2V1CC

Crystal structure and mutational study of recor provide insight into its role in dna repair
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
234
structure length
229
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Mutational Study of Recor Provide Insight Into its Mode of DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
molecule keywords RECOMBINATION PROTEIN RECR
total genus 52
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02565 RecO_C Recombination protein O C terminal
C PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2v1cC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2v1cC01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v1cC03
3F2DA 4DR6Q 1Y1WG 1BBUA 1B8AA 3S1QH 1HZCA 4UPAA 4AYBG 5M3FG 2Q2TA 5IYDH 4DAYB 2Z6KA 5M3MG 5IWAQ 3M3YH 1VS0A 3I4OA 4DV2Q 4BXXH 4PZ7A 4YWKA 4YHHL 2I5MX 3G4SA 4DV6L 3PIPA 1N32Q 3D0FA 1MIUA 2Q2HA 2Q2IA 4DV4Q 4LFAL 1VQ5A 2E8GA 3M4QA 4BBSG 1VQCA 2VQEQ 4YY3Q 4JI0L 1VQKA 2KCTA 3PIOA 1PH4A 4DR3L 3H3VI 1I3QH 4X6AH 2QGQA 3UDXA 4C2MH 1WOCA 1XPOA 3S1NH 3BU2A 1T9HA 3KJPA 3S16H 3KF6B 4O0AA 2EIFA 5GROA 3I55A 1EIYB 3BJUA 2ZM6L 2UUBL 1TWHH 1PVOA 1XTDA 2R93H 1SRUA 2KCMA 1PYSB 4JI1Q 1C7YA 4DR2L 1HNWL 5K36G 1EQQA 2KHIA 1PH8A 4R4OA 1QVGA 5GADC 4P72A 2PI2A 3NENA 3PUVA 1KIXA 3CCLA 4A3FH 2V1CC 3CW2C 4BY1G 4JI3L 4X64L 3T1HL 4A3IH 2D0PA 4LF6Q 4KHPQ 3S17H 3KLWA 3J80c 4GN5A 1CUKA 3ULLA 4X62Q 4A3CH 4DR6L 3RNUA 1Q1BA 5DLQE 1Q86C 5BR8L 4B3ML 2JA8G 5E7NA 5IWAL 2E2JH 1HZAA 3M4OH 2ATWA 3PO2H 2FXQA 1CKNB 1P16A 1N36Q 2RHQB 1K3RA 2GN5A 4JBJA 5IYCG 4YWLA 3CXCA 1PH1A 2UXCQ 1A63A 1TWGH 3STBC 4B3TQ 4JYAQ 1SN8A 4DR7L 2RF4A 4HJAA 1I94Q 4MTNA 1N32L 4BA1I 4R4CA 4DR4L 1KHIA 4JOIA 3JC66 2JA6H 3L7ZC 4UP7A 3HOYG 3FKIG 2DUDA 4KHZA 3F8TA 4DKAC 3PUYA 5GAGC 1IBMQ 5C3EG 3I4MG 2HIVA 4K0KL 4J15A 1MJCA 3I56A 1W2BA 4GKJQ 1E1OA 1G6PA 4A3BH 1ASYA 2E5LL 3FHWA 2F4VQ 3F1ZA 1SLJA 3J81j 1GKHA 2IY5B 1BKBA 2K5HA 2Q2UA 4LNQA 1YVCA 1HR0L 3NEMA 4C3IH 4LF5L 3AQQA 4B3SQ 1XNQQ 2BA1A 4NXML 3I4NG 1S72A 3PO3G 2OTJA 1O7IA 4DR2Q 1X3GA 3CPWA 1QUQA 3VDYA 2Y0SE 3SGIA 1KC8C 3GTQH 4JV5L 1IBLQ 2MO0A 2HHHL 3BZCA 4A3IG 4JI3Q 2JEAI 5M5YH 4LF6L 1X3FA 4DK3C 3G71A 3J7ZC 4GNXA 4GLXA 1PH6A 1QZHA 2K5NA 4DPGA 2R6GA 3GTGH 2AWOA 3PUWA 4OWTB 1OXVA 1VQGA 1V43A 1L1OA 2IHFA 4DK6C 3T1YQ 3M7NA 2R7ZH 2NZHA 3S15H 4IFDG 2YTYA 3J7A5 3J80i 2CFMA 1JJGA 3H0GG 2NZOA 4GN4B 2I0QA 4DR7Q 5IE8A 3MXNB 1K9MC 5LMNL 1YJWA 2PQAB 3U4VA 1Y1VG 2R92H 1Y1WH 1M90C 2ZJPA 4BBRH 2L15A 4A3MG 1HZBA 4L5RC 5C4XG 1NE3A 3H0GH 2VQFL 2N3SA 3EBEA 1E1TA 4HJ7A 3AFQA 3UDIA 3K7UC 1WCMH 4DV1Q 1IBML 2PMZE 1VQHA 1X54A 2ZTEA 3AYHB 5J3BA 3CCRA 3CF5A 2JA5G 4K0KQ 4IPCA 2A8VA 1JE5A 5GQOA 2E5LQ 2F4VL 1HNXL 1C9OA 4GOPC 3S1RH 2JA9A 4LFCQ 1TXYA 2WP8J 5FJ8H 1PH7A 3OTOQ 1WYDA 4POFA 1TWFH 1Z47A 1AH9A 2B63G 1V9PA 2XGTA 3PO3H 4NXMQ 1CKNA 3M85A 2JJQA 3HOZG 3CC2A 3KDFB 3GDEA 2OCEA 4JI8Q 2QA4A 3GTKH 2UXDQ 3AFPA 4LF8L 4JV5Q 1I6HH 1HJPA 1AE3A 1PHJA 1NBWA 2K75A 5GAHC 1JT8A 1VQ6A 4JI6Q 3CCVA 3I7FA 3W5OA 3AEVA 3A0JA 1X3EA 4C3JH 2IT1A 2K50A 3HKSA 4GKKL 3PCOB 3TRZA 4JBWA 1BVSA 1PH2A 5JJLA 4X65Q 1A62A 1X65A 2AHOB 1XMOQ 1X55A 4HIDA 3PF5A 1EFWA 3S2HH 1A8VA 2CWAA 4A3FG 1Q81C 1E3PA 3L0OA 2OWOA 1B7YB 1Y14B 4KLKA 4QY7A 4DV6Q 3BZKA 1Z9FA 1FJGL 3F2BA 2LXJA 3KDFA 5JEAG 5LMNQ 3GD7A 4LFAQ 2N78A 3NBHB 5C0XI 3CMAA 2OTLA 3CAMA 2CCZA 2K14A 1NJIC 2ZJQA 4NPSA 4JCVE 2NN6I 1VQLA 1UWVA 3M4PA 2ID0A 4GNXB 4JI7L 1KD1C 1JMCA 4ALPA 1VQ9A 4LF4Q 2JE6I 4IPHA 1N33Q 5FLMH 1IXRA 1JJ2A 3RLFA 2UUCQ 3GTMH 4P73A 4JC0A 3S14H 4AYBE 4LFCL 1EIFA 3ICEA 4TVAB 3JAMi 2ZM6Q 2I5HA 2VUMG 1PFSA 1SE8A 4A93H 1IL2A 1LYLA 1X6OA 4P74A 4IFDJ 4H02A 2IX1A 1YZ6A 2XTIA 5IYBH 3CMEA 4BY7H 1HNWQ 1JJCB 1PYBA 1UE5A 4LF8Q 2R93G 3W1GA 2AWNA 3CD6A 3T1HQ 1L1OB 1VCIA 4KHPL 1E7ZA 4XTCS 1Q1EA 3HKZE 1K73C 4JI6L 5IP9H 3HOUH 4DUYQ 2HT1A 1CSPA 3A5UA 4O2DA 5BR8Q 4B3MQ 1ASZA 3HFZB 1K0RA 4AIMA 4DV3Q 4A3CG 1IYJB 3HKZG 2D62A 1KL9A 4JG2A 4OONA 4APVA 2CWPA 3UE0A 2LSSA 3OW2A 3NELA 1PV4A 