE 4EQNA 4YWLA 2CKZB 2A68C 4LUOA 1G91A 3HKZG 3IKJA 3J80i 4A3KH 1SGQI 5COYA 1K0SA 2NTSA 1QZHA 3E0JA 4N9TA 4MZ9A 1N36L 5ELNA 3CQZB 2RCFA 1S3OA 3CCVA 3NEMA 1AZQA 4DV5L 1PXUA 4YCWA 3TDQA 1XNQL 2BE5C 2F0KA 1CA6A 3W1GA 3R5BA 4DNIA 3BJUA 4I7ZC 2K4KA 1PH8A 2CJSC 1VQ7A 2HIXA 3TP7A 1F9PA 4XDXA 5A2QE 2EY5A 1SMYD 1STYA 1A63A 1YHAA 2ZTCA 3KF6B 4LFBQ 2L8EA 1PV4A 3QB3A 5CV4A 3I4NG 4B3TQ 3T13A 4JI4Q 1WGCA 1BCPC 2F1MA 2EYJA 5IGFA 1AP0A 1MKHA 3OTOQ 3MTSA 1BCPF 4JVZA 1LTRD 3KDFA 2IP6A 3KLWA 5C6AA 5EX0A 1RODA 5C3EG 4B6DA 1S5FD 3NXWA 2KOLA 2WGCA 4I1TA 2B8GA 3CHBD 4HIDA 1IBLL 2NTTA 1TU2B 5FUVA 1T5XD 2F3IA 2NN6I 4DAYA 4IUPA 4UXIA 1K83H 1SDFA 2EJGC 1NUCA 4IURA 2FUG1 3CCUA 4YZ9A 3HOVH 1I4XA 1PFBA 3FPPA 2QDBA 4JI0L 2A69D 3ND9A 2E2HH 4IJHA 4OONA 4APVA 2NB0A 1NR2A 1B7YB 1TY0A 1EWCA 4QB4A 2HIVA 3K58A 3CU7A 2C35B 5LHY1 3QR8A 1I4GA 1B44D 1XX8A 4RG1A 2KMPA 3M7GA 1KC8C 1WOCA 3HOYH 3I4LA 3KK7A 1CT0I 2JB1A 1CM9A 3CPFA 1HUNA 2LEOA 3KOJA 1JOOA 4HEDA 1LTBD 1N8RC 4DWLA 1SYDA 4PL3A 5IGBA 1JE5A 2QQ0A 2DJGC 4AH6A 2GVAA 2NN6H 2BUSA 3BDOA 2SDFA 5D3DA 2OF1A 4EX5A 2E5LL 4FXDA 1BMOA 2NU2I 4OVOA 2Z4HA 3K5LA 2UXBL 1ULNA 2HHHQ 1CUKA 2L4NA 5ELBA 4O1NA 2E5LQ 4A3JG 4HMJA 4YZCA 2K33A 2MHVA 1E7ZA 4DPGA 3I4MB 3U9SA 4CDEC 4GOPA 1RHPA 1QCBD 5C4JB 1VQMA 1WGTA 4QJFA 2E2IB 2J7ZA 4A3MG 5IP7H 5GAGC 3D3RA 1PTQA 4A3FG 1SNCA 3A74A 3PCOB 4DV2L 3ERSX 1KRTA 4ZAIA 4L6TB 1CT2I 2WAQG 1EY4A 1EQTA 1ML0D 4JBKA 1LT3D 5LMNL 3GTQH 2K28A 1T9HA 1XYIA 1V1PA 2CW0C 1C0AA 3AEVA 3DHQA 1HJAI 3BZCA 2FJ2A 1I3QH 1SGEI 4C2MB 5IODA 4GN5A 1PRTC 1HDLA 1FY7A 4HEA1 3TP8A 1PRTF 4J15A 3T1HL 4L5SA 2OQKA 1HTLD 1MSGA 2N1AB 2RDGA 2BA0A 4A3GH 4NB3A 1SSOA 3VR5A 4IOAA 1J9OA 2Q2IA 3PO3G 4JI8L 3H0GG 4JI1L 2E76C 4ABNA 1PA6A 3H3VC 3DEOA 5HGIA 1JJ2A 3TRZA 2J0TD 3PIPA 4AYBB 1YJ9A 4JI1Q 2AQ1B 2RDFA 3UDGA 3ICEA 3A7AB 1K8OA 2IHFA 1XMQQ 4WJ3M 2RKSA 1VQKA 4AS2A 3OIQA 4AYBE 1FAQA 4UPAA 4LF8L 4OO1I 1SNQA 4V0BA 3HH2C 4PMBA 1FGBD 4JC0A 3MEHA 1EY8A 2GKVA 1O7ZA 3TBIB 2GVIA 1NBWA 1KAWA 1IKMA 2R7ZB 4I7AA 4GKKQ 1ZKOA 1B2TA 3H15A 4CDFC 1QILA 2RF4A 2Q2HA 1CTMA 5EKLA 4G76A 4GNXA 2PQAA 4JV5Q 4JI3Q 1DONA 3N52A 4DAYB 3LNNA 2WVJA 3VE5A 2AWOA 5M5XB 2ORVA 3OPOA 3K6OA 4GNXC 5FJ8H 1VQ4A 1CGII 1E22A 2SGDI 1Q1EA 1KRSA 4GN3B 4OO1H 4B08A 3L2PA 3S1NB 1JWSD 1DXMA 4RHRA 1PYBA 1V1HA 3T16A 3M4YA 1JCKB 2XWBB 1GUWA 3E5SA 4HCSA 3CC7A 1VQIA 4G7ZC 1K8GA 3F4MA 1FNUA 4IZ8A 1B70B 1U4PA 1W3SA 4O0AA 5F2DA 5M9OA 3FKIB 3E3XA 3R3OA 4A3IG 2JA7G 1MJBA 2L5TA 1AE2A 1VF7A 1WCMB 4A3DB 5C0XI 1CSOI 2EIFA 1VDDA 2VY3A 1W6JA 4BXXG 1FVIA 1IL2A 2LSSA 3TS0A 2HCCA 4JYAQ 2JXDA 1CKMA 3Q23A 2SGFI 3I73A 1IKLA 3GTJB 3U4VA 4GOPB 1WD1A 1BDOA 1BR9A 3DUZA 3DWPA 4A3LH 2P22B 3I56A 1GXDC 2UUAQ 3OVOA 2X69A 5HI7A 1QZGA 2QQEA 3PQIA 3H09A 4MPIA 2IW3A 5FLMG 1GM5A 5LMUQ 4IUUA 4GXTA 5IWAL 2O5IC 1TBRR 5DEHA 2NVTB 1HPCA 4MN3A 2RBMA 1QNKA 4X62L 1EFID 4DA2A 2C5CA 4DN4M 5E7NA 5JVH3 2SEBD 5C0XH 5IWAQ 2JSOA 3MHBA 2MNAA 1J5EQ 2DKVA 3FMCA 1I94L 1D6EC 3BVMA 1GUOA 1EU3A 2HD3A 3E2IA 2K5WA 2K7VA 5E4XA 2IX3A 5EPKA 2K32A 3PO2G 4NXNQ 3IAM1 3UOEA 3Q8DA 3I90A 2ZXPA 4YCUA 2Y0SG 1F9SA 4M8AA 1WYDA 2B2WA 4KN7C 2KMRA 3HKZE 1OTCA 2ZW3A 4GZYC 4DR5L 1JJCB 2CWPA 4J6HA 3R5DA 3I8ZA 1PHJA 9WGAA 1S72A 2B2WC 4B3SL 4LFCL 1KBEA 1TWFB 1M8AA 4NW2A 2HT1A 4MNOA 2B8TA 3OMGA 1TWAB 1VQJA 5JEAG 2QEXA 1UE6A 5ELFA 3KLSX 1XXGA 1IL8A 1Y8NB 1UVFA 2OVOA 4FKDA 4DV0L 2KCTA 2MJFB 5J8CA 3J7ZC 3J7A5 1CT4I 3EBEA 1TURA 4DV0Q 2H1EA 2BDNA 3M85A 1A62A 4NPSA 3D4WA 2A6ED 3BYYB 1JORA 1PZID 2YQPA 1LTLA 2A2DA 2DNCA 4KD3A 1PTOB 4DV3Q 4DNCA 1GKHA 4DNTB 2QZGA 1EYAA 4KI0A 1X6OA 2R7ZH 2Z9HA 1HR0W 2L55A 3MVVA 1QVCA 2DJFC 5I6YA 1C9OA 4KJNA 2DY7A 3L7ZC 1SGRI 4L5TA 3S1MB 4CKCA 2D0OA 3K0XA 4YWMA 4A3CG 1BUVT 1KDAA 2L9HA 4ME5A 5KGUA 5M5XH 3EIVA 3KLRA 1UHAA 1WVLA 5HQ8A 3FVQA 3KF8A 1SNPA 2JN4A 1STNA 3GTGB 3STBC 2R92B 1X56A 2IX0A 1AFPA 2K5NA 4GLVB 1Y69U 2FINB 3ER0A 1VS0A 3VDYA 3S1NH 3U9OA 1SFOB 4FF4A 1KNAA 2UXCQ 4OGQC 1Q12A 2PI2A 3D6WA 4DR1Q 1SGYI 1CKNB 1FD7D 2WINB 2VW9A 4DV7Q 2RADA 4AQYQ 1XNRL 1N34L 1TUSA 2I07B 4CBVA 1IYVA 1NXUA 1SGDI 1YU6C 1J6QA 4IPGA 2CHBD 3HRZC 1WCMH 4A3DH 2GA4B 3FDTA 1BO0A 2QGQA 1PDQA 3P7JA 3QOLA 5C4XG 4A3MB 2Q8TA 3S17B 3L9AX 4F8MA 3GTJH 4GN4B 2WCYA 1TS3A 4HCEA 5IYBH 1I6HB 2QILA 1R9TB 1SE2A 4E6IA 3HGBA 2K01A 3VR2A 3BZDB 1EIYB 4RCOA 2F6MB 2K14A 2RSNA 4CJ0B 1LT5D 2FNFX 2XVSA 1M1KC 1W4RA 1QVFA 4IUNA 3ND8A 5CORA 3J7AV 1SNMA 2WAQE 3GTMB 4IPDA 1FNWA 2CVRA 3LJ2A 4JI2L 3NBIA 4A3BG 1DOMA 1PFSA 3HOUH 1TS2A 3JAML 5KNBA 5E3FA 1JOKA 2NVQH 3JAME 1K0RA 2YTYA 4DFAA 4K5WA 4UP7A 4ZRZA 5FO8B 1OXVA 1DS3I 1OXSC 2K9HA 2OCEA 5EGTA 4CKBA 1V1QA 1K8AC 2CAZB 2JK8A 1L0YB 3P23A 2EOTA 3K80C 1F77A 3S2HB 1JR0D 2XGTA 2A74C 4PMCA 1UAPA 5DAUA 1I5FA 3FP9A 2UUBQ 2E8GA 3QTLD 3CXLA 1NTGA 4XQQA 4R8NA 1GUNA 4A3EG 1A8VA 1TWFH 1MJ9A 1EQVA 4YZDA 5E1FA 3J7AF 3CW2C 3H6MA 1TWAH 5C44G 3V05A 2G9HD 5A35A 3V2TA 1O7IA 4C56C 3SEBA 2XTQA 3KF6A 3I4NH 2N78A 4YY3L 2RLDA 1KDBA 1CHPD 3R2IA 1EWHA 2FMCA 1KXLA 3MXPA 1AEXA 1G8ZD 5IE8A 3K59A 2K6AA 2ID0A 2R7FA 3Q22A 1PPFI 1GOZA 4R1JA 5J3BA 5C3EH 1JWMD 4DR6Q 3CRLC 3W5OA 2VRWB 3D4DA 1H9RA 2EYOA 1DJRD 4K5VA 1D5ZC 1D1KA 3K5NA 1FARA 4DR4L 4KLKA 5CGKA 2A2CA 1Z7TA 3NENA 2AHOB 4MTNA 4QMGA 2E2HB 5M5WB 1HTPA 3CCRA 2QEJC 4DR7Q 3S1MH 2KECA 3TP6A 1YITA 3DA3A 3I4OA 3E9HA 3UE1A 3HOZB 1V9PA 2ZXRA 4CHTB 3KUPA 2OZUA 1KAAA 1QJOA 1SYEA 2B63B 4BBRG 3DXJC 5BR8L 3DEPA 2UXDL 3EA6A 3NTIA 4JBJA 3S9WA 3K8AA 5KNCA 3GTGH 1PH7A 3DLLA 4K2LA 2XSCA 1Q8IA 3I3CA 4ILWA 4C3JG 5I2YA 5IGEA 1H95A 4MTKA 3FPUB 4MHEA 2KENA 4HJ7A 2V1CC 2AQ3B 2KCMA 3CAMA 1LTID 2EY1A 1SFOH 3CP0A 4KKTA 1QB5D 2EYFA 5JJZA 5DM63 2KHSA 2F0PA 3LJ0A 2EJFC 1SE8A 1DOKA 2VQEL 5FOBB 2RQXA 3GTOB 5C3WA 4QUFA 4A3JH 3ZJYC 2WKCA 1PJUA 2I46A 3DM1A 2KQ3A 5CCMA 5CV7A 3OIPA 1V1IA 2ERWA 2UUCQ 1ENCA 3RZDB 4X6AH 5J39A 4A3MH 3AFPA 3S17H 1SGPI 3EQLC 4OXPA 1KTKA 4DU9A 4A3FH 1I6HH 1SYCA 3IAYA 4L8JA 3PIOA 1SNDA 3ITPA 1CQVA 4BBSG 3E59A 2E74C 3BVZA 2AKWB 3AMUA 1LACA 3KJPA 1E2WA 1PH5A 1KHIA 2PMZB 1BF4A 5E3PA 4WJWA 3NELA 1TBNA 5C0XJ 3S1RB 1EEFD 3RD4A 1LYLA 3WOEA 2PW7A 1LO5D 1SMXA 2EPBA 4A3GB 2Y0SE 4A93B 1Q90A 2A69C 2QPOA 2KMOA 1EOVA 1Y8OB 3FRPB 3HOWG 1SJED 1D8LA 1JICA 5EJWA 3DWAA 3BG3A 3S2HH 1TDPA 1KLGD 4LF6Q 3HEJA 2NVXB 2NU1I 1U9RA 3GDEA 4BY7G 3P75A 4LFBL 2N71A 4A75A 4PZ6A 1K73C 5M3FB 3PUZA 2SOBA 1Y1WG 1HUMA 4B3TL 5GAHC 4JI4L 1Z2IA 4JK1C 2WB1G 3LWUA 3JAMi 2E2DC 2Q2TA 1OXUA 4G57A 1RL2A 2HQEA 1RCVD 3OTOL 1LR7A 1HNXQ 1VQ8A 1IW4A 1E1OA 1F9RA 1ZYRD 3NTKA 5CV5A 3F1ZA 2F66B 4B3MQ 4IFDG 4L5QA 4DV4Q 1TKWB 1HZ9A 2FEFA 3VYRA 1IW7D 4LF5Q 4HTHA 1SJ8A 3VA9A 2JYYA 4I65A 2UZ3A 1A2UA 4CJ1B 3HS0C 2KJXA 1XPRA 4KKUA 3CXCA 2NBFA 4QQBX 2QDLA 3L0OA 2FHTA 4K14A 3A8KE 4JBMA 1SN8A 1X55A 2BA1A 2ENBA 3M4PA 5M5WH 1HNZQ 5CV8A 1HZCA 4EVOA 1L1OA 4ZLTF 1P9ZA 4RKBA 3VYUA 4C3HG 3HOZH 2TMPA 4LJZC 4IPCA 4L63B 2B63H 2LB7A 3MWYW 1YNJD 2F0FA 2K50A 4P73A 1YHQA 2PQ8A 2DUDA 3TOBA 1ONLA 2KKMA 2A68D 2K75A 1P9GA 2HHHL 5J1ZA 4PNYA 3R2TA 1B4OA 2F4IA 1H9JA 1CZGA 2MGSA 4BXXH 2B29A 1JQYD 3I72A 3QO2A 2F03A 5C4XB 3MXNA 1A6XA 1O7YA 1J8IA 3CC4A 2RVLA 4FF3A 4NV5A 3D4RA 2NZHA 2YYZA 5EBCA 1TS5A 2HDMA 4A4IA 3GTOH 4QF4A 3TS2A 2AUKA 4K0KQ 2TSSA 2JA6B 3CCMA 1MGSA 3IFTA 1ILPA 3Q6SA 1KDCA 5FLMH 5CBAE 2A6HD 4GOPC 2MO1A 4ZUJA 2EZVA 4P2CB 3M4OH 3RZDH 4RGNA 1H9KA 2L11A 2JE6I 1BCPD 4JOIA 3GP7A 5C4HA 1QVGA 3OWFA 2VL6A 1MJEA 2R93B 3VR6A 3E0EA 3F2CA 4X65Q 1EY9A 4H0LC 4TVAB 2ODDA 4KMUC 1LM0A 1TWHB 3S16H 3X3MA 2F0DA 1A15A 4X64Q 2VUMB 1DGSA 3PO2H 2FXQA 4CGYB 3S1RH 3EVQA 1OO9B 1QNUA 4PV1C 2SGEI 2KA7A 2H4OA 3K5MA 1T5EA 4C3IG 3B4VC 4KN4C 2SNMA 5ISRA 3FNBA 1ASYA 4A93H 4Q0FA 5KEEA 2D2CC 2HQLA 2L0CA 2HGKA 3NQIA 4B9WA 2RIOA 2I5HA 3BDLA 2F0IA 3K5OA 5JEAH 1XMQL 2L7XA 1TWCB 2IWHA 2EQSA 3CCSA 5I4DA 2QQCA 1P16A 1GO3E 3JAMc 3ONAB 2XTRA 1PH4A 2NVXH 2BH2A 1H0ZA 1EIFA 3LX0A 2EY2A 1W6KA 1X54A 4OWTB 3NP8A 5J22A 5M3FH 2OXPA 3QOJA 1CSPA 3CCLA 1PLFA 4POFA 5IT9c 3D31A 4GKKL 3GV3A 4R9WA 2L1BA 4JV5L 2QKIC 1GHKA 4F88A 4JI3L 3SVMA 1C7YA 4K6DA 5JPNC 4UHVA 1MI2A 4LW1A 2ZTEA 3D0FA 4JI6L 3T4AC 4OX9L 2MJ8A 1MHWC 4RKLA 1Z6HA 4YHHL 3S14H 5HGTA 4LF4L 4B3RL 3OW7A 4V190 3OXGA 2A5HA 1KIXA 1JB3A 1OXTA 3GO5A 4YIJA 4JI6Q 5JAVA 4OX9Q 1PTOC 4YHHQ 1SJHD 4A3CH 4LF4Q 4B3RQ 2D62A 5GQOA 1YNND 1WTPA 1KLUD 3KBXA 1HQMC 1PTOF 1UUCA 4G75A 3DA4A 1VQCA 4QUCA 5LNK1 2JA5G 4EQPA 2K04A 1L1OB 1XPOA 3TO6A 5IIFA 2LXJA 2Z6KA 4UDUC 4EQ5A 2D5DA 1K3BC 1VCIA 2O5JC 4O2DA 1CZWA 5G3LD 2F0WA 4Q5VA 2Z6KC 4PZ8A 5NUCA 1S5DD 2NZ1D 1XJVA 4ZUIA 5BN4A 2LY7A 4UAIA 3HOVG 1K7TA 3VYSA 1ULMA 4X66Q 4JYAL 2PPBC 4XYOA 3ERQA 2O4XA 1M8CA 1CKNA 4F7XA 3MXNB 3SXHA 1FJGQ 3CF5A 1IHZA 3SK6A 3QAHA 5D3IB 1GD7A 2UUAL 2ENNA 2JBWA 2OTLA 1EY6A 1ESRA 4FVMA 2IX1A 1NY4A 1VMCA 3HOYG 1EU4A 1N33Q 1STAA 5C4XH 2F3CI 3I7FA 3IL8A 5LMUL 4JW0A 4ZQ3A 2D0PA 3TEHB 1ZEQX 4HSVA 2XIWA 3I2ZA 2M00A 