4LF7Q 1UE6A 2UXCL 1K8GA 4B3TL 3H3VH 1OTCA 4LFBL 2N8NA 1SFOH 1VQAA 1I94L 4IOCA 1EOVA 1YIJA 2I5LX 1XMQL 2VY3A 1PA6A 1KXLA 1EQRA 3H15A 2R7DA 2A1AA 2VL6A 1VQOA 1YNXA 2F3IA 1SR3A 2KBNA 4IJLA 3W1BA 5M3MH 3HOXG 4PG3A 5IYDG 2YU9H 4GKJL 1N33L 3M9BA 2B3GA 3GTOH 3KF6A 5H1SE 2UUCL 2F52A 4YCVA 5EAYA 2UU9L 4UY8C 3CC4A 3CCQA 4BY1H 4WJ4A 3RZOH 3HOWG 4L5QA 2UUAL 4NB3A 1HR0Q 4LF5Q 2D0OA 2WB1E 4B3SL 1YJNA 1VQ7A 1WCMG 4BBSH 1UEBA 1QUQB 4DV7Q 2NVXH 1WJJA 2E2HH 2IHEA 3A5ZB 1Q46A 1YHAA 3PV0A 3ZJYC 4EQ5A 2IX0A 2MNAA 4FDBA 4OO1I 3HOWH 3CP0A 2HHHQ 1J5EL 4HJ5A 2N49A 3HOVG 2K52A 3UE1A 3B6YA 3I4NH 1Q7YC 3E9IA 3HOUG 4A3JG 5C44H 1WFQA 4OWWB 2HIXA 2B63H 4A3LH 3E9HA 1FVIA 2JEBI 1VQNA 5ELOA 4DV3L 2VZAA 1D8LA 4IO9A 1QVCA 2YYZA 4IPGA 3ER0A 1OXXK 2MFIA 1LTLA 3I2ZA 1VQEA 3CQZH 1HR0W 4LF7L 4JI2L 3RR5A 1HNZQ 2PQAA 3TREA 1XMQQ 1AE2A 4DR1L 4DV5L 1FGUA 2K5VA 4POGA 4A3EH 3TS2A 2VQFQ 2R7FA 1MKHA 1DGSA 3OYYA 5IT9c 3HOXH 1VQPA 5IY0A 3PUZA 1N34Q 2AMCB 2RCNA 4A3KG 3PO2G 3TQYA 4JI5L 4OX9Q 4AQYL 1PH3A 1MJEA 3U50C 4L5SA 2E2IH 4B3RL 2Z0SA 3CCUA 3G48A 3J81i 2UU9Q 5IYCH 1NMFA 5JJKA 1C0AA 3ERSX 2JK8A 1S3OA 3KFUA 1E22A 4A3KH 1YHBA 3RN5A 1FL0A 2GVBA 4DV7L 4DV0Q 5C0XG 3KJOA 2JA6G 5FLMG 2UXDL 2NN6G 3HOYH 1U0LA 4GLAC 1JB7A 4GS3A 1J5EQ 1XPRA 4LW1A 3STBD 4Y7NH 3L2PA 2WAQE 4YWMA 4A3GG 4GKKQ 2UXBL 4QQBX 5C4XH 4X65L 5C44G 4LUVA 4P71A 3S2DH 1XMOL 4LUZA 3E0EA 4R4QA 3TEHB 5IYBG 2K4KA 4DV4L 3CC7A 4JBMA 2JA8H 2MQHA 1LUZA 3RLNA 1OXSC 4DUZL 1HNZL 4A4IA 4GN3B 2VQEL 4YY3L 1PH5A 4JI0Q 1FJGQ 2Y0SG 1HZ9A 3EIVA 5M5XH 4DR3Q 1X56A 1EYGA 2OQKA 1CSQA 4DR1Q 5GAEC 1VQMA 5FJ8G 3Q8DA 1EUJA 1VQBA 4YCWA 2JA7G 2VNUD 2QEXA 3IRBA 1IZ6A 1L2FA 1VQJA 3LGJA 3KOJA 4A3DH 1XNRQ 4UP8A 4JI7Q 2RHSB 4X66L 1EWIA 2YV5A 2WAQG 1N34L 4LF4L 4OO1G 2AKWB 2DGYA 3K0XA 3RN2A 2UUBQ 1QVFA 1W3SA 2H5XA 1K83H 4AQYQ 4B3RQ 4JI1L 1Q12A 5M3FH 4A75A 4A3MH 2CKZB 4MZ9A 1OXUA 1UE1A 4BXXG 2YTVA 2BA0A 3S24A 1Y1VH 3WWVA 4LUOA 2R92G 1J6QA 4X64Q 5IP7G 1K8AC 4A3JH 3RLOA 1I50H 4R1JA 4X62L 1BBWA 4C3HH 1PH9A 3PF4A 2OQ0A 3K8AA 4AH6A 3MEFA 1E24A 2CQOA 1GO3E 4OWXB 4WJ3M 4PZ6A 1M1KC 2JA5H 2WFWA 3FP9A 2ZTCA 1GD7A 3CCEA 3JAMc 3TS0A 3PSIA 1SMXA 3PGZA 1N36L 1YBYA 1XPUA 5JJIA 1L1OC 1N9WA 5ELNA 4DUYL 4HIKA 1RL2A 4DR5Q 3ULPA 1NTGA 5IP7H 4GOPB 4JYAL 2UXBQ 1D7QA 1A0IA 4HIOA 2MO1A 3F2CA 4NXNQ 4R4TA 3GTPH 4DR4Q 1IBKQ 3KF8B 4IFDI 4HIMA 2PI2E 4EX5A 5IP9G 4QGUA 1P8LA 1VQIA 4DUZQ 3HOVH 1NY4A 1YITA 4LFBQ 5AJ3L 5C4JH 2EXDA 4XIGS 3S1MH 4A76A 1CKMA 4RG1A 4LWCA 2R7ZG 1OXTA 3DLLA 4A3BG 4ME3A 5HY6A 1Q8KA 1HH2P 3RZDH 4JBKA 1G51A 2C35B 4UP9A 4R4IA 1H95A 2VUMH 2NVTH 2JA7H 4A93G 3KYHC 1XNRL 4IJHA 3DM3A 4X66Q 4A3DG 2B29A 1RIPA 4GOPA 2VW9A 4LF9L 1XNQL 5C0XJ 2ASBA 4BBRG 1VQFA 4GLVB 4PZ8A 2EQSA 1L0WA 3PUXA 4DNIA 1NMGA 1KRTA 3CCMA 2UUAQ 1KQSA 1IBLL 5LMUL 3GTLH 4HJ9A 1TWCH 4JI4L 4QL5A 5M5WH 3K81C 3K7AH 3CCJA 1KAWA 1V1QA 4Y52H 2WB1G 4A3GH 4IPDA 1UE7A 4GNXC 5C3EH 3T1YL 3K80C 2ZTDA 3A74A 3GTJH 4DV2L 1Q82C 1N8RC 2GVAA 3FKIH 4JOIC 3G6EA 4PMWA 4YHHQ 2JQOA 4TQUS 5FLXc 5LMNW 1LM0A 1GVPA 4DR5L 4P75A 4IOAA 1QZGA 4NXNL 1IBKL 2BH2A 4L5TA 1S40A 2VS1A 3UDGA 2KENA 1KRSA 4JI2Q 2NVQH 1B70B 1GM5A 1X9NA 4HJ8A 2ES2A 5AJ3Q 2KHJA 1VQDA 3UDFA 1SROA 1TWAH 4QJFA 4DV1L 1VQ8A 3EN2A 4BY7G 3CPFA 5JEAJ 4DV5Q 1YJ9A 1CKOA 3CCSA 4MNOA 1XJVA 4BA2I 2Z6KC 3I4MH 2LXKA 3GO5A 3HOZH 1YHQA 1HNXQ 1YEZA 3OTOL 4A3EG 4DAMA 3U4ZA 5HGQA 4LF9Q 1WI5A 4JI5Q 1VQ4A 4OX9L 1U5KA 3U58A 4YCUA 3ULJA 1R9TH 2A19A 4JI8L 2YTXA 2ZJRA 4KI0A 4RMFA 5LMUQ 1I5FA 3D31A 2NVYH 2BH8A 1YI2A 4OXPA 4JI4Q 2PNHA 4QIWE 4DV0L 1G291 2ALYB 2HQLA 4A3LG 3J81c
chains in the Genus database with same CATH superfamily
2B2VA 3D4RA 1BXTA 1AFPA 3S1QH 4DXGA 1HZCA 4UPAA 2Q2TA 2B2YA 5IYDH 4LAAA 1SGPI 3I70A 1KTKA 4BXXH 4RGNA 4YHHL 5IT9L 1H9SA 3G4SA 3PIPA 4Z9CB 1TUSA 3R8BA 5DM63 4E1PA 1MIUA 3K5NA 5J1ZA 1LACA 4LFAL 1VQ5A 1QB5D 2W0TA 4YY3Q 2KCTA 3PIOA 1PH4A 3H3VI 1SDFA 1XPOA 2A69C 3HEJA 3IFDA 2Z6BA 5E3FA 4CBVA 1EIYB 2ZM6L 3LX0A 1E2VA 1CT0I 5LNK1 2UUBL 4A3MB 2QZGA 2JB1A 2KCMA 1HTLD 1Y1VB 1CFMA 1PH8A 1QVGA 3SGBI 3PUVA 2V1CC 2KMQA 3T1HL 3S17H 1EY4A 3J80c 4HMJA 2LEOA 3SXHA 2RQXA 2YUUA 5BR8L 1FNUA 3DWQA 3H6MA 4BBRB 3QTLD 3M4OH 3PO2H 1CKNB 2RHQB 3CXCA 4YWLA 1CHOI 2RF4A 4HJAA 4MTNA 4BA1I 4O1OA 5LL6S 4DR4L 2OEOA 3KBGA 3JAML 2FMMA 3PUYA 2NVYB 1MJCA 1A3TA 3R5AA 4GKJQ 1XX8A 3FHWA 1GKHA 2ZXRA 4LNQA 1YVCA 2JXDA 3AQQA 3I4NG 3PO3G 2OTJA 1O7IA 4DR2Q 2B8FA 1IBLQ 3N52A 1AZPA 1STEA 3QIAA 4DK3C 1PFNA 1Z7TA 2UZ3A 2R6GA 1WTXA 1D1KA 1V43A 1L1OA 1YNND 2AQ1B 2OT2A 3S9WA 3M7NA 2YTYA 1L0YB 1JJGA 5CC4A 4KD3A 1Y1WB 4JVZA 3MXNB 1TIID 5LMNL 3U4VA 1Y1VG 4HN7A 1Y1WH 1SNPA 2E2JB 2L15A 1A2UA 3RD4A 4L5RC 5C4XG 1NE3A 3H0GH 2HGKA 4PL3A 2ENBA 3DXJC 4JPBW 4ABNA 1E1TA 3RZDB 1TWCB 1IBML 3K7UC 1VQHA 4UXIA 2KMRA 2Q8IB 1NUBA 2E5LQ 1HNXL 2JA9A 1XXGA 2D5DA 2CH4A 3MHBA 1Z47A 1AH9A 5M5XB 1V9PA 2XGTA 2B2WA 3KUPA 5FO8B 1J9OA 1EEFD 2JJQA 3L3OC 3CC2A 2F1MA 2OCEA 3TP7A 2UXDQ 5A35A 1HJPA 1AE3A 3NK9A 1JT8A 1M8BA 1SYCA 2FFKB 1VQ6A 1MD2D 3W5OA 5ELEA 2BE5D 4PQXA 4OAUC 3PCOB 3M4YA 4C3HG 1A62A 1EFWA 1DCZA 1Z7KB 2KKMA 2CWAA 3VR6A 3C3LA 1WGCA 4QY7A 2BOSA 3KDFA 5JEAG 5LMNQ 3GD7A 4AS3A 4IZ8A 4LFAQ 1CZWA 2OTLA 2B8TA 2PQ8A 4BY1B 3CAMA 2RSOA 1NJIC 1LT5D 1PTOF 4DA2A 2NU0I 2RLDA 4OIJA 2X3TA 3C1FA 1CT2I 4KJOA 1KD1C 1JMCA 4LF4Q 3VYUA 3J7AF 3HOXB 2J9RA 4C1NK 1IXRA 1JJ2A 3RLFA 4JC0A 4AYBE 3ICEA 4TVAB 2N88A 3MZ5A 4A93H 1PFSA 1G2SA 1A6XA 3H09A 2XRCA 4X3TA 1VMPA 2XTIA 4BY7H 4RCOA 4QMGA 5IOCA 2Z9HA 1HFGA 2HUGA 1WGTA 2K01A 2N71A 1EY6A 3CQZB 1L1OB 1VCIA 2TMPA 4EVOA 1SNCA 5IP9H 3HOUH 2M5XA 1EY9A 1CSPA 3M4OB 2DJGC 5BR8Q 3HFZB 2PO4A 1X74A 2G9HD 1IYJB 4APVA 4C1NI 1CZGA 3UE0A 4B3TL 2ELIA 1OTCA 3HKZB 1SFOH 2JA8B 2FUG1 1XMQL 3WOEA 4MIUA 1TT2A 2F0FA 2VL6A 1P9ZA 1OMUA 2F3IA 4IJLA 2AUKA 2QDLA 5M3MH 3R93A 1SGRI 4QCLA 4EGVA 3SDZA 2F3CI 3I4MB 1N33L 3M9BA 3GTOH 2NU1I 2UUCL 4RA8A 3B55A 4UY8C 4G76A 1LTSD 2E76C 2D9UA 2UUAL 3NQIA 3URYA 2WB1E 5EX0A 4B3SL 1Q8IA 2KVMA 1YJNA 1WCMG 2JW6A 1PMRA 2E2HH 2IHEA 1SGDI 1YHAA 5CR3A 3RMHA 2LY7A 4FDBA 3HOWH 3S14B 2HHHQ 1GHKA 2K52A 4EQPA 5D3IB 1Q7YC 3SK8A 4OEMB 1EY7A 1D5XC 3L9AX 2HIXA 2B63H 4XT3B 4BS9A 1VQNA 1PTQA 3LJ2A 2F0QA 4L6TB 4IO9A 1RTOA 1OXXK 2E75C 1VQEA 1HR0W 5EBDA 2KEDA 4LF7L 2ETDA 1B9MA 5CV8A 1TGSI 5D3DA 5BN4A 4N8FA 1LT4D 1F2MA 4FXDA 4UXJA 2EXZA 4POGA 2VQFQ 3ND8A 5KIXA 4K14A 2XTQA 3FSYA 3PUZA 1UUCA 1CE3A 3PO2G 1IKLA 4PMCA 3CKIB 4ID6A 3KF8A 4OX9Q 4L5SA 3U50C 2K03A 3MXUA 3ERSX 5JOBA 1S3OA 3KFUA 4A3KH 5JPNC 2A68C 4G4KA 4DV0Q 3OXFA 1DZ1A 5LHY1 4DFAA 5KRUA 5C0XG 1JB7A 4GS3A 1Y69U 1D5ZC 1YTPA 4TRDA 4A3GB 1KDBA 1XPRA 2N1AB 1HTPA 4NW2A 3L2PA 2WAQE 4YWMA 3W2DA 4GKKQ 1DYQA 2AUJD 4LUVA 4LUZA 4JBMA 2K4KA 3CC7A 2LFNA 1WD1A 2O2LD 4A4IA 1HNZL 3D3RA 4YY3L 5JVH3 1HZ9A 1JORA 2J4XA 5M5XH 4XT1B 1M4VA 2RIJA 4WFN3 4JW0A 3FPUB 1VQMA 3Q8DA 1B3AA 4YCWA 1AN1I 1B9NA 1B1ZA 1PTOC 1VQJA 2P5ZX 2E5RA 5JVG3 2ORWA 1RKNA 4X66L 1EWIA 1YO7A 3TZDA 3VR4A 4AS2A 3RN2A 2UUBQ 1QVFA 1W3SA 4K2LA 2LMCB 4JI1L 2L0CA 4CJ1B 2CKZB 1OXUA 1HHVA 5DM73 1Y1VH 4C56C 1J6QA 1R0RI 5IP7G 5FKAC 1JWMD 4DK0A 1ML0D 3KY9A 3D6WA 5E4WC 3OMGA 4TKOB 2YQPA 1BBWA 3CU7A 2OQ0A 1QNUA 3K8AA 3J80L 1RTNA 2QQDA 4FXGC 3CCEA 3UGDA 2QPOA 3PSIA 1U4RA 3I73A 1SMXA 4A3EB 1XBTA 2VB2X 1L1OC 4DUYL 1KBFA 2HCCA 3ULPA 5CORA 5IP7H 4GOPB 3PO2B 4R4TA 4DR4Q 1IBKQ 2K9HA 4XQQA 3T53B 2PI2E 1JWSD 3S1MB 4QGUA 1P8LA 1QE6A 1Y1BA 5CV9A 3FBVA 5AJ3L 5C4JH 1CKMA 1WTRA 1JE4A 1KLUD 1LTTD 2RDFA 1Y8PB 1HH2P 4JBKA 2C35B 5AFWA 4A93G 1CGII 1XNRL 3OPOA 2O5JC 1X3QA 4A3DG 1V1OA 3CRLC 2BL7A 2WACA 1EFID 7WGAA 5C0XJ 1T5EA 4BBRG 4GLVB 1Z6HA 1KRTA 4XDXA 4IN3A 1SE3A 2F0MA 3LJ1A 1TWCH 4QL5A 3SK6A 2LS01 3K81C 2L12A 1KAWA 1V1QA 1N13A 4NMZA 4U673 1UE7A 2QILA 4GNXC 4CKBA 1HFNA 4DV2L 1Q82C 1WTHA 5E3QA 3PO3B 1HJAI 3BYYB 1S5DD 4PNYA 3FNBA 3NSWA 4I65A 5CV5A 3MTSA 2KOLA 2K32A 1MJBA 4L5TA 2A74C 1Z2IA 2DIPA 4ILWA 2ES2A 1VF5C 1VQDA 2CJSC 3UDFA 1SROA 4ZRZA 1CGJI 4QJFA 4DV1L 1TIHA 5JEAJ 2KA7A 1CKOA 4MNOA 2B2YC 2A73B 4KHVA 4RGTA 4EQNA 1TWGB 4A3IB 5IIFA 1ONLA 3RUZA 4A3EG 