1QUQB 4O1PA 3WDNA 1N9WA 1DS2I 2FU2A 2NN6G 2MUYA 2JP1A 4P75A 2JA6H 1IYUA 1VQBA 3UEYA 1UNSA 1J5EL 1Q9BA 2ZM6L 4AIMA 3A7LA 3A8IE 1PH1A 3HOUB 1JB7A 4EQOA 1XTDA 1TBQR 2MQHA 3IRBA 4FF1A 1VQ9A 2NVQB 3QWPA 4NXNL 2IPKD 1HJPA 2OT2A 5FLXc 3S24A 1X65A 2ZM6Q 2R93H 3HKZB 3CC2A 4ZKBB 1DYQA 1JQOA 1SGNI 2EXZA 3UGLA 2M9VA 1YVCA 1TWHH 4OHJA 2B2UA 2JW6A 5CYUA 3N6RA 3W2DA 2VUMH 2Z6BA 1S5CD 2WIIB 1EZ6A 2JAEA 3FBVA 1EYDA 3MFGA 1RFHA 3NQTA 4JI5Q 1TBOA 4XT1B 1MT1A 4BY7B 1WTXA 5LL6S 2B2UC 4HR7B 3A54A 3TMEA 4A3EH 4OWWB 5GADC 1XPUA 2Z0SA 1BVSA 3G48A 5KRUA 3MXUA 4DUZQ 2BH8A 1IBMQ 1Y1BA 1VQGA 1Y14B 1GHJA 3I4NB 1TWCH 1Y1VG 2WB1E 5M3MG 5FO7B 4H02A 4QY7A 3Q24A 4CDDC 4DV3L 1WTVA 3W1BA 5IYDG 5C3EB 3LWEA 2EE1A 1BKBA 1UEBA 4X3KA 4F87A 3TSSA 2OTJA 1PCEA 4JPBW 4DV1Q 2QQDA 3S1QB 2ZTDA 2DN8A 3MC0B 1SE3A 4QL5A 2ENZA 1KL9A 2F0MA 4IJLA 4DK6C 2R3ZA 3PIO3 1ASZA 2CH4A 2OWOA 1KD1C 5JJIA 4FO2A 1AW7A 5I9OA 2CH4W 2CWAA 2WFWA 2XMXA 1Q86C 1CGJI 2F0EA 4ME3A 3RLNA 3CMAA 4MIUA 1TOTA 2PO4A 5FUXA 2QSBA 4HAEA 3RUZA 4QIWB 1JE4A 2WP8J 1RF2D 4LUZA 3A56A 2ROWA 1D5MC 1E2VA 3NBHA 3QJYA 5L37A 2ZJRA 4KKSA 2UXCL 3X3NA 3R5CA 4NKLA 5DLQE 1X3EA 3PF4A 4DR1L 3NE5B 4QIWE 1LUZA 4DV7L 4AQYL 4C3JH 1UWVA 2JEBI 2VQFQ 5K5PA 5ELOA 3RR5A 3M4QA 3G7LA 4XT3B 3MXGA 2ZJQA 1ENAA 5DNFA 3NPPA 3OYYA 4ZYSA 3GV6A 4A3JB 1SYBA 2N17A 1C4QA 2BL7A 2VB2X 4KK7A 3RN5A 2DGYA 5ELDA 2VB3X 2VNUD 3Q0AA 2QF7A 3TREA 4BY1G 2L15A 1EFWA 3A5UA 4DXGA 1ILQA 2BDOA 5ELEA 3R8BA 4A3FB 2EY6A 2OQ0A 1JC7A 2F0UA 4Z9CB 1DOLA 1N32Q 1TS4A 2F0GA 3TJQA 2WAQB 4LF7L 1XMOQ 4WJ4A 5K36G 5E3QA 1HNWQ 1Q46A 1YEZA 1HA6A 4BBSH 4HGUA 2B2VA 1OMTA 3GTKH 4LF7Q 5GAEC 4GKJQ 1B9MA 1EUJA 1I4PA 3J81L 2B2VC 3VR4A 3PV0A 2QCPX 3I4MG 2AMCB 1TIHA 1U4RA 2A20A 1SNOA 2VXWA 2B2TA 2L1LB 2YTXA 5HURA 3UE0A 1YIJA 3BDCA 3H3VI 1PH3A 1LTGD 4LFAQ 2RSOA 4LUVA 5IT9L 3GOXA 1X4SA 3TO7A 3PO3B 3H0GB 2UUBL 1TXYA 2B2TC 4K8IA 3LGJA 4WRDA 5IT9E 3HOWH 1L2FA 5C3XA 1A3VA 2RDHA 5C0XG 3UGDA 1SLJA 2F0QA 2JA8G 1ET9A 2ARPF 3STBD 1ESFA 1IXRA 2GVBA 3FHWA 4BY7H 3PF5A 5DM73 1YJWA 1YZ6A 5JEAJ 3J81j 1Y8FA 1EQRA 4ODGA 3L0IA 1R4PB 1A3TA 1U4LA 2HCIA 4LF9L 2CQAA 1CKOA 3PMFA 3UEJA 2WV6D 1K28A 2N55A 4KHPQ
chains in the Genus database with same CATH topology
4XIGS 3IAS1 3H3VH 3S15H 4UP9A 4IPHA 4LF9Q 5AJ3Q 3GD7A 4DR6L 1LR9A 3RLFA 4L9MA 3T1YQ 3S1QH 4DR7L 4DK3C 1Q81C 4R4IA 2ZJPA 1VQEA 3B6YA 2R6GA 3NBHB 3F2DA 2UU9Q 2KCXA 1IBKQ 2NZOA 1CSQA 2R7ZG 4JI7Q 4C3HH 4POGA 4JCVE 1BBWA 1VQDA 2P6AC 1HR0Q 2MFIA 3OW2A 1P8LA 4UXJA 3JSBA 4NV2A 2F4VQ 1KMAA 3HOXG 1HZAA 2RCNA 1PH2A 2UUCL 4KHZA 3PDNA 2VZAA 3KYHC 4YWKA 3E9IA 1Q7YC 2GKRI 2K19A 2PI2E 2JQOA 1EQQA 4R4CA 3KJOA 3FKIG 1AH9A 2J87A 2XRCA 4BA2I 1WCMG 4A3DG 4AS3A 2E73A 1G6PA 4NXMQ 5LMNW 2YUUA 1SROA 5HY6A 5IP9G 1Q8KA 4DUYQ 4Z7GA 4PG3A 4C3IH 1BUSA 4P72A 4LF6L 3CCJA 4DV6L 3PO3H 2IHEA 3H0GH 4A76A 3PUYA 2NVYH 4DV6Q 2KHJA 2LXKA 1PVOA 1YJNA 1Z47A 4GLAC 3CPWA 1HNXL 3I55A 3J81i 3BJIA 1M8BA 4OWXB 2A19A 4B3ML 3A5ZB 4DV4L 4R4QA 2V53A 1Y1CA 4Z7HA 1N36Q 4LF5L 1X74A 3AFQA 5H1SE 2N49A 1YO7A 3PUWA 4GS3A 3RZOH 4DV5Q 2F52A 4UP8A 1Q1BA 1PH6A 1JJGA 1XNQQ 2R7DA 5IYCG 1HZBA 2W0TA 1HNZL 2JA5H 1YHBA 2ORWA 4PL4A 4IO9A 2N3SA 4JBWA 2AWNA 4PL5A 4JG2A 1L1OC 1IBLQ 2A8VA 4GLXA 4A3IH 2JA7H 3HKSA 3ULPA 3FC3A 3F2BA 1MJCA 1XBTA 4JI0Q 2YFAA 1M90C 4K0KL 2R92G 3KY9A 1U0LA 1IY6A 3K7UC 2NU0I 2OD1A 4SGBI 1QUQA 4OAVB 4X65L 1V43A 4DAMA 2JEAI 2YU9H 5JHWC 5GROA 2B3GA 2RHSB 1K3RA 4X64L 2UXBQ 4JOIC 4DR3L 3A0JA 4ALPA 3UDXA 4DR3Q 1XX6A 2IT1A 3TQYA 1U5KA 5IY0A 4LNQA 2KBNA 2I0QA 3OXFA 4DV2Q 3VDPA 1NMFA 3CCEA 1YTPA 4E1PA 5LMNQ 1NMGA 3U4ZA 1VQNA 3J80c 3U58A 3GTLH 2JZMA 3GTPH 3J81c 1Z7KB 1SRUA 4A3KG 1PTRA 1Y1VH 3I9V1 4P74A 2KHIA 3K7AH 2CQOA 1UE1A 4Y7NH 5M3MH 3T1HQ 5FUYA 1PH9A 5IYDH 1A0IA 3CQZH 1IYJB 4JI8Q 4IFDJ 1S40A 4A24A 1CE3A 3RLOA 1Q82C 3AYHB 4DKAC 4YCVA 3KDFB 1KQSA 4LF8Q 3RU0A 2QA4A 1VQ6A 3RN2A 4X66L 2N52A 1FJGL 2YV5A 3S2DH 3SGQI 1OXXK 1SR3A 2YFBA 1N33L 1G51A 4LWCA 5CCLA 2JJQA 3HOZG 3UITA 2B63G 2K5VA 4R4TA 4TQUS 4BY1H 3SDJA 1VQAA 3D00A 1VQHA 1WJJA 3AJFA 1NUBA 1X3GA 2SGPI 3RNUA 3UFFA 4FDBA 1VQPA 4Q9VA 2KMQA 3AQQA 1L0WA 4U6RA 2VS1A 4A3BH 3UGIA 3LJ1A 1CHOI 2RHQB 3PUVA 4HIKA 1Z9FA 3I4MH 4QGUA 5IP7G 3M3YH 5C4JH 2JB2A 4JI5L 2E2IH 2IY5B 3SGIA 2XTIA 4DUZL 3KP9A 1IBML 5JJLA 5FUWA 2ELIA 2JA8H 2LUYA 4X62Q 4PZ7A 2ASBA 4O1OA 3PGZA 4UY8C 1IZ6A 4C2MH 4HJAA 1I94Q 5C44H 4HJ9A 3U50C 1HH2P 4A3GG 4HJ8A 3F8TA 4A93G 4DR5Q 2B0UC 4DV1L 3G4SA 1VQOA 4B3SQ 4LFCQ 3SGBI 2SGQI 1UVGA 5M3FG 3UDIA 4IOCA 3G6EA 4HIMA 2NU3I 1TWGH 1X9NA 2GKTI 4GNXB 2PNHA 2PQAB 3CMEA 1OYVI 1TGSI 2DIPA 4BBRH 2VQFL 1BBUA 5EX3A 4HIOA 5M5YH 1EYGA 5FJ8G 2ES2A 2CCZA 2H5XA 3HOXH 2DB6A 4OO1G 1R79A 3CD6A 4OAUC 3BZKA 1N32L 1VQ5A 1FYBA 3CCQA 3KFUA 1XMOL 4L5RC 1HNWL 1FGUA 1RIPA 3FKIH 2V6EA 1K9MC 1E1TA 1XNRQ 4GKJL 1JMCA 1AE3A 1GVPA 1N34Q 3M9BA 4UXHA 1EWIA 4A3LG 4PMWA 3HFZB 4LFAL 1D7QA 1I50H 5IP9H 4HJ5A 2JA6G 2GN5A 4IFDI 2I5LX 1WFQA 3BU2A 1MIUA 5HGQA 2NVTH 4XTCS 1VQLA 1WI5A 2R93G 1G291 4JI2Q 4KHPL 1Y1WH 2ALYB 2VUMG 5AJ3L 2CFMA 2A1AA 3OL0A 5JJKA 4RMFA 3ULLA 2MO0A 3OXLA 3DM3A 5EAYA 3UDFA 3T1YL 4DR2L 4AYBG 3VDUA 2M5XA 1OVOA 1LR8A 1W2BA 1VQFA 5IYCH 2YTVA 4DR2Q 2UU9L 2Q2UA 1JT8A 2EXDA 1IBKL 4E1RA 4HFVA 4JI7L 4YY3Q 3SEKC 2NU4I 1HR0L 4BA1I 4P71A 2K5HA 3WWVA 3G71A 1B8AA 1N13A 1KBFA 2JB3A 2F4VL 4Y52H 3KF8B 2E2JH 1YBYA 1YNXA 4DR4Q 3PSIA 4R4OA 1NE3A 3MEKA 5DAEA 2V1CA 3DO9A 1PYSB 2R92H 1IY5A 5BR8Q 2UXDQ 2ATWA 3M7NA 3EN2A 1AN1I 1UE5A 4NXML 2I5MX 2ZRRA 1X3FA 3JC66 3MEFA 3PUXA 4DUYL 2VQEQ 2J9RA 3ULJA 5IYBG 1E24A 1HPTA 1R0RI 4GI3C 2JA9A 1R9TH 1FL0A 2K52A 1NJIC 2E5RA 1YI2A 1XA6A 1E3PA 2JA1A 3GTMH 3HOUG 1OMUA 3K81C 2N8NA 1UE7A 2PMZE 4YWLA 2CKZB 4LUOA 3HKZG 3J80i 4A3KH 1SGQI 1QZHA 4MZ9A 1N36L 5ELNA 1S3OA 3CCVA 3NEMA 4DV5L 4YCWA 1XNQL 3W1GA 4DNIA 3BJUA 2K4KA 1PH8A 2CJSC 1VQ7A 2HIXA 2L8EA 1A63A 1YHAA 2ZTCA 3KF6B 4LFBQ 1PV4A 3I4NG 4B3TQ 4JI4Q 1MKHA 3OTOQ 3KDFA 2IP6A 3KLWA 5EX0A 5C3EG 4B6DA 4I1TA 4HIDA 1IBLL 5FUVA 2F3IA 2NN6I 4UXIA 1K83H 2FUG1 3CCUA 4YZ9A 3HOVH 4JI0L 2E2HH 4IJHA 4OONA 4APVA 1B7YB 2HIVA 2C35B 2KMPA 4RG1A 1KC8C 1CT0I 1WOCA 3HOYH 2JB1A 3CPFA 2LEOA 3KOJA 1N8RC 4DWLA 4PL3A 1JE5A 2QQ0A 4AH6A 2GVAA 2BUSA 2NU2I 4EX5A 2E5LL 1BMOA 4OVOA 2UXBL 2HHHQ 1CUKA 2E5LQ 4A3JG 4YZCA 1E7ZA 4DPGA 4GOPA 1VQMA 4QJFA 4A3MG 5IP7H 5GAGC 1PTQA 4A3FG 3PCOB 3A74A 4DV2L 3ERSX 1KRTA 1CT2I 2WAQG 4JBKA 5LMNL 3GTQH 1T9HA 1C0AA 1HJAI 3AEVA 3BZCA 1I3QH 1SGEI 4GN5A 1HDLA 4HEA1 4J15A 3T1HL 4L5SA 2OQKA 2N1AB 2BA0A 4A3GH 4NB3A 4IOAA 2Q2IA 3PO3G 4JI8L 3H0GG 4JI1L 1PA6A 5HGIA 1JJ2A 3TRZA 3PIPA 1YJ9A 4JI1Q 3UDGA 3ICEA 2IHFA 1XMQQ 4WJ3M 1VQKA 4AS2A 4AYBE 1FAQA 4UPAA 4LF8L 4OO1I 3HH2C 4JC0A 2GKVA 2GVIA 1NBWA 1KAWA 4GKKQ 3H15A 2RF4A 2Q2HA 4G76A 4GNXA 2PQAA 4JV5Q 4JI3Q 4DAYB 2WVJA 3VE5A 2AWOA 2ORVA 4GNXC 5FJ8H 1VQ4A 1CGII 1E22A 2SGDI 1Q1EA 1KRSA 4GN3B 3L2PA 1PYBA 1V1HA 3CC7A 1VQIA 1K8GA 3F4MA 1B70B 1W3SA 4O0AA 4A3IG 2JA7G 1AE2A 5C0XI 1CSOI 2EIFA 1VDDA 2VY3A 4BXXG 1FVIA 1IL2A 2LSSA 3TS0A 4JYAQ 2JXDA 1CKMA 2SGFI 3U4VA 4GOPB 4A3LH 2P22B 3I56A 2UUAQ 3OVOA 5HI7A 1QZGA 2QQEA 5FLMG 1GM5A 5LMUQ 4GXTA 5IWAL 1TBRR 4X62L 5E7NA 5IWAQ 2MNAA 1J5EQ 1I94L 3E2IA 3PO2G 4NXNQ 3IAM1 3Q8DA 4YCUA 2Y0SG 1WYDA 2KMRA 3HKZE 1OTCA 4DR5L 1JJCB 2CWPA 1PHJA 1S72A 4B3SL 4LFCL 1KBEA 2HT1A 4MNOA 2B8TA 1VQJA 5JEAG 2QEXA 1UE6A 1UVFA 2OVOA 4FKDA 4DV0L 2KCTA 2MJFB 3J7ZC 3J7A5 1CT4I 3EBEA 1TURA 4DV0Q 3M85A 1A62A 4NPSA 2YQPA 1LTLA 2A2DA 4DV3Q 1GKHA 4KI0A 1X6OA 2R7ZH 1HR0W 1QVCA 1C9OA 3L7ZC 1SGRI 4L5TA 2D0OA 3K0XA 4YWMA 4A3CG 5M5XH 3EIVA 5HQ8A 3STBC 1X56A 2IX0A 2K5NA 4GLVB 3ER0A 1VS0A 3VDYA 3S1NH 2UXCQ 1Q12A 2PI2A 4DR1Q 1SGYI 1CKNB 2VW9A 4DV7Q 4AQYQ 1XNRL 1N34L 1TUSA 1SGDI 1YU6C 1J6QA 4IPGA 1WCMH 4A3DH 2QGQA 5C4XG 3GTJH 4GN4B 2WCYA 5IYBH 1EIYB 2F6MB 2K14A 2FNFX 1M1KC 1W4RA 1QVFA 2WAQE 4IPDA 3LJ2A 4JI2L 4A3BG 1PFSA 3HOUH 2NVQH 1K0RA 2YTYA 4UP7A 1OXVA 1DS3I 1OXSC 2K9HA 2OCEA 1V1QA 1K8AC 2CAZB 2JK8A 3P23A 3K80C 2XGTA 1I5FA 3FP9A 2UUBQ 2E8GA 3QTLD 3CXLA 1NTGA 4A3EG 1A8VA 1TWFH 4YZDA 3CW2C 1TWAH 5C44G 1O7IA 2XTQA 3KF6A 3I4NH 2N78A 4YY3L 1KXLA 5IE8A 2R7FA 2ID0A 1PPFI 4R1JA 5J3BA 5C3EH 4DR6Q 3W5OA 2VRWB 1FARA 4DR4L 4KLKA 2A2CA 3NENA 2AHOB 4MTNA 3CCRA 4DR7Q 3S1MH 1YITA 3DA3A 3I4OA 3E9HA 3UE1A 1V9PA 4BBRG 5BR8L 2UXDL 4JBJA 3K8AA 3GTGH 1PH7A 3DLLA 1H95A 2KENA 4HJ7A 2V1CC 2KCMA 3CAMA 1SFOH 3CP0A 3LJ0A 1SE8A 2VQEL 4A3JH 3ZJYC 1PJUA 5CCMA 1V1IA 2ERWA 2UUCQ 4X6AH 4A3MH 3AFPA 3S17H 1SGPI 4OXPA 4A3FH 1I6HH 3PIOA 4BBSG 3E59A 2AKWB 3KJPA 1PH5A 1KHIA 1TBNA 3NELA 5C0XJ 1LYLA 1SMXA 2Y0SE 2QPOA 2KMOA 1EOVA 3HOWG 1D8LA 3S2HH 4LF6Q 2NU1I 3GDEA 4BY7G 4LFBL 2N71A 4A75A 4PZ6A 1K73C 3PUZA 1Y1WG 4B3TL 4JI4L 5GAHC 2WB1G 3JAMi 2Q2TA 1OXUA 1RL2A 3OTOL 1LR7A 1HNXQ 1VQ8A 1IW4A 1E1OA 3F1ZA 2F66B 4B3MQ 4IFDG 4L5QA 4DV4Q 1HZ9A 4LF5Q 1SJ8A 3VA9A 2JYYA 2UZ3A 1XPRA 3CXCA 