3TO6A 2F3WA 1BNZA 1GUTA 3ULJA 2A19A 2RC4A 3T56B 3D31A 2NVYH 2BH8A 4JI4Q 2PNHA 2ALYB 3S1QB 1II3A 1F2YA 3VA9A 3A56A 3F2DA 4DR6Q 2I46A 2Z1CA 1RD9D 2Z6KA 5M3MG 3N6RA 1QG7A 2QW7A 1G8ZD 1S5BD 3I4OA 4A93B 5NUCA 3GTGB 3QG1A 3UGLA 2I5MX 2EZVA 2F0KA 3FRPB 1N32Q 2NU4I 3Q24A 5T1IA 3D8GA 4RAUC 1O7ZA 1BUSA 2E8GA 1K8MA 2VQEQ 3EQLC 1UUPA 2JA1A 4QUCA 4X6AH 2QGQA 3UDXA 4C2MH 1GUWA 1I4RA 1T9HA 4O0AA 5GROA 3BJUA 1BCPD 3EFXD 1TWHH 5FO7B 1PVOA 1XTDA 3NBHA 4JI1Q 5K36G 1TWFB 1HNWL 3LWUA 3TOAA 4R4OA 1FD7D 5GADC 4A3JB 1PLFA 3S15B 2PI2A 2R7ZB 4JI3L 3GOXA 1CA5A 3KLWA 1CUKA 2GKVA 2RADA 4A3CH 4K6LA 1BMOA 2QSBA 1TBNA 4P2CB 2JXMB 4HAEA 4LMQD 5E7NA 3D4WA 5IWAL 1SE4A 1IY5A 2X6LA 1C48A 1K3RA 1A63A 5EKLA 2KQ3A 5IODA 1T5XD 4B3TQ 5IGEA 2F3VA 2L11A 5ELBA 1AEXA 1V1HA 5C0XH 3L7ZC 2DUDA 2SEBD 4KHZA 4G57A 1IBMQ 1STHA 5GAGC 2PZUA 1TBOA 3G6JB 4A3BH 1DS3I 2N52A 4H13C 1ASYA 3F1ZA 3C2PA 5IT9E 1HR0L 3JSBA 2SGDI 2F0GA 4IUNA 4DAPA 2BA1A 5I2YA 4NXML 1CI3M 3GTQB 2B63B 2C9OA 4C3IB 3TBIB 2EY6A 3SGIA 3VDYA 1KC8C 3GTQH 1FGBD 3HH2C 2EY5A 1ZYRC 5CBAE 1I4PA 3A55A 2EJMA 2JEAI 1PYWD 4GNXA 3J7ZC 5EKIA 4CGYB 1QZHA 1LO5D 2K5NA 4V0BA 4DPGA 3PMFA 4OWTB 1IW7C 3FVQA 1OXVA 1VQGA 4FO2A 3NPPA 2XN9C 3I90A 4DK6C 1ILQA 3VA7A 4WRDA 3VDPA 1YNNC 2CFMA 3TZUA 1Y8FA 4QIWB 5IGCA 1E0BA 1VDDA 2NU2I 2R3ZA 3QO2A 4FP5D 1YJWA 2ZRRA 4UDUC 1UNSA 3SEBA 3SDJA 4BBRH 2EDGA 1S5CD 1BQQT 1M8AA 2BE5C 3FPPA 4ZK9B 1X3PA 3AFQA 1WCMH 4K0KQ 1X54A 2ZTEA 3AYHB 2JA7B 3WOFA 3OMCA 2JA5G 4IPCA 2D2CC 4A3DB 2A8VA 2XMXA 1WTOA 3S1RH 3P7JA 4Q5VA 3A8IE 1O78A 1YNJC 4POFA 3TJQA 2MUYA 2JZMA 2IWHA 3PO3H 1CKNA 2GKTI 2M00A 3AMUA 3GDEA 4JI8Q 3GTKH 4LF8L 3S17B 2LUYA 1NBWA 3KLRA 2V4DA 5BN3A 1CQVA 2B2UA 3AEVA 2PQEA 1X3EA 1LTRD 2K50A 3FKIB 3HKSA 1SXTA 2OF1A 1BVSA 2WKDA 1PJUA 4HIDA 3PF5A 3S2HH 2O4XA 1E3PA 2OWOA 4KLKA 3L0IA 3BZKA 1FJGL 3OXGA 2WV6D 4OL7A 5COYA 2NTSA 2MHVA 2K14A 2ZJQA 1GJXA 1CSOI 1VQLA 3M4PA 4DAVA 2ID0A 4GNXB 1TS4A 4WP4A 2F0JA 5JEAH 2JE6I 2FINB 5BN5A 1NAPA 1N33Q 5FLMH 4NV2A 2L1LB 2HQEA 3JAMi 3J7AV 1SE8A 1LYLA 4B9WA 2IX1A 3H3VC 1FYCA 1EU3A 4UAIA 1WTVA 3BDCA 1PYBA 1UE5A 4LF8Q 3W1GA 1HEVA 1A15A 2F0IA 1QWYA 1Q1EA 4XTCS 4JI6L 1LTGD 1MSGA 2Q8RE 2SGEI 1KLGD 2RA4A 5DAUA 1KL9A 4JG2A 2CWPA 3DA4A 2LSSA 3FDTA 4LF7Q 4LFBL 1EOVA 2I5LX 2ARPF 2VY3A 3JAME 1SJHD 1PA6A 4G7ZC 3BVMA 2OD1A 3CHBD 2R7DA 4B08A 1VQOA 3FMCA 2XVSA 2KBNA 3W1BA 3HOXG 4MHEA 2YU9H 4AMLA 3U9OA 5KGUA 1NUCA 4GKJL 1H9MA 3TO9A 3KF6A 3HOYB 4FF3A 2F52A 4YCVA 3CC4A 5FLXE 3G7LA 4BY1H 5T1GA 3RZOH 1K0SA 1Q9BA 4G7HC 4RKBA 2D0OA 1RF2D 4Y7NB 1UEBA 1QUQB 2F0SA 3E5SA 1WJJA 2NVXH 4A24A 2FU2A 3R5DA 1SAPA 1SGQI 3ZJYC 1BR9A 2IX0A 1V1PA 1HPCA 4XYQA 3NQTA 2N49A 2RVLA 3X3NA 3UE1A 3E9IA 3HOUG 4A3JG 4DAYA 5C44H 5CMDA 4OWWB 1K28A 3NE5B 1FVIA 3J80E 1CK1A 4DV3L 3PDNA 4RGMA 2QF7A 4HCEA 4IPGA 1TS5A 1TR5A 3GTMB 3FSXA 1LTLA 3I2ZA 3CQZH 4DN4M 1EQTA 1F9RA 1U4LA 1XMQQ 2IX3A 2NVQB 3UFFA 5EKKA 3W3AA 1AE2A 1HRJA 1NCVA 4DV5L 2DJFC 4DR1L 1K7UA 1LR7A 2XNAC 5FUWA 5FO9B 4A3EH 1SEBD 1MKHA 5IT9c 2R61A 2PMZB 3MVVA 2X69A 2Y0MA 2P22B 2JBWA 4JI5L 4XYOA 4AQYL 1TQOA 4B3RL 2E2IH 2KUMA 2BL8A 3CCUA 2UU9Q 1B2TA 1C0AA 4N9PA 1X4SA 1LTBD 3TP6A 1YHBA 3V96A 5C4HA 3RN5A 1FL0A 2J0TD 2CHBD 1KNEA 4KMUC 1EOTA 2A5HA 1GXDC 1IY6A 1STBA 5FLMG 2UXDL 3P1HA 3GTPB 1S4ZA 4L8JA 3T16A 3R3OA 2EE1A 1ESFA 4DNRB 3DMUA 1KABA 5C44G 3TMEA 3S2DH 1XMOL 4FYDA 2JA8H 3MEKA 2MQHA 1LUZA 2VQEL 1TU2B 2WCYA 4JI0Q 4YZCA 2Y0SG 3EIVA 2F0DA 3MEHA 3T51B 1PPFI 3OIPA 1C8CA 1PZKD 2V53A 2OQKA 2A68D 5GAEC 2JA7G 1Y8OB 2QEXA 1IZ6A 1S5FD 3SGQI 3LGJA 1I6VC 1XNRQ 3A8KE 2DGYA 2OU2A 2KHSA 1K83H 1Q12A 3SE0A 4NKLA 2A6ED 4MZ9A 1K83B 4BXXG 4HSVA 2BA0A 1V1PB 1EQVA 5E3PA 2G5DA 3LNNA 1K8AC 4A3JH 3SEKC 1I50H 4R1JA 3PF4A 2EJFC 4AH6A 1E24A 3UITA 4OWXB 4PZ6A 2JA5H 2H1EA 2ZTCA 3TS0A 1SYEA 1N36L 3PGZA 3LWEA 1WTPA 4HIKA 4DR5Q 2F0NA 4JYAL 2DY8A 3BS1A 1SNDA 3QWPA 3KF8B 1BF4A 5E4XA 4FKDA 5IP9G 1VQIA 3HOVH 1NY4A 1YITA 4I7AA 4LFBQ 2FEFA 4XIGS 3VYRA 4A76A 3KP9A 4LWCA 2R7ZG 2CH4W 2NTTA 3RZDH 4KTAA 