4QQBX 3L0OA 4JBMA 1SN8A 1X55A 2BA1A 3M4PA 5M5WH 1HNZQ 1HZCA 1L1OA 3HOZH 4IPCA 2B63H 2K50A 4P73A 1YHQA 2DUDA 2KKMA 2K75A 2HHHL 4BXXH 2B29A 3CC4A 4NV5A 2NZHA 2YYZA 4A4IA 3GTOH 3TS2A 4K0KQ 3CCMA 5FLMH 4GOPC 2MO1A 3M4OH 3RZDH 2JE6I 4JOIA 1QVGA 2VL6A 1MJEA 3E0EA 3F2CA 4X65Q 4TVAB 2ODDA 1LM0A 3S16H 4X64Q 1DGSA 3PO2H 2FXQA 3S1RH 2SGEI 3B4VC 1ASYA 4A93H 2HQLA 2RIOA 2I5HA 1XMQL 2L7XA 2EQSA 3CCSA 2QQCA 1P16A 1GO3E 3JAMc 2XTRA 1PH4A 2NVXH 2BH2A 1H0ZA 1EIFA 1X54A 4OWTB 5M3FH 1CSPA 3CCLA 4POFA 5IT9c 3D31A 4GKKL 4JV5L 4JI3L 1C7YA 4LW1A 2ZTEA 3D0FA 4JI6L 4OX9L 4YHHL 3S14H 4LF4L 4B3RL 3OXGA 1KIXA 3GO5A 1OXTA 4JI6Q 4OX9Q 4YHHQ 4A3CH 4LF4Q 4B3RQ 2D62A 5GQOA 1UUCA 4G75A 3DA4A 1VQCA 5LNK1 2JA5G 1L1OB 1XPOA 2LXJA 2Z6KA 4EQ5A 1VCIA 4O2DA 2Z6KC 4PZ8A 1XJVA 3HOVG 4X66Q 4JYAL 1M8CA 1CKNA 3MXNB 1FJGQ 3CF5A 1GD7A 2UUAL 2ENNA 2OTLA 2IX1A 1NY4A 3HOYG 1N33Q 5C4XH 2F3CI 3I7FA 5LMUL 2D0PA 3TEHB 3I2ZA 1QUQB 4O1PA 1N9WA 1DS2I 2NN6G 4P75A 2JA6H 1VQBA 3UEYA 1J5EL 2ZM6L 4AIMA 1PH1A 1JB7A 1XTDA 1TBQR 2MQHA 3IRBA 1VQ9A 3QWPA 4NXNL 1HJPA 5FLXc 3S24A 1X65A 2ZM6Q 2R93H 3CC2A 1SGNI 3UGLA 1YVCA 1TWHH 2JW6A 2VUMH 2JAEA 3FBVA 1RFHA 1TBOA 4JI5Q 1MT1A 4A3EH 4OWWB 5GADC 1XPUA 2Z0SA 1BVSA 3G48A 4DUZQ 2BH8A 1IBMQ 1Y1BA 1VQGA 1Y14B 1TWCH 1Y1VG 2WB1E 5M3MG 4H02A 4QY7A 4DV3L 3W1BA 5IYDG 1BKBA 1UEBA 2OTJA 1PCEA 4DV1Q 2QQDA 2ZTDA 4QL5A 2ENZA 1KL9A 4IJLA 4DK6C 1ASZA 2OWOA 5JJIA 1KD1C 1Q86C 2WFWA 2CWAA 2XMXA 1CGJI 4ME3A 3RLNA 3CMAA 1TOTA 5FUXA 2WP8J 4LUZA 2ROWA 2UXCL 2ZJRA 5DLQE 1X3EA 3PF4A 4DR1L 4QIWE 1LUZA 4DV7L 4AQYL 4C3JH 1UWVA 2JEBI 2VQFQ 5ELOA 3RR5A 3M4QA 2ZJQA 3OYYA 2N17A 3RN5A 2DGYA 2VNUD 3TREA 4BY1G 2L15A 1EFWA 3A5UA 2OQ0A 1N32Q 3TJQA 4LF7L 1XMOQ 4WJ4A 5K36G 1HNWQ 1Q46A 1YEZA 4BBSH 4HGUA 1OMTA 3GTKH 4LF7Q 5GAEC 4GKJQ 1EUJA 3PV0A 3I4MG 2AMCB 1TIHA 2A20A 2L1LB 2YTXA 1YIJA 3UE0A 3H3VI 1PH3A 4LFAQ 4LUVA 3GOXA 1X4SA 2UUBL 1TXYA 3LGJA 3HOWH 1L2FA 5C0XG 3UGDA 1SLJA 2JA8G 2ARPF 3STBD 1IXRA 2GVBA 3FHWA 4BY7H 3PF5A 1YJWA 1YZ6A 5JEAJ 3J81j 1Y8FA 1EQRA 3L0IA 4LF9L 1CKOA 3UEJA 4KHPQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TRZ A;  2WB1 G;  3PIP A;  1YJ9 A;  3JAM i;  4JI1 Q;  4XIG S;  2Q2T A;  1OXU A;  1RL2 A;  3UDG A;  3H3V H;  3OTO L;  3ICE A;  3S15 H;  4UP9 A;  4B3S Q;  4IPH A;  2IHF A;  1XMQ Q;  1HNX Q;  1VQ8 A;  4LFC Q;  4LF9 Q;  4WJ3 M;  5AJ3 Q;  3GD7 A;  4DR6 L;  1VQK A;  1E1O A;  4AYB E;  4UPA A;  4LF8 L;  4OO1 I;  3F1Z A;  4B3M Q;  4IFD G;  4L5Q A;  4JC0 A;  5M3F G;  3UDI A;  4IOC A;  4DV4 Q;  3G6E A;  4HIM A;  1HZ9 A;  1NBW A;  3RLF A;  4LF5 Q;  1KAW A;  3T1Y Q;  3S1Q H;  4DR7 L;  4GKK Q;  3H15 A;  2RF4 A;  2Q2H A;  1TWG H;  4GNX A;  2PQA A;  4DK3 C;  4GNX B;  2PNH A;  2PQA B;  1XPR A;  3CME A;  3CXC A;  1Q81 C;  4JV5 Q;  4R4I A;  2ZJP A;  4JI3 Q;  1VQE A;  4DAY B;  4QQB X;  3L0O A;  2AWO A;  3B6Y A;  4BBR H;  2R6G A;  2VQF L;  3NBH B;  3F2D A;  1BBU A;  4JBM A;  2UU9 Q;  4GNX C;  5FJ8 H;  1SN8 A;  1X55 A;  2BA1 A;  1IBK Q;  2NZO A;  4HIO A;  1CSQ A;  3M4P A;  1VQ4 A;  2R7Z G;  5M5Y H;  4JI7 Q;  1E22 A;  1EYG A;  5M5W H;  4C3H H;  4POG A;  5FJ8 G;  4JCV E;  1BBW A;  2ES2 A;  1HNZ Q;  1Q1E A;  1KRS A;  1VQD A;  2CCZ A;  2H5X A;  4GN3 B;  1HZC A;  1HR0 Q;  1L1O A;  3L2P A;  2MFI A;  3OW2 A;  1P8L A;  1PYB A;  3HOZ H;  3HOX H;  4IPC A;  2B63 H;  4OO1 G;  2F4V Q;  2K50 A;  4P73 A;  1YHQ A;  3CC7 A;  2DUD A;  3HOX G;  1VQI A;  1K8G A;  2K75 A;  1B70 B;  1W3S A;  4O0A A;  2HHH L;  3CD6 A;  3BZK A;  1HZA A;  1VQ5 A;  1N32 L;  2RCN A;  1PH2 A;  4A3I G;  2JA7 G;  3CCQ A;  2UUC L;  1AE2 A;  4KHZ A;  4BXX H;  3KFU A;  2B29 A;  1XMO L;  2VZA A;  5C0X I;  2EIF A;  2VY3 A;  3KYH C;  4YWK A;  3E9I A;  4L5R C;  1HNW L;  1Q7Y C;  4BXX G;  3CC4 A;  1FVI A;  1IL2 A;  2LSS A;  3TS0 A;  4JYA Q;  1FGU A;  1CKM A;  2NZH A;  1RIP A;  2YYZ A;  3FKI H;  2PI2 E;  1K9M C;  3U4V A;  1E1T A;  4GOP B;  2JQO A;  4A4I A;  1EQQ A;  1XNR Q;  3GTO H;  4GKJ L;  4R4C A;  3KJO A;  1AE3 A;  1GVP A;  3FKI G;  1N34 Q;  1JMC A;  3TS2 A;  3M9B A;  4K0K Q;  3CCM A;  4A3L H;  1AH9 A;  3I56 A;  2UUA Q;  5FLM H;  1EWI A;  4BA2 I;  1WCM G;  4A3D G;  4GOP C;  2MO1 A;  1QZG A;  4A3L G;  3M4O H;  3RZD H;  1G6P A;  4PMW A;  4NXM Q;  3HFZ B;  5FLM G;  1GM5 A;  5LMU Q;  4LFA L;  2JE6 I;  1D7Q A;  4JOI A;  5LMN W;  1I50 H;  5IP9 H;  1QVG A;  1SRO A;  2VL6 A;  5IWA L;  4HJ5 A;  1MJE A;  3E0E A;  3F2C A;  4X65 Q;  5HY6 A;  5IP9 G;  4X62 L;  4TVA B;  1Q8K A;  2JA6 G;  4DUY Q;  1LM0 A;  2GN5 A;  5E7N A;  2I5L X;  3S16 H;  4IFD I;  5IWA Q;  2MNA A;  4X64 Q;  1J5E Q;  1DGS A;  1WFQ A;  3PO2 H;  4PG3 A;  1I94 L;  3BU2 A;  2FXQ A;  1MIU A;  4C3I H;  5HGQ A;  2NVT H;  4XTC S;  3S1R H;  4P72 A;  1VQL A;  4LF6 L;  3CCJ A;  1WI5 A;  4DV6 L;  3PO2 G;  4NXN Q;  3Q8D A;  4YCU A;  2R93 G;  2Y0S G;  3PO3 H;  2IHE A;  3H0G H;  1G29 1;  4A76 A;  1WYD A;  4JI2 Q;  3HKZ E;  1OTC A;  4DR5 L;  1JJC B;  3PUY A;  2CWP A;  2NVY H;  1ASY A;  4A93 H;  4KHP L;  2HQL A;  2KHJ A;  4DV6 Q;  1PHJ A;  1Y1W H;  2LXK A;  1PVO A;  1YJN A;  1Z47 A;  2ALY B;  1S72 A;  2VUM G;  4B3S L;  4LFC L;  2I5H A;  4GLA C;  3CPW A;  1XMQ L;  1HNX L;  5AJ3 L;  2HT1 A;  4MNO A;  2CFM A;  3I55 A;  2EQS A;  2A1A A;  3CCS A;  1P16 A;  1GO3 E;  3J81 i;  1VQJ A;  5JEA G;  3JAM c;  5JJK A;  4RMF A;  3ULL A;  1UE6 A;  2MO0 A;  2QEX A;  4OWX B;  1PH4 A;  2A19 A;  2NVX H;  4B3M L;  2BH2 A;  1EIF A;  4B3T L;  3A5Z B;  3DM3 A;  1X54 A;  4OWT B;  4DV4 L;  4R4Q A;  5EAY A;  4DV0 L;  5M3F H;  2KCT A;  1N36 Q;  4LF5 L;  3UDF A;  1CSP A;  3J7Z C;  3CCL A;  4POF A;  5IT9 c;  3T1Y L;  3D31 A;  3J7A 5;  3AFQ A;  5H1S E;  4GKK L;  2N49 A;  3EBE A;  3PUW A;  4DR2 L;  4DV0 Q;  4GS3 A;  1X9N A;  4DV5 Q;  3RZO H;  2F52 A;  4JV5 L;  4AYB G;  4JI3 L;  1C7Y A;  3M85 A;  1A62 A;  4UP8 A;  1Q1B A;  1PH6 A;  1W2B A;  1JJG A;  1XNQ Q;  2R7D A;  4LW1 A;  1VQF A;  4NPS A;  2ZTE A;  3D0F A;  2YTV A;  5IYC H;  4DR2 Q;  2UU9 L;  4JI6 L;  1LTL A;  2Q2U A;  4OX9 L;  1JT8 A;  2EXD A;  4YHH L;  1IBK L;  3S14 H;  4DV3 Q;  4LF4 L;  4B3R L;  5IYC G;  1GKH A;  4JI7 L;  4KI0 A;  1HZB A;  1VQO A;  1X6O A;  4YY3 Q;  2R7Z H;  1HR0 W;  1KIX A;  3GO5 A;  1OXT A;  1HNZ L;  4JI6 Q;  4OX9 Q;  4YHH Q;  4A3C H;  1QVC A;  1HR0 L;  4LF4 Q;  4B3R Q;  1C9O A;  2D62 A;  5GQO A;  4BA1 I;  3L7Z C;  4P71 A;  2JA5 H;  1YHB A;  2K5H A;  4L5T A;  3WWV A;  2D0O A;  3G71 A;  1B8A A;  3K0X A;  4YWM A;  4A3C G;  2F4V L;  1VQC A;  5M5X H;  2JA5 G;  3EIV A;  4Y52 H;  4IO9 A;  1L1O B;  1XPO A;  2N3S A;  2LXJ A;  2Z6K A;  3KF8 B;  2E2J H;  1YBY A;  4EQ5 A;  4JBW A;  1YNX A;  1VCI A;  2AWN A;  4O2D A;  4DR4 Q;  3PSI A;  4JG2 A;  3STB C;  1L1O C;  1X56 A;  1IBL Q;  2IX0 A;  2A8V A;  2K5N A;  4GLV B;  2Z6K C;  4GLX A;  4R4O A;  1NE3 A;  4A3I H;  2JA7 H;  3ER0 A;  4PZ8 A;  1VS0 A;  3VDY A;  3S1N H;  3HKS A;  3ULP A;  1XJV A;  3F2B A;  3HOV G;  2UXC Q;  1MJC A;  1PYS B;  4X66 Q;  4JYA L;  1Q12 A;  2PI2 A;  2R92 H;  4DR1 Q;  4JI0 Q;  1CKN A;  3MXN B;  1CKN B;  2VW9 A;  1M90 C;  3CF5 A;  1FJG Q;  4DV7 Q;  5BR8 Q;  4AQY Q;  1XNR L;  2UXD Q;  2ATW A;  1N34 L;  4K0K L;  3M7N A;  2R92 G;  3EN2 A;  1GD7 A;  2UUA L;  2OTL A;  2IX1 A;  1NY4 A;  1U0L A;  1UE5 A;  3HOY G;  1J6Q A;  4IPG A;  1N33 Q;  1WCM H;  5C4X H;  4A3D H;  4NXM L;  2I5M X;  3I7F A;  5LMU L;  3K7U C;  2D0P A;  3TEH B;  1X3F A;  2QGQ A;  3I2Z A;  5C4X G;  1QUQ A;  1QUQ B;  1N9W A;  4X65 L;  1V43 A;  3GTJ H;  3JC6 6;  4GN4 B;  5IYB H;  2NN6 G;  3MEF A;  3PUX A;  4DAM A;  4P75 A;  2VQE Q;  4DUY L;  2YU9 H;  5GRO A;  2JEA I;  2B3G A;  2RHS B;  1EIY B;  2JA6 H;  1VQB A;  1K3R A;  3ULJ A;  4X64 L;  2K14 A;  1J5E L;  5IYB G;  1E24 A;  2UXB Q;  2ZM6 L;  4AIM A;  1M1K C;  1PH1 A;  1QVF A;  4JOI C;  1JB7 A;  4DR3 L;  1XTD A;  2MQH A;  3IRB A;  1VQ9 A;  2JA9 A;  1R9T H;  4NXN L;  2WAQ E;  1FL0 A;  2K52 A;  1NJI C;  1HJP A;  4IPD A;  3A0J A;  3S24 A;  1X65 A;  5FLX c;  2ZM6 Q;  4ALP A;  1YI2 A;  2R93 H;  4JI2 L;  3UDX A;  3CC2 A;  4DR3 Q;  2IT1 A;  3TQY A;  4JI4 L;  4A3B G;  1PFS A;  3HOU H;  1U5K A;  5IY0 A;  1YVC A;  1E3P A;  1TWH H;  4LNQ A;  2KBN A;  2NVQ H;  2I0Q A;  4DV2 Q;  1K0R A;  2YTY A;  3GTM H;  3HOU G;  2VUM H;  4UP7 A;  1NMF A;  1OXV A;  3K81 C;  1OXS C;  2N8N A;  2OCE A;  3CCE A;  1UE7 A;  1V1Q A;  1K8A C;  4JI5 Q;  2JK8 A;  2PMZ E;  4YWL A;  3K80 C;  5LMN Q;  2CKZ B;  4LUO A;  1NMG A;  3HKZ G;  3J80 i;  3U4Z A;  4A3K H;  1VQN A;  2XGT A;  3J80 c;  1QZH A;  3U58 A;  4A3E H;  3GTL H;  4MZ9 A;  1N36 L;  4OWW B;  5GAD C;  3J81 c;  1XPU A;  2Z0S A;  1BVS A;  3G48 A;  1I5F A;  3FP9 A;  5ELN A;  1SRU A;  2E8G A;  4DUZ Q;  2BH8 A;  4A3K G;  1IBM Q;  2UUB Q;  1VQG A;  1Y1V H;  1NTG A;  1S3O A;  4P74 A;  2KHI A;  3CCV A;  4A3E G;  3K7A