5EX3A 4UP9A 4R4IA 4I1TA 2NVTH 2JA7H 1NR4A 5EJWA 4IJHA 1K8OA 2IP6A 3NTKA 4CJ0B 1JICA 1HCZA 1XNQL 1G2TA 2ASBA 4RWSC 4ZCKA 4DNIA 3CCMA 3AB9A 4BBSB 2WVJA 1IBLL 2WB1B 5LMUL 1CT1D 1G6ZA 1GUGA 3K7AH 2KCCA 1SNOA 3Q0AA 4A3GH 2E2DC 4IPDA 1A2TA 2BCOA 3VR5A 4M1UB 2A69D 2ZTDA 3GTJH 3QAHA 2GVAA 2EOTA 3WDNA 4PMWA 5C4XB 2CWFA 1LM0A 1WCMB 1EIGA 4IOAA 2YU9B 5EPJA 1IKMA 4NXNL 2K1BA 4E1RA 1IBKL 2BH2A 1S40A 3S1RB 1KRSA 3NTIA 2NVQH 1B70B 4DXFA 4HJ8A 4C3IG 1R4PB 4RGOS 2VRWB 3NXWA 1VQ8A 3EN2A 4O1NA 1YJ9A 3IAS1 2MP1A 2Z6KC 4HMIA 2XSCA 3UOEA 1ICWA 1O7YA 2E2IB 4DAMA 3U4ZA 5HGQA 1WI5A 1VQ4A 3U58A 2G9DA 2WINB 3F2UA 3GV6A 4JI8L 2YTXA 4KI0A 4HEA1 5LMUQ 5CV7A 5ELDA 1YI2A 2ORVA 3VDUA 1K7VA 1Y1WG 1BBUA 5HQ8A 5C6AA 2L4NA 4DAYB 3M3YH 1VS0A 3K0YA 3BVZA 4PZ7A 2FJ2A 1A3VA 1Q90A 2E73A 3VR3A 1DJRD 2FNFX 1JWUD 2Q2HA 4N9TA 2B2UC 5C4JB 3NHHA 4BBSG 1SYFA 4XQNA 4JI0L 1GUNA 1EWCA 1F2LA 2H4OA 1I3QH 4U6RA 3SK4A 3IAYA 5IGFA 3S1NH 1ENFA 4QB4A 1D1IA 3FVVA 5TSSA 2RIOA 3S16H 2SGPI 3GTOB 1TWHB 2EIFA 4IUVA 1ULNA 1J8IA 2KJXA 5A2QE 1C7YA 1HUMA 1D2BA 2JP1A 4RHRA 5M5WB 3NENA 1KIXA 4A3FH 4BY1G 3CW2C 4X64L 4A3IH 2D0PA 4LF6Q 4KHPQ 3ULLA 4X62Q 4DR6L 1Q1BA 2LB7A 4K5XA 1Q86C 1ENCA 2PW7A 4B3ML 2JA8G 5K36H 1STNA 3F4MA 1HZAA 2K33A 4B9XA 2UVOA 2FXQA 1N36Q 1D6EC 3DWPA 1P16A 2GN5A 2IJ0A 1RFHA 1PH1A 3STBC 1SN8A 1IL8A 4DR7L 1I94Q 3UEYA 1SMYD 1SGEI 1R9TB 4JOIA 3RZOB 1EY0A 4ZKBB 4H44C 3FKIG 5C44B 4JK1C 3F8TA 4RH6A 4DKAC 5C3EG 2HIVA 1IYVA 5E3RA 4J15A 1W2BA 4YZ9A 1E1OA 1G6PA 2Y0SB 3HZXA 3E2IA 2E5LL 2EYHA 1RHPA 4OIKA 3H94A 2IY5B 2K5HA 5I6YA 3OWFA 2NUCA 4C3IH 5M3FB 1XNQQ 1QJOA 3K58A 5JHWC 1S72A 1X3GA 3CPWA 3BDLA 4OHJA 4BY7B 5L37A 4JI3Q 1E2ZA 1F9QA 1FNVA 4O42A 2XIWA 3K5LA 4ZLTF 4LF6L 3G71A 1M8CA 1WKXA 3I72A 2F4IA 4GLXA 1PH6A 9WGAA 2YFBA 3OIQA 2AWOA 3PUWA 4C3JG 2ZXPA 2IHFA 4IFDG 3T1YQ 2NZHA 3DEPA 3DWAA 3J7A5 3J80i 1STYA 2B0UC 2NZOA 2OZUA 3TP8A 4DR7Q 5IE8A 3ONAB 5I9OA 4DF7A 3UEJA 4FF1A 2PQAB 2PPBC 2R93B 4WJWA 1LT3D 2ZJPA 4G7OC 1CT4I 1HZBA 1RODA 1SYBA 3EBEA 4EQOA 4HJ7A 3UDIA 2WIIB 1TY2A 2PMZE 2L5TA 3MFGA 4S3SA 3EROA 2K7VA 1PCEA 1JE5A 5GQOA 1F9SA 1YNJD 1C9OA 1PRTC 2Z4HA 2NN6H 4LFCQ 1W6JA 5FJ8H 3HS0C 1WYDA 1TWFH 3O13A 2HDMA 2B63G 2A6EC 1CA6A 5DAEA 3HOZG 3E6ZX 2Z4IA 2QA4A 4JV5Q 4H7BA 1PHJA 2K75A 3UGIA 4ZQ3A 1BCPF 4JI6Q 3CCVA 5C3EB 4HR7B 3I3CA 3T4AC 4C3JH 5FUVA 1MGSA 3TRZA 4HCSA 4JBWA 2AQ3B 3ERQA 5FOBB 1PH2A 5JJLA 4X65Q 1X65A 2AHOB 1XMOQ 1A8VA 3R2TA 4A3FG 1Q81C 1U9RA 1B7YB 4Z7HA 5DEHA 2DNEA 3F2BA 5C3WA 3QOJA 1E2WA 5C0XI 3NBHB 3IFTA 4F88A 2CCZA 2GVIA 3NBIA 1SYDA 1TS3A 2NN6I 5CCMA 1TBQR 1LTID 2XRSD 4SGBI 4OVOA 3AJFA 1RJTA 4IPHA 1FNWA 4CJ2C 1GHJA 4NV5A 3GTMH 2UUCQ 4GZYC 4P73A 2ICEC 4LFCL 1TS2A 2M2LA 1VF7A 2NYZD 2VUMG 1IL2A 4P74A 4H02A 2GSCA 1YZ6A 2F0WA 4XQJA 3CMEA 1HNWQ 2R93G 4KK7A 1O7LA 3CD6A 2JB3A 3CRKC 4IQZA 2F0TA 1E7ZA 1K73C 3HOVB 1FAQA 1OO9B 1IYUA 1F9PA 3E0JA 1JCKB 1HQRD 3A5UA 4O2DA 4B3MQ 1ASZA 1K0RA 4AIMA 1KAAA 3HKZG 2GIVA 3J7YW 3OW2A 1PV4A 1ET6A 3FC3A 2ICIA 3RU0A 2N8NA 1VQAA 1I94L 4IOCA 1YIJA 1DONA 3I8ZA 5C4ZA 1KXLA 1LR9A 1EQRA 3DUZA 3H15A 2A1AA 2MJFB 1YNXA 1LR8A 1JQOA 1MSHA 4CDFC 2VUMB 2MPMA 5FK9C 1BCPC 5EAYA 3CCQA 3C46A 4L5QA 5CYUA 2N55A 4NB3A 1HR0Q 4BBSH 1VQ7A 2CAZB 1PZJD 3KK7A 2JAEA 1S5ED 2MNAA 4OO1I 1Y1CA 3OL0A 1B44D 2F0EA 1BOSA 4HJ5A 1OVOA 3I4NH 1QNKA 1BCPB 1WFQA 3GP7A 4A3LH 3E9HA 2JEBI 4X3KA 1ULKA 2VZAA 1D8LA 3I9V1 2J7ZA 2MFIA 3MA2B 1HUNA 2LKVA 3TDQA 4ZKCB 1B4OA 3OWEB 3RR5A 2PQAA 4RFBA 4FF2A 4YIJA 4IUTA 3VYTA 1FGUA 5IGDA 3TS2A 1WD0A 3HOXH 1DGSA 1IW7D 2I07B 1ILPA 1N34Q 1FR3A 2DKVA 1ESRA 1SNMA 2IW3A 4C3HB 1PH3A 1ZEQX 1MJEA 2Z0SA 3OW7A 3NTHA 5IYCH 5FUYA 1NMFA 1PZID 2RKSA 2NB0A 1E22A 5M3MB 4DV7L 3HGBA 3IAM1 1DOMA 2JA6G 3HOYH 2B8GA 4GLAC 1EYCA 2XWBB 1J5EQ 1SJED 3HOUB 3Q23A 4C3JB 3STBD 4Y7NH 1H9RA 3TP5A 3M3YB 3BG3A 4A3GG 2K6AA 5KYIA 2UXBL 1LV9A 1TOTA 4HFVA 4QQBX 4DU9A 3BDOA 4P71A 1BBXC 3C1EA 3E0EA 5IYBG 4DV4L 4R9WA 1SJ8A 2E74C 1H9SB 2L7XA 1OXSC 1FJGQ 1EIHA 2L8EA 4J1MA 2K19A 1X56A 4ULLA 1MJ9A 