H;  3NEM A;  1A8V A;  1TWF H;  2CQO A;  4DV5 L;  1Y14 B;  1UE1 A;  4Y7N H;  5M3M H;  3T1H Q;  1TWC H;  4YCW A;  3CW2 C;  1Y1V G;  2WB1 E;  1XNQ L;  1TWA H;  3W1G A;  5C44 G;  1PH9 A;  5IYD H;  5M3M G;  1A0I A;  4DNI A;  3CQZ H;  3BJU A;  2K4K A;  4H02 A;  4QY7 A;  1IYJ B;  1O7I A;  1PH8 A;  4DV3 L;  2HIX A;  1VQ7 A;  4JI8 Q;  3W1B A;  5IYD G;  4IFD J;  3KF6 A;  3I4N H;  1A63 A;  1YHA A;  2ZTC A;  2N78 A;  1BKB A;  3KF6 B;  1S40 A;  1UEB A;  4YY3 L;  1PV4 A;  4LFB Q;  1KXL A;  2OTJ A;  4DV1 Q;  4B3T Q;  5IE8 A;  4JI4 Q;  3I4N G;  3RLO A;  2ZTD A;  2R7F A;  2ID0 A;  4QL5 A;  1Q82 C;  3AYH B;  1KL9 A;  4IJL A;  4R1J A;  5J3B A;  1MKH A;  3OTO Q;  4DKA C;  4YCV A;  5C3E H;  4DK6 C;  4DR6 Q;  3W5O A;  3KDF A;  3KLW A;  3KDF B;  1ASZ A;  2OWO A;  5JJI A;  1KD1 C;  1KQS A;  1Q86 C;  2WFW A;  2CWA A;  5C3E G;  4LF8 Q;  4ME3 A;  3RLN A;  3CMA A;  4DR4 L;  4HID A;  2QA4 A;  4KLK A;  1IBL L;  3NEN A;  2AHO B;  4MTN A;  2F3I A;  2NN6 I;  3CCR A;  4DR7 Q;  1K83 H;  1VQ6 A;  2WP8 J;  3S1M H;  3RN2 A;  4LUZ A;  1YIT A;  2UXC L;  3I4O A;  2ZJR A;  3E9H A;  4X66 L;  3CCU A;  5DLQ E;  3UE1 A;  3HOV H;  1V9P A;  1X3E A;  3PF4 A;  4DR1 L;  4JI0 L;  1FJG L;  4QIW E;  4BBR G;  1LUZ A;  4DV7 L;  5BR8 L;  2YV5 A;  4C3J H;  4AQY L;  1UWV A;  2JEB I;  4IJH A;  2E2H H;  2VQF Q;  3S2D H;  2UXD L;  4OON A;  4APV A;  4JBJ A;  1B7Y B;  3K8A A;  5ELO A;  3GTG H;  1PH7 A;  3DLL A;  1H95 A;  2HIV A;  3RR5 A;  3M4Q A;  1OXX K;  1SR3 A;  2C35 B;  2KEN A;  1N33 L;  4HJ7 A;  2V1C C;  4RG1 A;  1G51 A;  1KC8 C;  4LWC A;  1WOC A;  2KCM A;  3CAM A;  2ZJQ A;  3HOY H;  1SFO H;  2JJQ A;  3CP0 A;  3CPF A;  3HOZ G;  3OYY A;  2B63 G;  3KOJ A;  2K5V A;  4R4T A;  4TQU S;  1N8R C;  4BY1 H;  3RN5 A;  2DGY A;  1VQA A;  1SE8 A;  1JE5 A;  2VNU D;  4AH6 A;  2VQE L;  3TRE A;  4BY1 G;  1VQH A;  2GVA A;  2L15 A;  1EFW A;  4EX5 A;  1WJJ A;  3A5U A;  2E5L L;  2UXB L;  4A3J H;  2OQ0 A;  3ZJY C;  2HHH Q;  1CUK A;  1X3G A;  1N32 Q;  3RNU A;  2E5L Q;  4FDB A;  2UUC Q;  4KHP Q;  4A3J G;  1VQP A;  4LF7 L;  1E7Z A;  4DPG A;  1XMO Q;  3AQQ A;  4WJ4 A;  4X6A H;  4A3M H;  3AFP A;  3S17 H;  4GOP A;  5K36 G;  1L0W A;  1VQM A;  4OXP A;  4A3F H;  1Q46 A;  1HNW Q;  1YEZ A;  4QJF A;  2VS1 A;  4BBS H;  1I6H H;  4A3B H;  4A3M G;  5IP7 H;  5GAG C;  3GTK H;  4LF7 Q;  2RHQ B;  3PUV A;  3PIO A;  4A3F G;  3PCO B;  3A74 A;  5GAE C;  4DV2 L;  3ERS X;  1KRT A;  4HIK A;  4BBS G;  1Z9F A;  3I4M H;  4GKJ Q;  4QGU A;  5IP7 G;  1EUJ A;  3M3Y H;  2AKW B;  5C4J H;  3KJP A;  1PH5 A;  1KHI A;  2WAQ G;  3PV0 A;  4JI5 L;  2E2I H;  3I4M G;  2AMC B;  4JBK A;  5LMN L;  3GTQ H;  1T9H A;  3NEL A;  5C0X J;  2YTX A;  2IY5 B;  1YIJ A;  3UE0 A;  3H3V I;  1PH3 A;  1C0A A;  3AEV A;  4LFA Q;  1LYL A;  3BZC A;  4LUV A;  3SGI A;  1I3Q H;  1SMX A;  2UUB L;  2XTI A;  4GN5 A;  4DUZ L;  1TXY A;  2Y0S E;  1IBM L;  3LGJ A;  5JJL A;  3HOW H;  2JA8 H;  1L2F A;  4X62 Q;  5C0X G;  4PZ7 A;  4J15 A;  1EOV A;  3T1H L;  1SLJ A;  4L5S A;  2ASB A;  2OQK A;  3PGZ A;  3GTP H;  3HOW G;  2JA8 G;  1D8L A;  4UY8 C;  1IZ6 A;  4C2M H;  3STB D;  4HJA A;  2BA0 A;  1IXR A;  1I94 Q;  4A3G H;  2GVB A;  3FHW A;  5C44 H;  3PF5 A;  4BY7 H;  4NB3 A;  4HJ9 A;  1YJW A;  1YZ6 A;  4IOA A;  3S2H H;  2Q2I A;  5JEA J;  3J81 j;  4LF6 Q;  3PO3 G;  4JI8 L;  3H0G G;  1HH2 P;  3GDE A;  1EQR A;  4JI1 L;  3U50 C;  4HJ8 A;  4A3G G;  4BY7 G;  4LFB L;  3F8T A;  4A75 A;  4A93 G;  4PZ6 A;  1K73 C;  4LF9 L;  1PA6 A;  3PUZ A;  1CKO A;  4DR5 Q;  1Y1W G;  4DV1 L;  3G4S A;  5GAH C;  1JJ2 A; 
#chains in the Genus database with same CATH topology
 5J8F A;  1SEB D;  2OU2 A;  2LMC B;  4XIG S;  4K5X A;  3IAS 1;  3H3V H;  1K7V A;  3S15 H;  4UP9 A;  4IPH A;  4LF9 Q;  2XRS D;  3GD7 A;  4IN3 A;  5AJ3 Q;  4DR6 L;  1SE4 A;  2K05 A;  4IFD H;  1C8C A;  1CQF A;  1LR9 A;  2K1B A;  4CJ2 C;  5EQ0 A;  3BS1 A;  1O80 A;  3RLF A;  2HDL A;  2C9O A;  1B50 A;  4L9M A;  1EIH A;  3T1Y Q;  2NYZ D;  3TN2 A;  3S1Q H;  4DR7 L;  1WTJ A;  4IUT A;  3CRK C;  5C5L A;  3NWT A;  4DK3 C;  2EDG A;  1Q81 C;  2J4X A;  4R4I A;  2ZJP A;  1VQE A;  1HCZ A;  3DMU A;  3B6Y A;  2B2Y A;  2R6G A;  4XYQ A;  3NBH B;  3F2D A;  1PYW D;  2UU9 Q;  5D14 A;  2KCX A;  4TKO B;  1IBK Q;  4RGM A;  2NZO A;  3RMH A;  3URY A;  1CSQ A;  2LFN A;  1I4R A;  2R7Z G;  4JI7 Q;  4C3H H;  4POG A;  4JCV E;  1BBW A;  4FXK C;  1FR3 A;  2XN9 C;  1VQD A;  2F0J A;  4A3I B;  2JA7 B;  2P6A C;  1PFM A;  1HR0 Q;  2MFI A;  1WKX A;  3OW2 A;  1P8L A;  3SK4 A;  3J7Y W;  2BOS A;  2CWG A;  4UXJ A;  3JSB A;  4NV2 A;  2F4V Q;  2NUC A;  1KMA A;  3HOX G;  4BWG B;  4K8J A;  1KAB A;  2IL8 A;  3SE0 A;  3QG1 A;  5T1G A;  1HZA A;  1EY0 A;  2RCN A;  1PH2 A;  5KND A;  5FLX L;  2UUC L;  4KHZ A;  3W3A A;  2GSC A;  1DCZ A;  4FXG C;  3PDN A;  5JVG 3;  2Q8R E;  2VZA A;  1WTO A;  1XWE A;  3TOA A;  3KYH C;  4YWK A;  5FLX E;  3E9I A;  1SMY C;  1Q7Y C;  2GKR I;  2K19 A;  2PYK A;  1Y8P B;  1O78 A;  3M4O B;  2PI2 E;  3V96 A;  1FNV A;  1F2Y A;  2JQO A;  1EQQ A;  4R4C A;  3KJO A;  1ZYR C;  3FKI G;  1KNE A;  1AH9 A;  3EJI A;  2J87 A;  1A2T A;  2XRC A;  4BA2 I;  1WCM G;  4A3D G;  4DAV A;  1IW7 C;  4C1N K;  1U4M A;  4AS3 A;  2E73 A;  1G6P A;  2B39 A;  4NXM Q;  3S16 B;  5LMN W;  2NWG A;  1EIG A;  2YUU A;  2KED A;  1SRO A;  1H9S B;  3PO2 B;  1JOQ A;  2Y0S B;  4X3S A;  5HY6 A;  3C1E A;  5IP9 G;  2PW5 A;  1Q8K A;  4DUY Q;  5CV9 A;  4Z7G A;  3D8G A;  1HHV A;  1WD0 A;  1ENF A;  4PG3 A;  4C3I H;  1BUS A;  3HZX A;  4P72 A;  1TY2 A;  3CCJ A;  4LF6 L;  4OL7 A;  4DV6 L;  2JYO A;  3DWQ A;  3PO3 H;  2IHE A;  1ET6 A;  3H0G H;  4A76 A;  1S5E D;  1TT2 A;  3PUY A;  2NVY H;  4DV6 Q;  2KHJ A;  2LXK A;  1PVO A;  1Y1V B;  1Z47 A;  1YJN A;  1B1Z A;  3K7A B;  4GLA C;  3CPW A;  1HNX L;  4Y7N B;  5M3M B;  3FSX A;  3I55 A;  4HN7 A;  3J81 i;  3BJI A;  4WOR A;  3SDZ A;  1LV9 A;  1M8B A;  4OWX B;  2A19 A;  1EL0 A;  3UI2 A;  4B3M L;  2MPM A;  4RA8 A;  1CT1 D;  2N88 A;  3A5Z B;  5CR3 A;  2PZW A;  4KY5 A;  4R4Q A;  4DV4 L;  1Y1C A;  2V53 A;  4BS9 A;  4Z7H A;  1N36 Q;  4LF5 L;  2LS0 1;  4XQJ A;  1PMR A;  2ICI A;  2EYH A;  1X74 A;  3AFQ A;  5H1S E;  1ICF B;  2N49 A;  1YO7 A;  3S14 B;  3PUW A;  4GS3 A;  5A2Q L;  4DV5 Q;  3RZO H;  2F52 A;  3BVG A;  4UP8 A;  1PFN A;  1Q1B A;  1EY5 A;  1PH6 A;  1JJG A;  4NP5 A;  1XNQ Q;  2R7D A;  2GIV A;  2A6H C;  3VA5 A;  5IYC G;  3MFY A;  1HZB A;  5KYL A;  1EYC A;  2V4D A;  3OHX C;  4IAL A;  2HUG A;  2W0T A;  1HNZ L;  1HRJ A;  1ULK A;  1GUS A;  2JA5 H;  3GQB A;  1YHB A;  2ORW A;  5I2X A;  3F2U A;  7WGA A;  4PL4 A;  4IO9 A;  2N3S A;  4KJO A;  3S2D B;  5E3R A;  4JBW A;  2AWN A;  4PL5 A;  4JG2 A;  3HG9 A;  1L1O C;  1IBL Q;  1AZP A;  2A8V A;  4TRD A;  4GLX A;  1I6V C;  4A3I H;  2JA7 H;  3HKS A;  2UVO A;  2L12 A;  3ULP A;  2F3W A;  3FC3 A;  3F2B A;  2FFK B;  1DM0 B;  1MJC A;  3A55 A;  1XBT A;  4BY1 B;  1X3P A;  4JI0 Q;  2YFA A;  1WTR A;  1STE A;  1M90 C;  3T51 B;  4K0K L;  1X32 A;  2R92 G;  2K5Q A;  4H7B A;  2BE5 D;  3K0Y A;  2DNE A;  3KY9 A;  1U0L A;  3H94 A;  1WTW A;  1IY6 A;  2D9U A;  3K7U C;  2NU0 I;  1NR4 A;  4PQX A;  2OD1 A;  4RWS C;  4SGB I;  1BOS A;  1QUQ A;  4OAV B;  1RTN A;  4LAA A;  4X65 L;  1V43 A;  1HFG A;  4B9X A;  1RD9 D;  4A3B B;  4N8F A;  1LTS D;  4DAM A;  2JEA I;  2YU9 H;  5JHW C;  5GRO A;  2X6L A;  2B3G A;  2RHS B;  1ZXT A;  4N8X 1;  1K3R A;  5ELC A;  4X64 L;  5IGG A;  2UXB Q;  3M3Y B;  4JOI C;  4DR3 L;  2X3T A;  3A0J A;  2F0V A;  4ALP A;  1YNN C;  5D65 A;  1H9M A;  3NWS A;  3UDX A;  4DR3 Q;  1XX6 A;  2IT1 A;  3EFX D;  3TQY A;  2KEE A;  3BYT B;  1GJX A;  1U5K A;  3T53 B;  4XQN A;  5IY0 A;  4FYD A;  1G2T A;  2JA8 B;  4LNQ A;  2KBN A;  2I0Q A;  4M1U B;  4DV2 Q;  3OXF A;  3VDP A;  4A3E B;  5KIX A;  4RGO S;  1NMF A;  1HFN A;  3A8J E;  3CCE A;  1YTP A;  4E1P A;  5C44 B;  5LMN Q;  2RA4 A;  1SXT A;  1ICW A;  1D1I A;  1NMG A;  2PZT A;  5G3L F;  3U4Z A;  1VQN A;  3J80 c;  4KY6 A;  3U58 A;  3GTL H;  2JZM A;  3GTP H;  3J81 c;  1Z7K B;  1SRU A;  4A3K G;  5FO9 B;  1LLR D;  4RGT A;  1Y1V H;  1PTR A;  3KLS A;  3I9V 1;  4P74 A;  2KHI A;  3K7A H;  2CQO A;  1JWU D;  4KHV A;  1UE1 A;  4Y7N H;  5I6W A;  5M3M H;  3T1H Q;  1DZ1 A;  5FUY A;  3FEW X;  4AML A;  1B53 A;  2QW7 A;  2Z4I A;  1PH9 A;  5IYD H;  5JOB A;  1A0I A;  4EGV A;  5EBD A;  3CQZ H;  2XRQ D;  4C1N I;  1IYJ B;  1MBY A;  4JI8 Q;  4IFD J;  1BCP B;  1S40 A;  4U68 A;  2KUM A;  4A24 A;  4ZKC B;  1CE3 A;  4CKE A;  3RLO A;  2R61 A;  3C3L A;  1Q82 C;  3AYH B;  1D5X C;  5JPM C;  4DKA C;  3TO9 A;  4YCV A;  1TWG B;  1Q3L A;  2EYP A;  1VMP A;  4RFB A;  3KDF B;  1KQS A;  4LF8 Q;  3H91 A;  4BBR B;  2F0S A;  2AUJ D;  3RU0 A;  3IFD A;  2QA4 A;  3SHL A;  1LTT D;  1O7L A;  5EKI A;  5AFW A;  4ZK9 B;  5M5Y B;  4C3J B;  3WOF A;  2CW0 D;  2PCF B;  2KVM A;  1VQ6 A;  3RN2 A;  4X66 L;  2N52 A;  4X3T A;  1PRT D;  1D2B A;  4H13 C;  3HOX B;  3NK9 A;  1FJG L;  2YV5 A;  1RKN A;  3S2D H;  3SGQ I;  1PZK D;  1XTC D;  1OXX K;  1SR3 A;  2YFB A;  1N33 L;  1S20 A;  1CA5 A;  1G51 A;  4LWC A;  5CCL A;  2JJQ A;  4NMZ A;  4XXE A;  3HOZ G;  5IGC A;  3UIT A;  2B63 G;  2K5V A;  5IGD A;  4R4T A;  4TQU S;  4BY1 H;  2O2L D;  3SDJ A;  5E4W C;  1V8Q A;  1VQA A;  5CV6 A;  3D00 A;  1VQH A;  1WJJ A;  3AJF A;  1SAP A;  4DGZ A;  4BBS B;  1NUB A;  3GTK B;  1NNX A;  1X3G A;  2A6E C;  5K36 H;  2SGP I;  3RNU A;  3UFF A;  4FDB A;  1NCV A;  1VQP A;  4Q9V A;  5TSS A;  2KMQ A;  1F2L A;  1FYC A;  3AQQ A;  1L0W A;  4U6R A;  2X52 A;  1I50 B;  2RC4 A;  1MSH A;  2VS1 A;  1DD2 A;  2WKD A;  1E0B A;  4A3B H;  3UGI A;  3LJ1 A;  3L3O C;  3VA7 A;  1CHO I;  2RHQ B;  3PUV A;  4HIK A;  1Z9F A;  1SBB B;  3I4M H;  4QGU A;  5IP7 G;  3M3Y H;  1EOT A;  3ZYY X;  5C4J H;  3OMC A;  2JB2 A;  3VR3 A;  4JI5 L;  2E2I H;  3HOW B;  4ID6 A;  3R93 A;  2IY5 B;  1PTO D;  1PRT B;  2PZU A;  1V1P B;  3B55 A;  3AU7 A;  3SGI A;  2XTI A;  4DUZ L;  3KP9 A;  1IBM L;  5JJL A;  5FUW A;  2ELI A;  2JA8 H;  4WP4 A;  2LUY A;  1V1O A;  4X62 Q;  2ICE C;  1Y1W B;  4PZ7 A;  2F0N A;  4O1O A;  2ASB A;  2BL8 A;  1QOH A;  1R4Q B;  3PGZ A;  2WB1 B;  3P1H A;  2EYM A;  4UY8 C;  1IZ6 A;  4C2M H;  4HJA A;  1BQQ T;  1I94 Q;  5C44 H;  4HJ9 A;  1UEA B;  3E6Z X;  4S3S A;  5BN3 A;  4IUQ A;  1I4Q A;  1TQO A;  3S15 B;  1GUG A;  2LKV A;  1HH2 P;  3U50 C;  4A3G G;  3OWE B;  4HJ8 A;  3F8T A;  4A93 G;  1HQR D;  2MP1 A;  4DR5 Q;  2B0U C;  2CWH A;  1C48 A;  4DV1 L;  3G4S A;  2OEO A;  1VQO A;  4DNR B;  2ZT9 C;  4K6L A;  4B3S Q;  4LFC Q;  3SGB I;  5LL6 X;  2SGQ I;  1S4Z A;  4RH6 A;  1UVG A;  5I9P A;  1LTA D;  2G9D A;  3I70 A;  5M3F G;  3UDI A;  1BNZ A;  4IOC A;  3G6E A;  3NUC A;  4RCN A;  4HIM A;  1WTH A;  3MZ5 A;  2NU3 I;  3I91 A;  4IQZ A;  3R5A A;  2WAC A;  1G6Z A;  1K7U A;  2P5Z X;  4G7H C;  1HEV A;  1NSN S;  4WFN 3;  1TWG H;  1X9N A;  2GKT I;  3FVV A;  2PNH A;  2PQA B;  1EZ8 A;  3CME A;  4GNX B;  1VDZ A;  4C3H B;  1OYV I;  1TGS I;  3HP3 A;  2DIP A;  4BBR H;  2VQF L;  1BBU A;  4KV6 A;  1CHQ D;  4QCL A;  2E2J B;  5EX3 A;  5CBE E;  4HIO A;  4HMI A;  4CDC C;  5M5Y H;  1EYG A;  3SK5 A;  5FJ8 G;  1F2Z A;  2SNS A;  2XNA C;  3MA2 B;  2ES2 A;  4R8I A;  5T1I A;  2CCZ A;  2H5X A;  4KTA A;  3TZU A;  4NDX A;  3QIA A;  1AN8 A;  3HOX H;  1B3A A;  2B8F A;  4K2K A;  1QWY A;  2CWF A;  2DB6 A;  4OO1 G;  3TZD A;  1R79 A;  4OEM B;  3CD6 A;  4OAU C;  3BZK A;  1N32 L;  1VQ5 A;  1FYB A;  3CCQ A;  2G5D A;  3KFU A;  1F2M A;  1NAP A;  1XMO L;  2Y0M A;  5FKA C;  3VYT A;  4L5R C;  1HNW L;  2EJM A;  4KD4 A;  1RDP D;  1FGU A;  2AQ2 B;  2K5D A;  1M4V A;  1RIP A;  3FKI H;  2V6E A;  1K8M A;  4DK0 A;  1TR5 A;  1K9M C;  1E1T A;  1E2Z A;  3CKI B;  1XNR Q;  4GKJ L;  5CC4 A;  4ZCK A;  4H44 C;  1AE3 A;  1GVP A;  2JXM B;  1N34 Q;  1JMC A;  1HA5 A;  3M9B A;  2FMM A;  4DAP A;  4UXH A;  1EWI A;  1B3Q A;  3O13 A;  5FK9 C;  1TII D;  4A3L G;  3J80 L;  3OOC A;  3OSO A;  4PMW A;  4RHS A;  3HFZ B;  4LFA L;  1D7Q A;  1I50 H;  5IP9 H;  3J80 E;  4IUV A;  3K57 A;  1H9S A;  3MAQ A;  4HJ5 A;  3J81 E;  5KYI A;  1I4H A;  4FNF A;  4C3I B;  1GUT A;  4LMQ D;  3TP5 A;  5BN5 A;  1HXY D;  2JA6 G;  1G2S A;  2QGM A;  2GN5 A;  4IFD I;  2I5L X;  4DXF A;  1WFQ A;  2NVY B;  2F0O A;  3NSW A;  3BU2 A;  5IOC A;  1MIU A;  5EPJ A;  1MD2 D;  5HGQ A;  2NVT H;  4XTC S;  5C5M A;  1VQL A;  1WI5 A;  2R93 G;  2ZXO A;  3C46 A;  2ETD A;  4A3K B;  1G29 1;  2DY8 A;  1A3U A;  2F0T A;  4JI2 Q;  1STH A;  3QWN A;  4KHP L;  4RAU C;  2Q8I B;  1Y1W H;  4G4K A;  4HSP A;  2ALY B;  1RTO A;  1TVX A;  2VUM G;  5AJ3 L;  2CFM A;  2A1A A;  3OL0 A;  4TSS A;  1X3Q A;  5JJK A;  4RMF A;  3ULL A;  5C4Z A;  2MO0 A;  2PQE A;  3ERO A;  3RZO B;  3OXL A;  3DM3 A;  3P20 A;  1VF5 C;  1MJA A;  5EAY A;  3SR1 A;  2EYL A;  3UDF A;  3T1Y L;  1BBX C;  4OIJ A;  1WTQ A;  2PNR C;  4DR2 L;  3SK8 A;  4AYB G;  3VDU A;  2M5X A;  1OVO A;  1LR8 A;  1W2B A;  3NTH A;  5EPL A;  1VQF A;  5IYC H;  2YTV A;  2EVB A;  4DR2 Q;  2UU9 L;  2Q2U A;  1JT8 A;  2JA5 B;  2E75 C;  2EXD A;  1IBK L;  4E1R A;  4HFV A;  2XWJ B;  3C1F A;  4JI7 L;  4YY3 Q;  3SEK C;  1STB A;  1II3 A;  2NU4 I;  5CMD A;  1SYF A;  4OEL B;  2F0L A;  4OIK A;  3T56 B;  1HR0 L;  4BA1 I;  4P71 A;  1K83 B;  2K5H A;  2B2Y C;  3WWV A;  1PTO H;  3G71 A;  1B8A A;  1N13 A;  1KBF A;  2JB3 A;  2F4V L;  3HOV B;  4J1M A;  4Y52 H;  3G6J B;  3D6C A;  1S5B D;  4FF2 A;  3KF8 B;  3C2P A;  2E2J H;  1YBY A;  1F9Q A;  1YNX A;  1EEI D;  4X3U A;  4DR4 Q;  3PSI A;  2M2L A;  1UUP A;  1QG7 A;  4R4O A;  1NE3 A;  3MEK A;  3HOY B;  2X6G A;  5DAE A;  2V1C A;  1LAB A;  3DO9 A;  1PYS B;  1EY7 A;  1RJT A;  2R92 H;  1IY5 A;  3KBG A;  1STG A;  5BR8 Q;  2UXD Q;  4N9P A;  2ATW A;  4O42 A;  3M7N A;  3FSY A;  3EN2 A;  5EKK A;  1BXT A;  1CK1 A;  2KCN A;  1AN1 I;  1SYG A;  1UE5 A;  2RIJ A;  2KCC A;  2YU9 B;  4NXM L;  2I5M X;  2BCO A;  2ZRR A;  2F3V A;  2Z8L A;  1X3F A;  3PIP 3;  1B9N A;  4KY7 A;  4J8Q A;  1CI3 M;  3JC6 6;  2Z1C A;  3MEF A;  3PUX A;  3AB9 A;  2IJ0 A;  2VQE Q;  4DUY L;  2J9R A;  3ULJ A;  1PZJ D;  1LT6 D;  5IYB G;  1E24 A;  2F0H A;  1HPT A;  4U67 3;  1LT4 D;  4ULL A;  1R0R I;  4GI3 C;  2JA9 A;  1R9T H;  3GTQ B;  1FL0 A;  4FP5 D;  2K52 A;  1NJI C;  2E5R A;  4DF7 A;  1YI2 A;  2K03 A;  1XA6 A;  1I3Q B;  4G7O C;  1CFM A;  1E3P A;  1L0X B;  4LK1 C;  1QE6 A;  2JA1 A;  3GTM H;  3HOU G;  3GTL B;  4DK1 A;  1OMU A;  3GTP B;  1YNJ C;  3K81 C;  2A73 B;  3NHH A;  2N8N A;  1UE7 A;  2PMZ E;  4EQN A;  4YWL A;  2CKZ B;  2A68 C;  4LUO A;  1G91 A;  3HKZ G;  3IKJ A;  3J80 i;  4A3K H;  1SGQ I;  5COY A;  1K0S A;  2NTS A;  1QZH A;  3E0J A;  4N9T A;  4MZ9 A;  1N36 L;  5ELN A;  3CQZ B;  2RCF A;  1S3O A;  3CCV A;  3NEM A;  1AZQ A;  4DV5 L;  1PXU A;  4YCW A;  3TDQ A;  1XNQ L;  2BE5 C;  2F0K A;  1CA6 A;  3W1G A;  3R5B A;  4DNI A;  3BJU A;  4I7Z C;  2K4K A;  1PH8 A;  2CJS C;  1VQ7 A;  2HIX A;  3TP7 A;  1F9P A;  4XDX A;  5A2Q E;  2EY5 A;  1SMY D;  1STY A;  1A63 A;  1YHA A;  2ZTC A;  3KF6 B;  4LFB Q;  2L8E A;  1PV4 A;  3QB3 A;  5CV4 A;  3I4N G;  4B3T Q;  3T13 A;  4JI4 Q;  1WGC A;  1BCP C;  2F1M A;  2EYJ A;  5IGF A;  1AP0 A;  1MKH A;  3OTO Q;  3MTS A;  1BCP F;  4JVZ A;  1LTR D;  3KDF A;  2IP6 A;  3KLW A;  5C6A A;  5EX0 A;  1ROD A;  5C3E G;  4B6D A;  1S5F D;  3NXW A;  2KOL A;  2WGC A;  4I1T A;  2B8G A;  3CHB D;  4HID A;  1IBL L;  2NTT A;  1TU2 B;  5FUV A;  1T5X D;  2F3I A;  2NN6 I;  4DAY A;  4IUP A;  4UXI A;  1K83 H;  1SDF A;  2EJG C;  1NUC A;  4IUR A;  2FUG 1;  3CCU A;  4YZ9 A;  3HOV H;  1I4X A;  1PFB A;  3FPP A;  2QDB A;  4JI0 L;  2A69 D;  3ND9 A;  2E2H H;  4IJH A;  4OON A;  4APV A;  2NB0 A;  1NR2 A;  1B7Y B;  1TY0 A;  1EWC A;  4QB4 A;  2HIV A;  3K58 A;  3CU7 A;  2C35 B;  5LHY 1;  3QR8 A;  1I4G A;  1B44 D;  1XX8 A;  4RG1 A;  2KMP A;  3M7G A;  1KC8 C;  1WOC A;  3HOY H;  3I4L A;  3KK7 A;  1CT0 I;  2JB1 A;  1CM9 A;  3CPF A;  1HUN A;  2LEO A;  3KOJ A;  1JOO A;  4HED A;  1LTB D;  1N8R C;  4DWL A;  1SYD A;  4PL3 A;  5IGB A;  1JE5 A;  2QQ0 A;  2DJG C;  4AH6 A;  2GVA A;  2NN6 H;  2BUS A;  3BDO A;  2SDF A;  5D3D A;  2OF1 A;  4EX5 A;  2E5L L;  4FXD A;  1BMO A;  2NU2 I;  4OVO A;  2Z4H A;  3K5L A;  2UXB L;  1ULN A;  2HHH Q;  1CUK A;  2L4N A;  5ELB A;  4O1N A;  2E5L Q;  4A3J G;  4HMJ A;  4YZC A;  2K33 A;  2MHV A;  1E7Z A;  4DPG A;  3I4M B;  3U9S A;  4CDE C;  4GOP A;  1RHP A;  1QCB D;  5C4J B;  1VQM A;  1WGT A;  4QJF A;  2E2I B;  2J7Z A;  4A3M G;  5IP7 H;  5GAG C;  3D3R A;  1PTQ A;  4A3F G;  1SNC A;  3A74 A;  3PCO B;  4DV2 L;  3ERS X;  1KRT A;  4ZAI A;  4L6T B;  1CT2 I;  2WAQ G;  1EY4 A;  1EQT A;  1ML0 D;  4JBK A;  1LT3 D;  5LMN L;  3GTQ H;  2K28 A;  1T9H A;  1XYI A;  1V1P A;  2CW0 C;  1C0A A;  3AEV A;  3DHQ A;  1HJA I;  3BZC A;  2FJ2 A;  1I3Q H;  1SGE I;  4C2M B;  5IOD A;  4GN5 A;  1PRT C;  1HDL A;  1FY7 A;  4HEA 1;  3TP8 A;  1PRT F;  4J15 A;  3T1H L;  4L5S A;  2OQK A;  1HTL D;  1MSG A;  2N1A B;  2RDG A;  2BA0 A;  4A3G H;  4NB3 A;  1SSO A;  3VR5 A;  4IOA A;  1J9O A;  2Q2I A;  3PO3 G;  4JI8 L;  3H0G G;  4JI1 L;  2E76 C;  4ABN A;  1PA6 A;  3H3V C;  3DEO A;  5HGI A;  1JJ2 A;  3TRZ A;  2J0T D;  3PIP A;  4AYB B;  1YJ9 A;  4JI1 Q;  2AQ1 B;  2RDF A;  3UDG A;  3ICE A;  3A7A B;  1K8O A;  2IHF A;  1XMQ Q;  4WJ3 M;  2RKS A;  1VQK A;  4AS2 A;  3OIQ A;  4AYB E;  1FAQ A;  4UPA A;  4LF8 L;  4OO1 I;  1SNQ A;  4V0B A;  3HH2 C;  4PMB A;  1FGB D;  4JC0 A;  3MEH A;  1EY8 A;  2GKV A;  1O7Z A;  3TBI B;  2GVI A;  1NBW A;  1KAW A;  1IKM A;  2R7Z B;  4I7A A;  4GKK Q;  1ZKO A;  1B2T A;  3H15 A;  4CDF C;  1QIL A;  2RF4 A;  2Q2H A;  1CTM A;  5EKL