4DR1Q 1MHWC 5I4DA 1XTCD 1EUJA 5FJ8G 3GTJB 1I3QB 1Q3LA 1EL0A 3IRBA 1L2FA 1PTRA 2QQEA 4RKLA 4UP8A 1KMAA 2F0PA 2RHSB 2YV5A 1N34L 4LF4L 1B50A 2AKWB 2H5XA 4N8X1 3V2TA 4B3RQ 4HTHA 4A75A 2JA6B 1UE1A 3K5OA 4LUOA 3LJ0A 1NNXA 3EA6A 4X64Q 2F6MB 4CKCA 3MXPA 4X62L 5JJZA 3MWYW 3MEFA 2CQOA 1GO3E 4QUFA 1M1KC 2RCFA 2WFWA 2KEEA 5EGTA 1XPUA 3ZYYX 5JJIA 5ELNA 2WGCA 1D7QA 2UXBQ 1A0IA 4HIOA 4ZYSA 1KDCA 4XXEA 3J81E 3A8JE 3GTPH 4HIMA 2C5CA 4DUZQ 1I4GA 4CHTB 1RDPD 2EXDA 5DNFA 4A3BG 1PFMA 3TN2A 2HDLA 2L1BA 4ME3A 1TURA 2A6HC 3K5MA 2VUMH 3KYHC 4C2MB 3Q6SA 4F7XA 1ET9A 1TVXA 3K6OA 4LF9L 1OMTA 1UVFA 4PZ8A 2EQSA 2X6GA 4FNFA 3PUXA 1L0WA 2P6AC 2B2VC 1JOOA 1L0XB 3K7AB 1H9JA 2QGMA 4HJ9A 3CCJA 4Y52H 1STGA 3P23A 3HRZC 2FMCA 1WTJA 4DK1A 1EZ8A 5C3EH 1H9KA 1N8RC 3MC0B 2GA4B 3FKIH 4JOIC 4YHHQ 2JQOA 4TQUS 5FLXc 5LMNW 4DR5L 1R4QB 1QZGA 4KN7C 2KENA 2RBMA 4G75A 2V1CA 1X9NA 5I6WA 1EZ6A 5AJ3Q 2KHJA 3Q22A 4UXHA 3T13A 1HPTA 4BY7G 3CPFA 4DV5Q 2WKCA 5G3LF 3CCSA 5C5LA 2LXKA 3GO5A 1YHQA 1YEZA 4RHSA 3AU7A 3HP3A 3VYSA 4KKUA 4OX9L 1U5KA 1SYGA 4K8JA 1R9TH 4KY7A 2F0LA 4GXTA 5KNDA 1BO0A 1F2ZA 3E59A 4QIWE 4DV0L 4A3LG 2HQLA 4KY6A 1I6HB 1ULMA 1RCVD 4A3BB 1B8AA 5M3FG 4AYBG 5IWAQ 2SOBA 1PXUA 4DV2Q 2KCXA 4YWKA 2ROWA 3GV3A 2DNCA 2CQAA 1AZQA 2JYYA 4DV6L 3NWTA 2MGSA 2A20A 3D0FA 2EYOA 2EYJA 2CWHA 2Q2IA 4DV4Q 2PCFB 4KJNA 1O80A 3M4QA 2CW0D 1VQCA 3K57A 5K5PA 1VQKA 3QWNA 4DR3L 2F0OA 2QQ0A 1WOCA 3QB3A 1Y8NB 3BU2A 3KJPA 5JAVA 3KF6B 3I55A 2QEJC 1BUVT 4V190 1I4QA 3SVMA 2R93H 1SRUA 2OXPA 4K6DA 1PYSB 3IL8A 2F03A 4DR2L 4A3FB 1EQQA 2KHIA 2L9HA 4P72A 1TDPA 1PRTB 3CCLA 1MI2A 2ENNA 1XYIA 3I91A 4GN5A 4J6HA 3RNUA 1TWAB 5DLQE 2E2JH 2CVRA 2ATWA 1ZYRD 3HOZB 4JBJA 5IYCG 1CQFA 2UXCQ 1TWGH 4JYAQ 1SMYC 1N32L 1OYVI 1SGNI 4DNCA 1CHQD 4R4CA 2ENZA 4DGZA 2XWJB 1KHIA 4NP5A 3JC66 2JA6H 4UP7A 3HOYG 1STAA 4KY5A 4YZDA 4B6DA 3I4MG 3R2IA 3A54A 2K5WA 4K0KL 3I56A 5JPMC 4BWGB 2NWGA 2F4VQ 1SLJA 3J81j 2BUSA 1G91A 1FY7A 1BKBA 2Q2UA 3NEMA 4LF5L 4B3SQ 3U9SA 4IUUA 1P9GA 2SNMA 5IGBA 1QUQA 4ZUIA 2Y0SE 2QDBA 2F0VA 4JV5L 5HI7A 2MO0A 1IHZA 3BZCA 4A3IG 2HHHL 5M5YH 3BZDB 1NSNS 1X3FA 2JN4A 1HA6A 4Q9VA 5ELFA 5FLXL 3GTGH 1U4MA 1HA5A 2R7ZH 3S15H 1K3BC 3P75A 5EQ0A 4OELB 1JC7A 3H0GG 3OVOA 1MT1A 1XWEA 4GN4B 2I0QA 1SGYI 4MPIA 1MBYA 3CXLA 2JB2A 1K9MC 2DN8A 2R92H 3DEOA 2CWGA 1M90C 2QCPX 4GI3C 4A3MG 2WAQB 1BDOA 2Q8TA 4NDXA 3OOCA 1U4PA 2VQFL 2N3SA 4DV1Q 1ZXTA 4FVMA 3CF5A 5J3BA 3CCRA 3H91A 2XRQD 3TSSA 3K59A 4F87A 2ODDA 1NR2A 3QJYA 2F4VL 3I4MH 4UHVA 4GOPC 1TXYA 1TY0A 2WP8J 4ME5A 1PH7A 3OTOQ 4E6IA 1PRTD 4FF4A 2F0HA 5EBCA 4NXMQ 5M9OA 3M85A 1IW4A 3KDFB 3KLSA 3AFPA 1I6HH 3D6CA 4OO1H 3NWSA 1QCBD 5GAHC 2NU3I 2SGQI 3I7FA 3NP8A 3A0JA 2EY1A 4QF4A 2IT1A 4GKKL 1JR0D 1I4HA 2B2TC 3A7LA 5D65A 1X55A 1CM9A 1SNQA 3OXLA 2IL8A 3L0OA 1F77A 2K05A 4K2KA 1Y14B 3SHLA 4OAVB 4DV6Q 1V8QA 1Z9FA 4MN3A 2QQCA 2LXJA 1UEAB 3EVQA 2N78A 3CMAA 2MJ8A 3ITPA 3X3MA 3I4NB 1DD2A 5C5MA 4NPSA 1PDQA 4JCVE 4X3SA 5I9PA 1UWVA 1HQMC 3DHQA 4OGQC 4HSPA 4JI7L 3D4DA 3FEWX 3GQBA 1ICFB 2ZT9C 1VQ9A 4ALPA 2NVTB 5D14A 2JSOA 1C4QA 5IGGA 4F8MA 2L55A 3S14H 4FXKC 1EIFA 2ZM6Q 3V05A 2I5HA 1GOZA 5ISRA 1SBBB 4Q0FA 1X6OA 3MAQA 4IFDJ 5FUXA 1AP0A 5IYBH 1JJCB 1XA6A 2AWNA 2EY2A 3T1HQ 2KECA 4KHPL 3HKZE 3H0GB 2EYPA 1FARA 2FHTA 2A2CA 4DUYQ 2HT1A 4DV3Q 2M9VA 1UAPA 4A3CG 2D62A 4OONA 3NELA 2UXCL 1UE6A 1K8GA 3H3VH 2PZTA 3QOLA 5HGIA 1SFOB 1CHPD 1EYAA 4DWLA 1SR3A 4CDEC 4PG3A 2AQ2B 4CKEA 5IYDG 2B3GA 5H1SE 4L9MA 2UU9L 4WJ4A 1EYDA 3EJIA 4J8QA 4R8NA 1AN8A 4KKSA 3HOWG 2VB3X 1PTOB 4LF5Q 3TO7A 5CV6A 1X32A 1DM0B 3KBXA 1LABA 4CDCC 4DV7Q 3D00A 5J39A 1VMCA 4CDDC 2EYLA 3A5ZB 1Q46A 1VDZA 3PV0A 4EQ5A 1TBRR 2IPKD 3BYTB 3CP0A 1J5EL 2E2HB 3HOVG 2HD3A 4IUPA 2K5QA 2EYFA 3B6YA 5J8FA 1PRTF 2ZXOA 2JA5B 1WVLA 2PW5A 1EY8A 5F2DA 3B4VC 2RDHA 5ELOA 4RCNA 2YYZA 1QVCA 2B39A 2K28A 2RSNA 3ER0A 2CW0C 3MXNA 3PIP3 3DO9A 1PFBA 1B3QA 4JI2L 2F66B 1HNZQ 1I50B 2EPBA 4LK1C 5G3LD 5KEEA 5CGKA 3TREA 1QOHA 1S20A 5J8CA 1EY5A 2F0UA 4I7ZC 5A2QL 4ZAIA 1JQYD 4O1PA 3ND9A 2EVBA 1A3UA 2K5VA 2V6EA 3DM1A 2R7FA 1VQPA 1SE2A 2RDGA 3OYYA 5LL6X 5IY0A 3S1NB 3OHXC 2AMCB 2RCNA 4PL5A 4A3KG 3TQYA 3E3XA 1H0ZA 3NUCA 1W6KA 3G48A 3J81i 1DXMA 5C3XA 2K04A 5CBEE 5JJKA 3SK5A 2YFAA 2JK8A 2N17A 4K5VA 1LTAD 2GVBA 4KKTA 4M8AA 3KJOA 2NN6G 1U0LA 3R5CA 1FYBA 3VR2A 1JOKA 3BVGA 2SGFI 2R92B 4PL4A 4L63B 5HGTA 4LW1A 5HURA 2PZWA 2B2TA 2BDNA 2NVXB 1YU6C 4ZUJA 3QR8A 2NZ1D 1AW7A 5C4XH 4X65L 3UI2A 4X3UA 4R4QA 3TEHB 3S16B 2DY7A 3RLNA 1LT6D 4DUZL 3SR1A 4GN3B 1PH5A 4KN4C 5ELCA 1HDLA 1SSOA 4DR3Q 1EYGA 1UHAA 1CSQA 1KBEA 4IFDH 1QILA 1VQBA 4R8IA 1R79A 1KNAA 2VNUD 2GKRI 3HOWB 3KOJA 1GUSA 4A3DH 4JI7Q 2WAQG 4OO1G 1PTOD 3K0XA 4U68A 3P20A 4AQYQ 1MJAA 5M3FH 4A3MH 4IALA 2YTVA 3S24A 2OVOA 3WWVA 2R92G 1K7TA 2DB6A 2EJGC 3MXGA 3GTKB 3RLOA 1JB3A 4IURA 1PH9A 4C3HH 1GUOA 3TOBA 4WJ3M 1XX6A 3FP9A 1GD7A 3JAMc 3I4LA 1YBYA 1N9WA 1RL2A 1NTGA 4WORA 1WTWA 3S2HB 3KLSX 2MO1A 3F2CA 3BJIA 4NXNQ 4IFDI 4EX5A 2O5IC 4K5WA 4AYBB 3MFYA 4A3KB 3S1MH 4RG1A 1JOQA 1OXTA 3OSOA 3DLLA 1NXUA 2VXWA 1DOLA 1Q8KA 5HY6A 1G51A 4LJZC 3S2DB 1CTMA 1H95A 5I2XA 4H0LC 2A6HD 3DM3A 4X66Q 2PYKA 5M5YB 2B29A 1RIPA 4GOPA 2VW9A 1I4XA 1VQFA 4ODGA 1PTOH 3GTLB 1NMGA 4KD4A 2UUAQ 1EWHA 3DA3A 1KQSA 2ERWA 1EEID 3GTLH 4JI4L 4DNTB 5M5WH 2XTRA 2JYOA 2A2DA 2EYMA 1DS2I 1UVGA 2WB1G 5EPKA 3HG9A 1ZKOA 2J87A 3VA5A 1D5MC 4TSSA 2SNSA 2KMOA 1B53A 3T1YL 3K80C 3A74A 5J22A 3G6EA 4MTKA 2X52A 2ZW3A 3VE5A 5CCLA 3R5BA 1GVPA 3A7AB 4K8IA 1HXYD 4P75A 5E1FA 4HEDA 1ENAA 2VS1A 2K5DA 3UDGA 4JI2Q 1LLRD 1GM5A 2PNRC 2B2WC 2NBFA 3PIO3 1W4RA 1TWAH 5KNBA 5KYLA 2QKIC 5EPLA 3J81L 1KDAA 3IKJA 3M7GA 1XJVA 4BA2I 3HOZH 1HNXQ 5CV4A 2KMPA 4HGUA 1EU4A 2TSSA 3OTOL 1TKWB 1V1IA 4PMBA 4LF9Q 4JI5Q 4YCUA 4IUQA 1DOKA 1WTQA 2KCNA 2ZJRA 4RMFA 1I5FA 2HCIA 4PV1C 4OXPA 2Z8LA 1G291 2BDOA 5KNCA 2SDFA 4KV6A 3PQIA 3J81c 4Z7GA
chains in the Genus database with same CATH topology
3F2DA 4DR6Q 1Y1WG 1BBUA 1B8AA 3S1QH 5HQ8A 1HZCA 4UPAA 4AYBG 5M3FG 2Q2TA 5IYDH 4DAYB 2Z6KA 5M3MG 5IWAQ 3M3YH 1VS0A 1SGPI 3I4OA 4DV2Q 2KCXA 4BXXH 4PZ7A 3UGLA 4YWKA 4YHHL 2I5MX 2ROWA 2E73A 3G4SA 2JYYA 4DV6L 3PIPA 1N32Q 1TUSA 2A20A 2NU4I 2FNFX 4E1PA 3D0FA 1MIUA 2Q2HA 2Q2IA 4DV4Q 4LFAL 1VQ5A 1BUSA 2E8GA 3M4QA 4BBSG 1VQCA 2VQEQ 2W0TA 4YY3Q 4JI0L 1VQKA 2KCTA 3PIOA 1PH4A 4DR3L 3H3VI 1I3QH 2JA1A 4U6RA 2QQ0A 4X6AH 2QGQA 3UDXA 4C2MH 1WOCA 1XPOA 3S1NH 3BU2A 1T9HA 3KJPA 2SGPI 2RIOA 3S16H 3SGQI 3KF6B 4O0AA 2EIFA 5GROA 3I55A 1EIYB 3BJUA 2ZM6L 1CT0I 5LNK1 2UUBL 1TWHH 1PVOA 1XTDA 2R93H 2JB1A 1SRUA 2KCMA 1PYSB 4JI1Q 1C7YA 4DR2L 1HNWL 5K36G 1EQQA 2KHIA 1PH8A 4R4OA 1QVGA 3SGBI 5GADC 4P72A 2PI2A 3NENA 3PUVA 1KIXA 3CCLA 4A3FH 2V1CC 3CW2C 4BY1G 4JI3L 4X64L 3T1HL 2KMQA 4A3IH 2D0PA 4LF6Q 4KHPQ 3S17H 2ENNA 3GOXA 3KLWA 3J80c 4GN5A 1CUKA 2GKVA 3ULLA 4X62Q 2LEOA 4A3CH 4DR6L 3RNUA 1Q1BA 5DLQE 1BMOA 1Q86C 2YUUA 5BR8L 4B3ML 2JA8G 5E7NA 5IWAL 1TBNA 3F4MA 1HZAA 2E2JH 1IY5A 3QTLD 3M4OH 2ATWA 3PO2H 2FXQA 1CKNB 1P16A 1N36Q 2RHQB 1K3RA 2GN5A 4JBJA 5IYCG 4YWLA 3CXCA 1PH1A 2UXCQ 1A63A 1TWGH 3STBC 4B3TQ 4JYAQ 1CHOI 1SN8A 4DR7L 2RF4A 4HJAA 1I94Q 4MTNA 1N32L 1OYVI 1SGNI 4BA1I 4O1OA 4R4CA 3UEYA 4DR4L 2ENZA 1SGEI 1V1HA 1KHIA 4JOIA 3JC66 2JA6H 3L7ZC 4UP7A 3HOYG 3FKIG 2DUDA 4YZDA 4KHZA 3F8TA 4DKAC 3PUYA 5GAGC 1IBMQ 5C3EG 3I4MG 4B6DA 2HIVA 4K0KL 4J15A 1MJCA 3I56A 1W2BA 4YZ9A 1TBOA 4GKJQ 1E1OA 1G6PA 3E2IA 4A3BH 1DS3I 2N52A 1ASYA 2E5LL 3FHWA 2F4VQ 3F1ZA 1SLJA 3J81j 1GKHA 2BUSA 2IY5B 3MEKA 1BKBA 2K5HA 2Q2UA 4LNQA 1YVCA 1HR0L 3JSBA 3NEMA 4C3IH 4LF5L 2JXDA 3AQQA 2SGDI 4B3SQ 1XNQQ 2BA1A 4NXML 3I4NG 1S72A 5JHWC 3PO3G 2OTJA 1O7IA 4DR2Q 1X3GA 3CPWA 1QUQA 3VDYA 2Y0SE 3SGIA 1KC8C 3GTQH 4JV5L 1IBLQ 3HH2C 5HI7A 2MO0A 2HHHL 3BZCA 4A3IG 4JI3Q 2JEAI 5M5YH 4LF6L 1X3FA 4DK3C 3G71A 3J7ZC 4GNXA 1M8CA 4GLXA 4Q9VA 1PH6A 1QZHA 2K5NA 2YFBA 4DPGA 2R6GA 2UZ3A 3GTGH 2AWOA 3PUWA 4OWTB 1OXVA 1VQGA 1V43A 1L1OA 2IHFA 4DK6C 3T1YQ 3M7NA 2R7ZH 2NZHA 3S15H 4IFDG 1RFHA 2YTYA 3J7A5 3VDPA 3J80i 2CFMA 1JJGA 2B0UC 3H0GG 3OVOA 1Y8FA 1MT1A 2NZOA 4GN4B 2I0QA 