A;  4G76 A;  4GNX A;  2PQA A;  4JV5 Q;  4JI3 Q;  1DON A;  3N52 A;  4DAY B;  3LNN A;  2WVJ A;  3VE5 A;  2AWO A;  5M5X B;  2ORV A;  3OPO A;  3K6O A;  4GNX C;  5FJ8 H;  1VQ4 A;  1CGI I;  1E22 A;  2SGD I;  1Q1E A;  1KRS A;  4GN3 B;  4OO1 H;  4B08 A;  3L2P A;  3S1N B;  1JWS D;  1DXM A;  4RHR A;  1PYB A;  1V1H A;  3T16 A;  3M4Y A;  1JCK B;  2XWB B;  1GUW A;  3E5S A;  4HCS A;  3CC7 A;  1VQI A;  4G7Z C;  1K8G A;  3F4M A;  1FNU A;  4IZ8 A;  1B70 B;  1U4P A;  1W3S A;  4O0A A;  5F2D A;  5M9O A;  3FKI B;  3E3X A;  3R3O A;  4A3I G;  2JA7 G;  1MJB A;  2L5T A;  1AE2 A;  1VF7 A;  1WCM B;  4A3D B;  5C0X I;  1CSO I;  2EIF A;  1VDD A;  2VY3 A;  1W6J A;  4BXX G;  1FVI A;  1IL2 A;  2LSS A;  3TS0 A;  2HCC A;  4JYA Q;  2JXD A;  1CKM A;  3Q23 A;  2SGF I;  3I73 A;  1IKL A;  3GTJ B;  3U4V A;  4GOP B;  1WD1 A;  1BDO A;  1BR9 A;  3DUZ A;  3DWP A;  4A3L H;  2P22 B;  3I56 A;  1GXD C;  2UUA Q;  3OVO A;  2X69 A;  5HI7 A;  1QZG A;  2QQE A;  3PQI A;  3H09 A;  4MPI A;  2IW3 A;  5FLM G;  1GM5 A;  5LMU Q;  4IUU A;  4GXT A;  5IWA L;  2O5I C;  1TBR R;  5DEH A;  2NVT B;  1HPC A;  4MN3 A;  2RBM A;  1QNK A;  4X62 L;  1EFI D;  4DA2 A;  2C5C A;  4DN4 M;  5E7N A;  5JVH 3;  2SEB D;  5C0X H;  5IWA Q;  2JSO A;  3MHB A;  2MNA A;  1J5E Q;  2DKV A;  3FMC A;  1I94 L;  1D6E C;  3BVM A;  1GUO A;  1EU3 A;  2HD3 A;  3E2I A;  2K5W A;  2K7V A;  5E4X A;  2IX3 A;  5EPK A;  2K32 A;  3PO2 G;  4NXN Q;  3IAM 1;  3UOE A;  3Q8D A;  3I90 A;  2ZXP A;  4YCU A;  2Y0S G;  1F9S A;  4M8A A;  1WYD A;  2B2W A;  4KN7 C;  2KMR A;  3HKZ E;  1OTC A;  2ZW3 A;  4GZY C;  4DR5 L;  1JJC B;  2CWP A;  4J6H A;  3R5D A;  3I8Z A;  1PHJ A;  9WGA A;  1S72 A;  2B2W C;  4B3S L;  4LFC L;  1KBE A;  1TWF B;  1M8A A;  4NW2 A;  2HT1 A;  4MNO A;  2B8T A;  3OMG A;  1TWA B;  1VQJ A;  5JEA G;  2QEX A;  1UE6 A;  5ELF A;  3KLS X;  1XXG A;  1IL8 A;  1Y8N B;  1UVF A;  2OVO A;  4FKD A;  4DV0 L;  2KCT A;  2MJF B;  5J8C A;  3J7Z C;  3J7A 5;  1CT4 I;  3EBE A;  1TUR A;  4DV0 Q;  2H1E A;  2BDN A;  3M85 A;  1A62 A;  4NPS A;  3D4W A;  2A6E D;  3BYY B;  1JOR A;  1PZI D;  2YQP A;  1LTL A;  2A2D A;  2DNC A;  4KD3 A;  1PTO B;  4DV3 Q;  4DNC A;  1GKH A;  4DNT B;  2QZG A;  1EYA A;  4KI0 A;  1X6O A;  2R7Z H;  2Z9H A;  1HR0 W;  2L55 A;  3MVV A;  1QVC A;  2DJF C;  5I6Y A;  1C9O A;  4KJN A;  2DY7 A;  3L7Z C;  1SGR I;  4L5T A;  3S1M B;  4CKC A;  2D0O A;  3K0X A;  4YWM A;  4A3C G;  1BUV T;  1KDA A;  2L9H A;  4ME5 A;  5KGU A;  5M5X H;  3EIV A;  3KLR A;  1UHA A;  1WVL A;  5HQ8 A;  3FVQ A;  3KF8 A;  1SNP A;  2JN4 A;  1STN A;  3GTG B;  3STB C;  2R92 B;  1X56 A;  2IX0 A;  1AFP A;  2K5N A;  4GLV B;  1Y69 U;  2FIN B;  3ER0 A;  1VS0 A;  3VDY A;  3S1N H;  3U9O A;  1SFO B;  4FF4 A;  1KNA A;  2UXC Q;  4OGQ C;  1Q12 A;  2PI2 A;  3D6W A;  4DR1 Q;  1SGY I;  1CKN B;  1FD7 D;  2WIN B;  2VW9 A;  4DV7 Q;  2RAD A;  4AQY Q;  1XNR L;  1N34 L;  1TUS A;  2I07 B;  4CBV A;  1IYV A;  1NXU A;  1SGD I;  1YU6 C;  1J6Q A;  4IPG A;  2CHB D;  3HRZ C;  1WCM H;  4A3D H;  2GA4 B;  3FDT A;  1BO0 A;  2QGQ A;  1PDQ A;  3P7J A;  3QOL A;  5C4X G;  4A3M B;  2Q8T A;  3S17 B;  3L9A X;  4F8M A;  3GTJ H;  4GN4 B;  2WCY A;  1TS3 A;  4HCE A;  5IYB H;  1I6H B;  2QIL A;  1R9T B;  1SE2 A;  4E6I A;  3HGB A;  2K01 A;  3VR2 A;  3BZD B;  1EIY B;  4RCO A;  2F6M B;  2K14 A;  2RSN A;  4CJ0 B;  1LT5 D;  2FNF X;  2XVS A;  1M1K C;  1W4R A;  1QVF A;  4IUN A;  3ND8 A;  5COR A;  3J7A V;  1SNM A;  2WAQ E;  3GTM B;  4IPD A;  1FNW A;  2CVR A;  3LJ2 A;  4JI2 L;  3NBI A;  4A3B G;  1DOM A;  1PFS A;  3HOU H;  1TS2 A;  3JAM L;  5KNB A;  5E3F A;  1JOK A;  2NVQ H;  3JAM E;  1K0R A;  2YTY A;  4DFA A;  4K5W A;  4UP7 A;  4ZRZ A;  5FO8 B;  1OXV A;  1DS3 I;  1OXS C;  2K9H A;  2OCE A;  5EGT A;  4CKB A;  1V1Q A;  1K8A C;  2CAZ B;  2JK8 A;  1L0Y B;  3P23 A;  2EOT A;  3K80 C;  1F77 A;  3S2H B;  1JR0 D;  2XGT A;  2A74 C;  4PMC A;  1UAP A;  5DAU A;  1I5F A;  3FP9 A;  2UUB Q;  2E8G A;  3QTL D;  3CXL A;  1NTG A;  4XQQ A;  4R8N A;  1GUN A;  4A3E G;  1A8V A;  1TWF H;  1MJ9 A;  1EQV A;  4YZD A;  5E1F A;  3J7A F;  3CW2 C;  3H6M A;  1TWA H;  5C44 G;  3V05 A;  2G9H D;  5A35 A;  3V2T A;  1O7I A;  4C56 C;  3SEB A;  2XTQ A;  3KF6 A;  3I4N H;  2N78 A;  4YY3 L;  2RLD A;  1KDB A;  1CHP D;  3R2I A;  1EWH A;  2FMC A;  1KXL A;  3MXP A;  1AEX A;  1G8Z D;  5IE8 A;  3K59 A;  2K6A A;  2ID0 A;  2R7F A;  3Q22 A;  1PPF I;  1GOZ A;  4R1J A;  5J3B A;  5C3E H;  1JWM D;  4DR6 Q;  3CRL C;  3W5O A;  2VRW B;  3D4D A;  1H9R A;  2EYO A;  1DJR D;  4K5V A;  1D5Z C;  1D1K A;  3K5N A;  1FAR A;  4DR4 L;  4KLK A;  5CGK A;  2A2C A;  1Z7T A;  3NEN A;  2AHO B;  4MTN A;  4QMG A;  2E2H B;  5M5W B;  1HTP A;  3CCR A;  2QEJ C;  4DR7 Q;  3S1M H;  2KEC A;  3TP6 A;  1YIT A;  3DA3 A;  3I4O A;  3E9H A;  3UE1 A;  3HOZ B;  1V9P A;  2ZXR A;  4CHT B;  3KUP A;  2OZU A;  1KAA A;  1QJO A;  1SYE A;  2B63 B;  4BBR G;  3DXJ C;  5BR8 L;  3DEP A;  2UXD L;  3EA6 A;  3NTI A;  4JBJ A;  3S9W A;  3K8A A;  5KNC A;  3GTG H;  1PH7 A;  3DLL A;  4K2L A;  2XSC A;  1Q8I A;  3I3C A;  4ILW A;  4C3J G;  5I2Y A;  5IGE A;  1H95 A;  4MTK A;  3FPU B;  4MHE A;  2KEN A;  4HJ7 A;  2V1C C;  2AQ3 B;  2KCM A;  3CAM A;  1LTI D;  2EY1 A;  1SFO H;  3CP0 A;  4KKT A;  1QB5 D;  2EYF A;  5JJZ A;  5DM6 3;  2KHS A;  2F0P A;  3LJ0 A;  2EJF C;  1SE8 A;  1DOK A;  2VQE L;  5FOB B;  2RQX A;  3GTO B;  5C3W A;  4QUF A;  4A3J H;  3ZJY C;  2WKC A;  1PJU A;  2I46 A;  3DM1 A;  2KQ3 A;  5CCM A;  5CV7 A;  3OIP A;  1V1I A;  2ERW A;  2UUC Q;  1ENC A;  3RZD B;  4X6A H;  5J39 A;  4A3M H;  3AFP A;  3S17 H;  1SGP I;  3EQL C;  4OXP A;  1KTK A;  4DU9 A;  4A3F H;  1I6H H;  1SYC A;  3IAY A;  4L8J A;  3PIO A;  1SND A;  3ITP A;  1CQV A;  4BBS G;  3E59 A;  2E74 C;  3BVZ A;  2AKW B;  3AMU A;  1LAC A;  3KJP A;  1E2W A;  1PH5 A;  1KHI A;  2PMZ B;  1BF4 A;  5E3P A;  4WJW A;  3NEL A;  1TBN A;  5C0X J;  3S1R B;  1EEF D;  3RD4 A;  1LYL A;  3WOE A;  2PW7 A;  1LO5 D;  1SMX A;  2EPB A;  4A3G B;  2Y0S E;  4A93 B;  1Q90 A;  2A69 C;  2QPO A;  2KMO A;  1EOV A;  1Y8O B;  3FRP B;  3HOW G;  1SJE D;  1D8L A;  1JIC A;  5EJW A;  3DWA A;  3BG3 A;  3S2H H;  1TDP A;  1KLG D;  4LF6 Q;  3HEJ A;  2NVX B;  2NU1 I;  1U9R A;  3GDE A;  4BY7 G;  3P75 A;  4LFB L;  2N71 A;  4A75 A;  4PZ6 A;  1K73 C;  5M3F B;  3PUZ A;  2SOB A;  1Y1W G;  1HUM A;  4B3T L;  5GAH C;  4JI4 L;  1Z2I A;  4JK1 C;  2WB1 G;  3LWU A;  3JAM i;  2E2D C;  2Q2T A;  1OXU A;  4G57 A;  1RL2 A;  2HQE A;  1RCV D;  3OTO L;  1LR7 A;  1HNX Q;  1VQ8 A;  1IW4 A;  1E1O A;  1F9R A;  1ZYR D;  3NTK A;  5CV5 A;  3F1Z A;  2F66 B;  4B3M Q;  4IFD G;  4L5Q A;  4DV4 Q;  1TKW B;  1HZ9 A;  2FEF A;  3VYR A;  1IW7 D;  4LF5 Q;  4HTH A;  1SJ8 A;  3VA9 A;  2JYY A;  4I65 A;  2UZ3 A;  1A2U A;  4CJ1 B;  3HS0 C;  2KJX A;  1XPR A;  4KKU A;  3CXC A;  2NBF A;  4QQB X;  2QDL A;  3L0O A;  2FHT A;  4K14 A;  3A8K E;  4JBM A;  1SN8 A;  1X55 A;  2BA1 A;  2ENB A;  3M4P A;  5M5W H;  1HNZ Q;  5CV8 A;  1HZC A;  4EVO A;  1L1O A;  4ZLT F;  1P9Z A;  4RKB A;  3VYU A;  4C3H G;  3HOZ H;  2TMP A;  4LJZ C;  4IPC A;  4L63 B;  2B63 H;  2LB7 A;  3MWY W;  1YNJ D;  2F0F A;  2K50 A;  4P73 A;  1YHQ A;  2PQ8 A;  2DUD A;  3TOB A;  1ONL A;  2KKM A;  2A68 D;  2K75 A;  1P9G A;  2HHH L;  5J1Z A;  4PNY A;  3R2T A;  1B4O A;  2F4I A;  1H9J A;  1CZG A;  2MGS A;  4BXX H;  2B29 A;  1JQY D;  3I72 A;  3QO2 A;  2F03 A;  5C4X B;  3MXN A;  1A6X A;  1O7Y A;  1J8I A;  3CC4 A;  2RVL A;  4FF3 A;  4NV5 A;  3D4R A;  2NZH A;  2YYZ A;  5EBC A;  1TS5 A;  2HDM A;  4A4I A;  3GTO H;  4QF4 A;  3TS2 A;  2AUK A;  4K0K Q;  2TSS A;  2JA6 B;  3CCM A;  1MGS A;  3IFT A;  1ILP A;  3Q6S A;  1KDC A;  5FLM H;  5CBA E;  2A6H D;  4GOP C;  2MO1 A;  4ZUJ A;  2EZV A;  4P2C B;  3M4O H;  3RZD H;  4RGN A;  1H9K A;  2L11 A;  2JE6 I;  1BCP D;  4JOI A;  3GP7 A;  5C4H A;  1QVG A;  3OWF A;  2VL6 A;  1MJE A;  2R93 B;  3VR6 A;  3E0E A;  3F2C A;  4X65 Q;  1EY9 A;  4H0L C;  4TVA B;  2ODD A;  4KMU C;  1LM0 A;  1TWH B;  3S16 H;  3X3M A;  2F0D A;  1A15 A;  4X64 Q;  2VUM B;  1DGS A;  3PO2 H;  2FXQ A;  4CGY B;  3S1R H;  3EVQ A;  1OO9 B;  1QNU A;  4PV1 C;  2SGE I;  2KA7 A;  2H4O A;  3K5M A;  1T5E A;  4C3I G;  3B4V C;  4KN4 C;  2SNM A;  5ISR A;  3FNB A;  1ASY A;  4A93 H;  4Q0F A;  5KEE A;  2D2C C;  2HQL A;  2L0C A;  2HGK A;  3NQI A;  4B9W A;  2RIO A;  2I5H A;  3BDL A;  2F0I A;  3K5O A;  5JEA H;  1XMQ L;  2L7X A;  1TWC B;  2IWH A;  2EQS A;  3CCS A;  5I4D A;  2QQC A;  1P16 A;  1GO3 E;  3JAM c;  3ONA B;  2XTR A;  1PH4 A;  2NVX H;  2BH2 A;  1H0Z A;  1EIF A;  3LX0 A;  2EY2 A;  1W6K A;  1X54 A;  4OWT B;  3NP8 A;  5J22 A;  5M3F H;  2OXP A;  3QOJ A;  1CSP A;  3CCL A;  1PLF A;  4POF A;  5IT9 c;  3D31 A;  4GKK L;  3GV3 A;  4R9W A;  2L1B A;  4JV5 L;  2QKI C;  1GHK A;  4F88 A;  4JI3 L;  3SVM A;  1C7Y A;  4K6D A;  5JPN C;  4UHV A;  1MI2 A;  4LW1 A;  2ZTE A;  3D0F A;  4JI6 L;  3T4A C;  4OX9 L;  2MJ8 A;  1MHW C;  4RKL A;  1Z6H A;  4YHH L;  3S14 H;  5HGT A;  4LF4 L;  4B3R L;  3OW7 A;  4V19 0;  3OXG A;  2A5H A;  1KIX A;  1JB3 A;  1OXT A;  3GO5 A;  4YIJ A;  4JI6 Q;  5JAV A;  4OX9 Q;  1PTO C;  4YHH Q;  1SJH D;  4A3C H;  4LF4 Q;  4B3R Q;  2D62 A;  5GQO A;  1YNN D;  1WTP A;  1KLU D;  3KBX A;  1HQM C;  1PTO F;  1UUC A;  4G75 A;  3DA4 A;  1VQC A;  4QUC A;  5LNK 1;  2JA5 G;  4EQP A;  2K04 A;  1L1O B;  1XPO A;  3TO6 A;  5IIF A;  2LXJ A;  2Z6K A;  4UDU C;  4EQ5 A;  2D5D A;  1K3B C;  1VCI A;  2O5J C;  4O2D A;  1CZW A;  5G3L D;  2F0W A;  4Q5V A;  2Z6K C;  4PZ8 A;  5NUC A;  1S5D D;  2NZ1 D;  1XJV A;  4ZUI A;  5BN4 A;  2LY7 A;  4UAI A;  3HOV G;  1K7T A;  3VYS A;  1ULM A;  4X66 Q;  4JYA L;  2PPB C;  4XYO A;  3ERQ A;  2O4X A;  1M8C A;  1CKN A;  4F7X A;  3MXN B;  3SXH A;  1FJG Q;  3CF5 A;  1IHZ A;  3SK6 A;  3QAH A;  5D3I B;  1GD7 A;  2UUA L;  2ENN A;  2JBW A;  2OTL A;  1EY6 A;  1ESR A;  4FVM A;  2IX1 A;  1NY4 A;  1VMC A;  3HOY G;  1EU4 A;  1N33 Q;  1STA A;  5C4X H;  2F3C I;  3I7F A;  3IL8 A;  5LMU L;  4JW0 A;  4ZQ3 A;  2D0P A;  3TEH B;  1ZEQ X;  4HSV A;  2XIW A;  3I2Z A;  2M00 A;  1QUQ B;  4O1P A;  3WDN A;  1N9W A;  1DS2 I;  2FU2 A;  2NN6 G;  2MUY A;  2JP1 A;  4P75 A;  2JA6 H;  1IYU A;  1VQB A;  3UEY A;  1UNS A;  1J5E L;  1Q9B A;  2ZM6 L;  4AIM A;  3A7L A;  3A8I E;  1PH1 A;  3HOU B;  1JB7 A;  4EQO A;  1XTD A;  1TBQ R;  2MQH A;  3IRB A;  4FF1 A;  1VQ9 A;  2NVQ B;  3QWP A;  4NXN L;  2IPK D;  1HJP A;  2OT2 A;  5FLX c;  3S24 A;  1X65 A;  2ZM6 Q;  2R93 H;  3HKZ B;  3CC2 A;  4ZKB B;  1DYQ A;  1JQO A;  1SGN I;  2EXZ A;  3UGL A;  2M9V A;  1YVC A;  1TWH H;  4OHJ A;  2B2U A;  2JW6 A;  5CYU A;  3N6R A;  3W2D A;  2VUM H;  2Z6B A;  1S5C D;  2WII B;  1EZ6 A;  2JAE A;  3FBV A;  1EYD A;  3MFG A;  1RFH A;  3NQT A;  4JI5 Q;  1TBO A;  4XT1 B;  1MT1 A;  4BY7 B;  1WTX A;  5LL6 S;  2B2U C;  4HR7 B;  3A54 A;  3TME A;  4A3E H;  4OWW B;  5GAD C;  1XPU A;  2Z0S A;  1BVS A;  3G48 A;  5KRU A;  3MXU A;  4DUZ Q;  2BH8 A;  1IBM Q;  1Y1B A;  1VQG A;  1Y14 B;  1GHJ A;  3I4N B;  1TWC H;  1Y1V G;  2WB1 E;  5M3M G;  5FO7 B;  4H02 A;  4QY7 A;  3Q24 A;  4CDD C;  4DV3 L;  1WTV A;  3W1B A;  5IYD G;  5C3E B;  3LWE A;  2EE1 A;  1BKB A;  1UEB A;  4X3K A;  4F87 A;  3TSS A;  2OTJ A;  1PCE A;  4JPB W;  4DV1 Q;  2QQD A;  3S1Q B;  2ZTD A;  2DN8 A;  3MC0 B;  1SE3 A;  4QL5 A;  2ENZ A;  1KL9 A;  2F0M A;  4IJL A;  4DK6 C;  2R3Z A;  3PIO 3;  1ASZ A;  2CH4 A;  2OWO A;  1KD1 C;  5JJI A;  4FO2 A;  1AW7 A;  5I9O A;  2CH4 W;  2CWA A;  2WFW A;  2XMX A;  1Q86 C;  1CGJ I;  2F0E A;  4ME3 A;  3RLN A;  3CMA A;  4MIU A;  1TOT A;  2PO4 A;  5FUX A;  2QSB A;  4HAE A;  3RUZ A;  4QIW B;  1JE4 A;  2WP8 J;  1RF2 D;  4LUZ A;  3A56 A;  2ROW A;  1D5M C;  1E2V A;  3NBH A;  3QJY A;  5L37 A;  2ZJR A;  4KKS A;  2UXC L;  3X3N A;  3R5C A;  4NKL A;  5DLQ E;  1X3E A;  3PF4 A;  4DR1 L;  3NE5 B;  4QIW E;  1LUZ A;  4DV7 L;  4AQY L;  4C3J H;  1UWV A;  2JEB I;  2VQF Q;  5K5P A;  5ELO A;  3RR5 A;  3M4Q A;  3G7L A;  4XT3 B;  3MXG A;  2ZJQ A;  1ENA A;  5DNF A;  3NPP A;  3OYY A;  4ZYS A;  3GV6 A;  4A3J B;  1SYB A;  2N17 A;  1C4Q A;  2BL7 A;  2VB2 X;  4KK7 A;  3RN5 A;  2DGY A;  5ELD A;  2VB3 X;  2VNU D;  3Q0A A;  2QF7 A;  3TRE A;  4BY1 G;  2L15 A;  1EFW A;  3A5U A;  4DXG A;  1ILQ A;  2BDO A;  5ELE A;  3R8B A;  4A3F B;  2EY6 A;  2OQ0 A;  1JC7 A;  2F0U A;  4Z9C B;  1DOL A;  1N32 Q;  1TS4 A;  2F0G A;  3TJQ A;  2WAQ B;  4LF7 L;  1XMO Q;  4WJ4 A;  5K36 G;  5E3Q A;  1HNW Q;  1Q46 A;  1YEZ A;  1HA6 A;  4BBS H;  4HGU A;  2B2V A;  1OMT A;  3GTK H;  4LF7 Q;  5GAE C;  4GKJ Q;  1B9M A;  1EUJ A;  1I4P A;  3J81 L;  2B2V C;  3VR4 A;  3PV0 A;  2QCP X;  3I4M G;  2AMC B;  1TIH A;  1U4R A;  2A20 A;  1SNO A;  2VXW A;  2B2T A;  2L1L B;  2YTX A;  5HUR A;  3UE0 A;  1YIJ A;  3BDC A;  3H3V I;  1PH3 A;  1LTG D;  4LFA Q;  2RSO A;  4LUV A;  5IT9 L;  3GOX A;  1X4S A;  3TO7 A;  3PO3 B;  3H0G B;  2UUB L;  1TXY A;  2B2T C;  4K8I A;  3LGJ A;  4WRD A;  5IT9 E;  3HOW H;  1L2F A;  5C3X A;  1A3V A;  2RDH A;  5C0X G;  3UGD A;  1SLJ A;  2F0Q A;  2JA8 G;  1ET9 A;  2ARP F;  3STB D;  1ESF A;  1IXR A;  2GVB A;  3FHW A;  4BY7 H;  3PF5 A;  5DM7 3;  1YJW A;  1YZ6 A;  5JEA J;  3J81 j;  1Y8F A;  1EQR A;  4ODG A;  3L0I A;  1R4P B;  1A3T A;  1U4L A;  2HCI A;  4LF9 L;  2CQA A;  1CKO A;  3PMF A;  3UEJ A;  2WV6 D;  1K28 A;  2N55 A;  4KHP Q; 
#chains in the Genus database with same CATH homology
 4XIG S;  3IAS 1;  3H3V H;  3S15 H;  4UP9 A;  4IPH A;  4LF9 Q;  5AJ3 Q;  3GD7 A;  4DR6 L;  1LR9 A;  3RLF A;  4L9M A;  3T1Y Q;  3S1Q H;  4DR7 L;  4DK3 C;  1Q81 C;  4R4I A;  2ZJP A;  1VQE A;  3B6Y A;  2R6G A;  3NBH B;  3F2D A;  2UU9 Q;  2KCX A;  1IBK Q;  2NZO A;  1CSQ A;  2R7Z G;  4JI7 Q;  4C3H H;  4POG A;  4JCV E;  1BBW A;  1VQD A;  2P6A C;  1HR0 Q;  2MFI A;  3OW2 A;  1P8L A;  4UXJ A;  3JSB A;  4NV2 A;  2F4V Q;  1KMA A;  3HOX G;  1HZA A;  2RCN A;  1PH2 A;  2UUC L;  4KHZ A;  3PDN A;  2VZA A;  3KYH C;  4YWK A;  3E9I A;  1Q7Y C;  2GKR I;  2K19 A;  2PI2 E;  2JQO A;  1EQQ A;  4R4C A;  3KJO A;  3FKI G;  1AH9 A;  2J87 A;  2XRC A;  4BA2 I;  1WCM G;  4A3D G;  4AS3 A;  2E73 A;  1G6P A;  4NXM Q;  5LMN W;  2YUU A;  1SRO A;  5HY6 A;  5IP9 G;  1Q8K A;  4DUY Q;  4Z7G A;  4PG3 A;  4C3I H;  1BUS A;  4P72 A;  4LF6 L;  3CCJ A;  4DV6 L;  3PO3 H;  2IHE A;  3H0G H;  4A76 A;  3PUY A;  2NVY H;  4DV6 Q;  2KHJ A;  2LXK A;  1PVO A;  1YJN A;  1Z47 A;  4GLA C;  3CPW A;  1HNX L;  3I55 A;  3J81 i;  3BJI A;  1M8B A;  4OWX B;  2A19 A;  4B3M L;  3A5Z B;  4DV4 L;  4R4Q A;  2V53 A;  1Y1C A;  4Z7H A;  1N36 Q;  4LF5 L;  1X74 A;  3AFQ A;  5H1S E;  2N49 A;  1YO7 A;  3PUW A;  4GS3 A;  3RZO H;  4DV5 Q;  2F52 A;  4UP8 A;  1Q1B A;  1PH6 A;  1JJG A;  1XNQ Q;  2R7D A;  5IYC G;  1HZB A;  2W0T A;  1HNZ L;  2JA5 H;  1YHB A;  2ORW A;  4PL4 A;  4IO9 A;  2N3S A;  4JBW A;  2AWN A;  4PL5 A;  4JG2 A;  1L1O C;  1IBL Q;  2A8V A;  4GLX A;  4A3I H;  2JA7 H;  3HKS A;  3ULP A;  3FC3 A;  3F2B A;  1MJC A;  1XBT A;  4JI0 Q;  2YFA A;  1M90 C;  4K0K L;  2R92 G;  3KY9 A;  1U0L A;  1IY6 A;  3K7U C;  2NU0 I;  2OD1 A;  4SGB I;  1QUQ A;  4OAV B;  4X65 L;  1V43 A;  4DAM A;  2JEA I;  2YU9 H;  5JHW C;  5GRO A;  2B3G A;  2RHS B;  1K3R A;  4X64 L;  2UXB Q;  4JOI C;  4DR3 L;  3A0J A;  4ALP A;  3UDX A;  4DR3 Q;  1XX6 A;  2IT1 A;  3TQY A;  1U5K A;  5IY0 A;  4LNQ A;  2KBN A;  2I0Q A;  3OXF A;  4DV2 Q;  3VDP A;  1NMF A;  3CCE A;  1YTP A;  4E1P A;  5LMN Q;  1NMG A;  3U4Z A;  1VQN A;  3J80 c;  3U58 A;  3GTL H;  2JZM A;  3GTP H;  3J81 c;  1Z7K B;  1SRU A;  4A3K G;  1PTR A;  1Y1V H;  3I9V 1;  4P74 A;  2KHI A;  3K7A H;  2CQO A;  1UE1 A;  4Y7N H;  5M3M H;  3T1H Q;  5FUY A;  1PH9 A;  5IYD H;  1A0I A;  3CQZ H;  1IYJ B;  4JI8 Q;  4IFD J;  1S40 A;  4A24 A;  1CE3 A;  3RLO A;  1Q82 C;  3AYH B;  4DKA C;  4YCV A;  3KDF B;  1KQS A;  4LF8 Q;  3RU0 A;  2QA4 A;  1VQ6 A;  3RN2 A;  4X66 L;  2N52 A;  1FJG L;  2YV5 A;  3S2D H;  3SGQ I;  1OXX K;  1SR3 A;  2YFB A;  1N33 L;  1G51 A;  4LWC A;  5CCL A;  2JJQ A;  3HOZ G;  3UIT A;  2B63 G;  2K5V A;  4R4T A;  4TQU S;  4BY1 H;  3SDJ A;  1VQA A;  3D00 A;  1VQH A;  1WJJ A;  3AJF A;  1NUB A;  1X3G A;  2SGP I;  3RNU A;  3UFF A;  4FDB A;  1VQP A;  4Q9V A;  2KMQ A;  3AQQ A;  1L0W A;  4U6R A;  2VS1 A;  4A3B H;  3UGI A;  3LJ1 A;  1CHO I;  2RHQ B;  3PUV A;  4HIK A;  1Z9F A;  3I4M H;  4QGU A;  5IP7 G;  3M3Y H;  5C4J H;  2JB2 A;  4JI5 L;  2E2I H;  2IY5 B;  3SGI A;  2XTI A;  4DUZ L;  3KP9 A;  1IBM L;  5JJL A;  5FUW A;  2ELI A;  2JA8 H;  2LUY A;  4X62 Q;  4PZ7 A;  2ASB A;  4O1O A;  3PGZ A;  4UY8 C;  1IZ6 A;  4C2M H;  4HJA A;  1I94 Q;  5C44 H;  4HJ9 A;  3U50 C;  1HH2 P;  4A3G G;  4HJ8 A;  3F8T A;  4A93 G;  4DR5 Q;  2B0U C;  4DV1 L;  3G4S A;  1VQO A;  4B3S Q;  4LFC Q;  3SGB I;  2SGQ I;  1UVG A;  5M3F G;  3UDI A;  4IOC A;  3G6E A;  4HIM A;  2NU3 I;  1TWG H;  1X9N A;  2GKT I;  4GNX B;  2PNH A;  2PQA B;  3CME A;  1OYV I;  1TGS I;  2DIP A;  4BBR H;  2VQF L;  1BBU A;  5EX3 A;  4HIO A;  5M5Y H;  1EYG A;  5FJ8 G;  2ES2 A;  2CCZ A;  2H5X A;  3HOX H;  2DB6 A;  4OO1 G;  1R79 A;  3CD6 A;  4OAU C;  3BZK A;  1N32 L;  1VQ5 A;  1FYB A;  3CCQ A;  3KFU A;  1XMO L;  4L5R C;  1HNW L;  1FGU A;  1RIP A;  3FKI H;  2V6E A;  1K9M C;  1E1T A;  1XNR Q;  4GKJ L;  1JMC A;  1AE3 A;  1GVP A;  1N34 Q;  3M9B A;  4UXH A;  1EWI A;  4A3L G;  4PMW A;  3HFZ B;  4LFA L;  1D7Q A;  1I50 H;  5IP9 H;  4HJ5 A;  2JA6 G;  2GN5 A;  4IFD I;  2I5L X;  1WFQ A;  3BU2 A;  1MIU A;  5HGQ A;  2NVT H;  4XTC S;  1VQL A;  1WI5 A;  2R93 G;  1G29 1;  4JI2 Q;  4KHP L;  1Y1W H;  2ALY B;  2VUM G;  5AJ3 L;  2CFM A;  2A1A A;  3OL0 A;  5JJK A;  4RMF A;  3ULL A;  2MO0 A;  3OXL A;  3DM3 A;  5EAY A;  3UDF A;  3T1Y L;  4DR2 L;  4AYB G;  3VDU A;  2M5X A;  1OVO A;  1LR8 A;  1W2B A;  1VQF A;  5IYC H;  2YTV A;  4DR2 Q;  2UU9 L;  2Q2U A;  1JT8 A;  2EXD A;  1IBK L;  4E1R A;  4HFV A;  4JI7 L;  4YY3 Q;  3SEK C;  2NU4 I;  1HR0 L;  4BA1 I;  4P71 A;  2K5H A;  3WWV A;  3G71 A;  1B8A A;  1N13 A;  1KBF A;  2JB3 A;  2F4V L;  4Y52 H;  3KF8 B;  2E2J H;  1YBY A;  1YNX A;  4DR4 Q;  3PSI A;  4R4O A;  1NE3 A;  3MEK A;  5DAE A;  2V1C A;  3DO9 A;  1PYS B;  2R92 H;  1IY5 A;  5BR8 Q;  2UXD Q;  2ATW A;  3M7N A;  3EN2 A;  1AN1 I;  1UE5 A;  4NXM L;  2I5M X;  2ZRR A;  1X3F A;  3JC6 6;  3MEF A;  3PUX A;  4DUY L;  2VQE Q;  2J9R A;  3ULJ A;  5IYB G;  1E24 A;  1HPT A;  1R0R I;  4GI3 C;  2JA9 A;  1R9T H;  1FL0 A;  2K52 A;  1NJI C;  2E5R A;  1YI2 A;  1XA6 A;  1E3P A;  2JA1 A;  3GTM H;  3HOU G;  1OMU A;  3K81 C;  2N8N A;  1UE7 A;  2PMZ E;  4YWL A;  2CKZ B;  4LUO A;  3HKZ G;  3J80 i;  4A3K H;  1SGQ I;  1QZH A;  4MZ9 A;  1N36 L;  5ELN A;  1S3O A;  3CCV A;  3NEM A;  4DV5 L;  4YCW A;  1XNQ L;  3W1G A;  4DNI A;  3BJU A;  2K4K A;  1PH8 A;  2CJS C;  1VQ7 A;  2HIX A;  2L8E A;  1A63 A;  1YHA A;  2ZTC A;  3KF6 B;  4LFB Q;  1PV4 A;  3I4N G;  4B3T Q;  4JI4 Q;  1MKH A;  3OTO Q;  3KDF A;  2IP6 A;  3KLW A;  5EX0 A;  5C3E G;  4B6D A;  4I1T A;  4HID A;  1IBL L;  5FUV A;  2F3I A;  2NN6 I;  4UXI A;  1K83 H;  2FUG 1;  3CCU A;  4YZ9 A;  3HOV H;  4JI0 L;  2E2H H;  4IJH A;  4OON A;  4APV A;  1B7Y B;  2HIV A;  2C35 B;  2KMP A;  4RG1 A;  1KC8 C;  1CT0 I;  1WOC A;  3HOY H;  2JB1 A;  3CPF A;  2LEO A;  3KOJ A;  1N8R C;  4DWL A;  4PL3 A;  1JE5 A;  2QQ0 A;  4AH6 A;  2GVA A;  2BUS A;  2NU2 I;  4EX5 A;  2E5L L;  1BMO A;  4OVO A;  2UXB L;  2HHH Q;  1CUK A;  2E5L Q;  4A3J G;  4YZC A;  1E7Z A;  4DPG A;  4GOP A;  1VQM A;  4QJF A;  4A3M G;  5IP7 H;  5GAG C;  1PTQ A;  4A3F G;  3PCO B;  3A74 A;  4DV2 L;  3ERS X;  1KRT A;  1CT2 I;  2WAQ G;  4JBK A;  5LMN L;  3GTQ H;  1T9H A;  1C0A A;  1HJA I;  3AEV A;  3BZC A;  1I3Q H;  1SGE I;  4GN5 A;  1HDL A;  4HEA 1;  4J15 A;  3T1H L;  4L5S A;  2OQK A;  2N1A B;  2BA0 A;  4A3G H;  4NB3 A;  4IOA A;  2Q2I A;  3PO3 G;  4JI8 L;  3H0G G;  4JI1 L;  1PA6 A;  5HGI A;  1JJ2 A;  3TRZ A;  3PIP A;  1YJ9 A;  4JI1 Q;  3UDG A;  3ICE A;  2IHF A;  1XMQ Q;  4WJ3 M;  1VQK A;  4AS2 A;  4AYB E;  1FAQ A;  4UPA A;  4LF8 L;  4OO1 I;  3HH2 C;  4JC0 A;  2GKV A;  2GVI A;  1NBW A;  1KAW A;  4GKK Q;  3H15 A;  2RF4 A;  2Q2H A;  4G76 A;  4GNX A;  2PQA A;  4JV5 Q;  4JI3 Q;  4DAY B;  2WVJ A;  3VE5 A;  2AWO A;  2ORV A;  4GNX C;  5FJ8 H;  1VQ4 A;  1CGI I;  1E22 A;  2SGD I;  1Q1E A;  1KRS A;  4GN3 B;  3L2P A;  1PYB A;  1V1H A;  3CC7 A;  1VQI A;  1K8G A;  3F4M A;  1B70 B;  1W3S A;  4O0A A;  4A3I G;  2JA7 G;  1AE2 A;  5C0X I;  1CSO I;  2EIF A;  1VDD A;  2VY3 A;  4BXX G;  1FVI A;  1IL2 A;  2LSS A;  3TS0 A;  4JYA Q;  2JXD A;  1CKM A;  2SGF I;  3U4V A;  4GOP B;  4A3L H;  2P22 B;  3I56 A;  2UUA Q;  3OVO A;  5HI7 A;  1QZG A;  2QQE A;  5FLM G;  1GM5 A;  5LMU Q;  4GXT A;  5IWA L;  1TBR R;  4X62 L;  5E7N A;  5IWA Q;  2MNA A;  1J5E Q;  1I94 L;  3E2I A;  3PO2 G;  4NXN Q;  3IAM 1;  3Q8D A;  4YCU A;  2Y0S G;  1WYD A;  2KMR A;  3HKZ E;  1OTC A;  4DR5 L;  1JJC B;  2CWP A;  1PHJ A;  1S72 A;  4B3S L;  4LFC L;  1KBE A;  2HT1 A;  4MNO A;  2B8T A;  1VQJ A;  5JEA G;  2QEX A;  1UE6 A;  1UVF A;  2OVO A;  4FKD A;  4DV0 L;  2KCT A;  2MJF B;  3J7Z C;  3J7A 5;  1CT4 I;  3EBE A;  1TUR A;  4DV0 Q;  3M85 A;  1A62 A;  4NPS A;  2YQP A;  1LTL A;  2A2D A;  4DV3 Q;  1GKH A;  4KI0 A;  1X6O A;  2R7Z H;  1HR0 W;  1QVC A;  1C9O A;  3L7Z C;  1SGR I;  4L5T A;  2D0O A;  3K0X A;  4YWM A;  4A3C G;  5M5X H;  3EIV A;  5HQ8 A;  3STB C;  1X56 A;  2IX0 A;  2K5N A;  4GLV B;  3ER0 A;  1VS0 A;  3VDY A;  3S1N H;  2UXC Q;  1Q12 A;  2PI2 A;  4DR1 Q;  1SGY I;  1CKN B;  2VW9 A;  4DV7 Q;  4AQY Q;  1XNR L;  1N34 L;  1TUS A;  1SGD I;  1YU6 C;  1J6Q A;  4IPG A;  1WCM H;  4A3D H;  2QGQ A;  5C4X G;  3GTJ H;  4GN4 B;  2WCY A;  5IYB H;  1EIY B;  2F6M B;  2K14 A;  2FNF X;  1M1K C;  1W4R A;  1QVF A;  2WAQ E;  4IPD A;  3LJ2 A;  4JI2 L;  4A3B G;  1PFS A;  3HOU H;  2NVQ H;  1K0R A;  2YTY A;  4UP7 A;  1OXV A;  1DS3 I;  1OXS C;  2K9H A;  2OCE A;  1V1Q A;  1K8A C;  2CAZ B;  2JK8 A;  3P23 A;  3K80 C;  2XGT A;  1I5F A;  3FP9 A;  2UUB Q;  2E8G A;  3QTL D;  3CXL A;  1NTG A;  4A3E G;  1A8V A;  1TWF H;  4YZD A;  3CW2 C;  1TWA H;  5C44 G;  1O7I A;  2XTQ A;  3KF6 A;  3I4N H;  2N78 A;  4YY3 L;  1KXL A;  5IE8 A;  2R7F A;  2ID0 A;  1PPF I;  4R1J A;  5J3B A;  5C3E H;  4DR6 Q;  3W5O A;  2VRW B;  1FAR A;  4DR4 L;  4KLK A;  2A2C A;  3NEN A;  2AHO B;  4MTN A;  3CCR A;  4DR7 Q;  3S1M H;  1YIT A;  3DA3 A;  3I4O A;  3E9H A;  3UE1 A;  1V9P A;  4BBR G;  5BR8 L;  2UXD L;  4JBJ A;  3K8A A;  3GTG H;  1PH7 A;  3DLL A;  1H95 A;  2KEN A;  4HJ7 A;  2V1C C;  2KCM A;  3CAM A;  1SFO H;  3CP0 A;  3LJ0 A;  1SE8 A;  2VQE L;  4A3J H;  3ZJY C;  1PJU A;  5CCM A;  1V1I A;  2ERW A;  2UUC Q;  4X6A H;  4A3M H;  3AFP A;  3S17 H;  1SGP I;  4OXP A;  4A3F H;  1I6H H;  3PIO A;  4BBS G;  3E59 A;  2AKW B;  3KJP A;  1PH5 A;  1KHI A;  1TBN A;  3NEL A;  5C0X J;  1LYL A;  1SMX A;  2Y0S E;  2QPO A;  2KMO A;  1EOV A;  3HOW G;  1D8L A;  3S2H H;  4LF6 Q;  2NU1 I;  3GDE A;  4BY7 G;  4LFB L;  2N71 A;  4A75 A;  4PZ6 A;  1K73 C;  3PUZ A;  1Y1W G;  4B3T L;  4JI4 L;  5GAH C;  2WB1 G;  3JAM i;  2Q2T A;  1OXU A;  1RL2 A;  3OTO L;  1LR7 A;  1HNX Q;  1VQ8 A;  1IW4 A;  1E1O A;  3F1Z A;  2F66 B;  4B3M Q;  4IFD G;  4L5Q A;  4DV4 Q;  1HZ9 A;  4LF5 Q;  1SJ8 A;  3VA9 A;  2JYY A;  2UZ3 A;  1XPR A;  3CXC A;  4QQB X;  3L0O A;  4JBM A;  1SN8 A;  1X55 A;  2BA1 A;  3M4P A;  5M5W H;  1HNZ Q;  1HZC A;  1L1O A;  3HOZ H;  4IPC A;  2B63 H;  2K50 A;  4P73 A;  1YHQ A;  2DUD A;  2KKM A;  2K75 A;  2HHH L;  4BXX H;  2B29 A;  3CC4 A;  4NV5 A;  2NZH A;  2YYZ A;  4A4I A;  3GTO H;  3TS2 A;  4K0K Q;  3CCM A;  5FLM H;  4GOP C;  2MO1 A;  3M4O H;  3RZD H;  2JE6 I;  4JOI A;  1QVG A;  2VL6 A;  1MJE A;  3E0E A;  3F2C A;  4X65 Q;  4TVA B;  2ODD A;  1LM0 A;  3S16 H;  4X64 Q;  1DGS A;  3PO2 H;  2FXQ A;  3S1R H;  2SGE I;  3B4V C;  1ASY A;  4A93 H;  2HQL A;  2RIO A;  2I5H A;  1XMQ L;  2L7X A;  2EQS A;  3CCS A;  2QQC A;  1P16 A;  1GO3 E;  3JAM c;  2XTR A;  1PH4 A;  2NVX H;  2BH2 A;  1H0Z A;  1EIF A;  1X54 A;  4OWT B;  5M3F H;  1CSP A;  3CCL A;  4POF A;  5IT9 c;  3D31 A;  4GKK L;  4JV5 L;  4JI3 L;  1C7Y A;  4LW1 A;  2ZTE A;  3D0F A;  4JI6 L;  4OX9 L;  4YHH L;  3S14 H;  4LF4 L;  4B3R L;  3OXG A;  1KIX A;  3GO5 A;  1OXT A;  4JI6 Q;  4OX9 Q;  4YHH Q;  4A3C H;  4LF4 Q;  4B3R Q;  2D62 A;  5GQO A;  1UUC A;  4G75 A;  3DA4 A;  1VQC A;  5LNK 1;  2JA5 G;  1L1O B;  1XPO A;  2LXJ A;  2Z6K A;  4EQ5 A;  1VCI A;  4O2D A;  2Z6K C;  4PZ8 A;  1XJV A;  3HOV G;  4X66 Q;  4JYA L;  1M8C A;  1CKN A;  3MXN B;  1FJG Q;  3CF5 A;  1GD7 A;  2UUA L;  2ENN A;  2OTL A;  2IX1 A;  1NY4 A;  3HOY G;  1N33 Q;  5C4X H;  2F3C I;  3I7F A;  5LMU L;  2D0P A;  3TEH B;  3I2Z A;  1QUQ B;  4O1P A;  1N9W A;  1DS2 I;  2NN6 G;  4P75 A;  2JA6 H;  1VQB A;  3UEY A;  1J5E L;  2ZM6 L;  4AIM A;  1PH1 A;  1JB7 A;  1XTD A;  1TBQ R;  2MQH A;  3IRB A;  1VQ9 A;  3QWP A;  4NXN L;  1HJP A;  5FLX c;  3S24 A;  1X65 A;  2ZM6 Q;  2R93 H;  3CC2 A;  1SGN I;  3UGL A;  1YVC A;  1TWH H;  2JW6 A;  2VUM H;  2JAE A;  3FBV A;  1RFH A;  1TBO A;  4JI5 Q;  1MT1 A;  4A3E H;  4OWW B;  5GAD C;  1XPU A;  2Z0S A;  1BVS A;  3G48 A;  4DUZ Q;  2BH8 A;  1IBM Q;  1Y1B A;  1VQG A;  1Y14 B;  1TWC H;  1Y1V G;  2WB1 E;  5M3M G;  4H02 A;  4QY7 A;  4DV3 L;  3W1B A;  5IYD G;  1BKB A;  1UEB A;  2OTJ A;  1PCE A;  4DV1 Q;  2QQD A;  2ZTD A;  4QL5 A;  2ENZ A;  1KL9 A;  4IJL A;  4DK6 C;  1ASZ A;  2OWO A;  5JJI A;  1KD1 C;  1Q86 C;  2WFW A;  2CWA A;  2XMX A;  1CGJ I;  4ME3 A;  3RLN A;  3CMA A;  1TOT A;  5FUX A;  2WP8 J;  4LUZ A;  2ROW A;  2UXC L;  2ZJR A;  5DLQ E;  1X3E A;  3PF4 A;  4DR1 L;  4QIW E;  1LUZ A;  4DV7 L;  4AQY L;  4C3J H;  1UWV A;  2JEB I;  2VQF Q;  5ELO A;  3RR5 A;  3M4Q A;  2ZJQ A;  3OYY A;  2N17 A;  3RN5 A;  2DGY A;  2VNU D;  3TRE A;  4BY1 G;  2L15 A;  1EFW A;  3A5U A;  2OQ0 A;  1N32 Q;  3TJQ A;  4LF7 L;  1XMO Q;  4WJ4 A;  5K36 G;  1HNW Q;  1Q46 A;  1YEZ A;  4BBS H;  4HGU A;  1OMT A;  3GTK H;  4LF7 Q;  5GAE C;  4GKJ Q;  1EUJ A;  3PV0 A;  3I4M G;  2AMC B;  1TIH A;  2A20 A;  2L1L B;  2YTX A;  1YIJ A;  3UE0 A;  3H3V I;  1PH3 A;  4LFA Q;  4LUV A;  3GOX A;  1X4S A;  2UUB L;  1TXY A;  3LGJ A;  3HOW H;  1L2F A;  5C0X G;  3UGD A;  1SLJ A;  2JA8 G;  2ARP F;  3STB D;  1IXR A;  2GVB A;  3FHW A;  4BY7 H;  3PF5 A;  1YJW A;  1YZ6 A;  5JEA J;  3J81 j;  1Y8F A;  1EQR A;  3L0I A;  4LF9 L;  1CKO A;  3UEJ A;  4KHP Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...