4DR7Q 5IE8A 1SGYI 1VDDA 2NU2I 3MXNB 3CXLA 2JB2A 1K9MC 5LMNL 1YJWA 2PQAB 3UEJA 2ZRRA 1Y1VG 3U4VA 1Y1WH 2R92H 1M90C 2ZJPA 3SDJA 4BBRH 2L15A 4A3MG 1HZBA 4L5RC 5C4XG 1CT4I 4GI3C 1NE3A 3H0GH 4PL3A 2VQFL 2N3SA 3EBEA 1E1TA 4HJ7A 3AFQA 3UDIA 3K7UC 1WCMH 4DV1Q 1IBML 2PMZE 1VQHA 1X54A 2ZTEA 3AYHB 5J3BA 3CCRA 3CF5A 2JA5G 4K0KQ 4IPCA 1NUBA 2KMRA 2A8VA 2XMXA 1PCEA 1JE5A 2ODDA 5GQOA 2E5LQ 2F4VL 1HNXL 1C9OA 4GOPC 3S1RH 2JA9A 4LFCQ 1TXYA 2WP8J 5FJ8H 1PH7A 3OTOQ 1WYDA 3TJQA 4POFA 1TWFH 2JZMA 1Z47A 1AH9A 2B63G 1V9PA 2XGTA 3PO3H 4UXIA 4NXMQ 1CKNA 5DAEA 2GKTI 3M85A 2JJQA 3HOZG 3CC2A 1IW4A 3KDFB 3GDEA 2OCEA 4JI8Q 2QA4A 3GTKH 2UXDQ 3AFPA 4LF8L 4JV5Q 1I6HH 1HJPA 1AE3A 1PHJA 2LUYA 1NBWA 2K75A 5GAHC 1JT8A 1M8BA 2NU3I 1VQ6A 3UGIA 4JI6Q 2SGQI 3CCVA 3I7FA 3W5OA 3AEVA 3A0JA 1X3EA 4C3JH 4OAUC 2IT1A 2K50A 3HKSA 3PCOB 3TRZA 4GKKL 4JBWA 5FUVA 1BVSA 1PH2A 5JJLA 4X65Q 1A62A 1X65A 2AHOB 1PJUA 1XMOQ 1X55A 4HIDA 2KKMA 3PF5A 1EFWA 1A8VA 2CWAA 4A3FG 1Q81C 1E3PA 3L0OA 2OWOA 3OXLA 1B7YB 1Y14B 4OAVB 4Z7HA 3L0IA 4KLKA 4QY7A 4DV6Q 3BZKA 1Z9FA 1FJGL 3F2BA 2QQCA 2LXJA 3KDFA 3OXGA 5JEAG 5LMNQ 3GD7A 4AS3A 4LFAQ 2N78A 3NBHB 5C0XI 3CMAA 2OTLA 2B8TA 3CAMA 2CCZA 2K14A 1NJIC 2ZJQA 2GVIA 4NPSA 2NU0I 4JCVE 2NN6I 1VQLA 1UWVA 3M4PA 2ID0A 4GNXB 1CSOI 1TBQR 5CCMA 4JI7L 1CT2I 1KD1C 1JMCA 4ALPA 1VQ9A 4LF4Q 4SGBI 2JE6I 4OVOA 3AJFA 4IPHA 2J9RA 1N33Q 5FLMH 1IXRA 4NV5A 1JJ2A 3RLFA 2UUCQ 3GTMH 4P73A 4JC0A 4NV2A 3S14H 2L1LB 4AYBE 4LFCL 1EIFA 3ICEA 4TVAB 3JAMi 2ZM6Q 2I5HA 2VUMG 1PFSA 1SE8A 4A93H 1IL2A 1LYLA 1X6OA 4P74A 4IFDJ 4H02A 2IX1A 2XRCA 5FUXA 1YZ6A 2XTIA 5IYBH 4OO1G 3CMEA 4BY7H 1HNWQ 1JJCB 1PYBA 1UE5A 4LF8Q 2R93G 3W1GA 1XA6A 2AWNA 2N71A 3CD6A 3T1HQ 2JB3A 1L1OB 1VCIA 4KHPL 1E7ZA 4XTCS 1Q1EA 3HKZE 1K73C 4JI6L 5IP9H 1FARA 1FAQA 2A2CA 3HOUH 2M5XA 2SGEI 4DUYQ 2HT1A 1CSPA 3A5UA 4O2DA 5BR8Q 4B3MQ 1ASZA 3HFZB 1K0RA 4AIMA 4DV3Q 4A3CG 1X74A 1IYJB 3HKZG 2D62A 1KL9A 4JG2A 4OONA 4APVA 2CWPA 1R79A 3DA4A 2LSSA 3UE0A 3OW2A 3NELA 1PV4A 4LF7Q 1UE6A 2UXCL 1K8GA 4B3TL 3H3VH 2ELIA 1OTCA 4LFBL 3RU0A 2N8NA 1SFOH 1VQAA 2FUG1 1I94L 4IOCA 1EOVA 1YIJA 2I5LX 1XMQL 2VY3A 5HGIA 2ARPF 1PA6A 1KXLA 1LR9A 1EQRA 3H15A 2OD1A 2R7DA 2A1AA 2VL6A 1VQOA 2MJFB 4DWLA 1OMUA 1YNXA 2F3IA 1SR3A 2KBNA 4IJLA 3W1BA 5M3MH 1LR8A 1SGRI 3HOXG 2F3CI 4PG3A 1KBFA 5IYDG 2YU9H 4GKJL 1N33L 3M9BA 2B3GA 3GTOH 3KF6A 2NU1I 5H1SE 2UUCL 2F52A 4YCVA 5EAYA 2UU9L 4UY8C 4G76A 3CCQA 3CC4A 4BY1H 3RZOH 4WJ4A 4L9MA 3HOWG 4L5QA 2UUAL 4NB3A 1HR0Q 4LF5Q 2D0OA 2WB1E 5EX0A 4B3SL 2JW6A 1YJNA 1VQ7A 1WCMG 4BBSH 1UEBA 2CAZB 1QUQB 4DV7Q 1WJJA 2NVXH 3D00A 4A24A 1Z7KB 2E2HH 2JAEA 2IHEA 1SGDI 3A5ZB 1Q46A 1YHAA 3PV0A 3ZJYC 4EQ5A 1SGQI 2IX0A 2MNAA 4FDBA 4OO1I 3HOWH 3CP0A 1TBRR 2HHHQ 1J5EL 1Y1CA 3OL0A 4HJ5A 2N49A 3HOVG 2K52A 3UE1A 1OVOA 3B6YA 3I4NH 1Q7YC 3E9IA 3HOUG 4A3JG 5C44H 1WFQA 4OWWB 2HIXA 2B63H 4A3LH 3B4VC 3E9HA 1FVIA 2JEBI 1VQNA 5ELOA 3S2HH 1PTQA 3LJ2A 4DV3L 3PDNA 2VZAA 1D8LA 4IO9A 3I9V1 1QVCA 2YYZA 4IPGA 3ER0A 1OXXK 2MFIA 1LTLA 3I2ZA 3DO9A 1VQEA 3CQZH 1HR0W 4LF7L 4JI2L 2F66B 3RR5A 1HNZQ 1TGSI 2PQAA 3TREA 1XMQQ 3UFFA 1AE2A 4O1PA 1LR7A 4DR1L 4DV5L 4UXJA 1FGUA 2K5VA 4POGA 5FUWA 2V6EA 4A3EH 3TS2A 2VQFQ 2R7FA 1MKHA 1DGSA 3OYYA 5IT9c 3HOXH 1VQPA 5IY0A 2XTQA 3PUZA 1N34Q 2AMCB 2RCNA 4PL5A 4A3KG 3PO2G 1UUCA 1CE3A 3TQYA 2P22B 4JI5L 4OX9Q 1H0ZA 4AQYL 1PH3A 1MJEA 3U50C 4L5SA 2E2IH 4B3RL 2Z0SA 3CCUA 3G48A 3J81i 2UU9Q 5IYCH 5FUYA 1NMFA 5JJKA 1C0AA 2YFAA 3ERSX 1X4SA 2JK8A 2N17A 1S3OA 3KFUA 1E22A 4A3KH 1YHBA 3RN5A 1FL0A 2GVBA 4DV7L 4DV0Q 3OXFA 3IAM1 1IY6A 5C0XG 3KJOA 2JA6G 5FLMG 2UXDL 2NN6G 3HOYH 1U0LA 4GLAC 1JB7A 1FYBA 2SGFI 4GS3A 1J5EQ 1YTPA 4PL4A 1XPRA 4LW1A 3STBD 2N1AB 4Y7NH 3L2PA 2WAQE 4YWMA 4A3GG 1YU6C 4GKKQ 2UXBL 1TOTA 4HFVA 4QQBX 5C4XH 4X65L 5C44G 4LUVA 4P71A 3S2DH 1XMOL 4LUZA 3E0EA 4R4QA 3TEHB 5IYBG 2K4KA 4DV4L 1SJ8A 3CC7A 4JBMA 2MQHA 2JA8H 1LUZA 3RLNA 2L7XA 1OXSC 4DUZL 1HNZL 4A4IA 4GN3B 2VQEL 4YY3L 1PH5A 2WCYA 4JI0Q 4YZCA 2Y0SG 1HZ9A 3EIVA 5M5XH 1FJGQ 1PPFI 2L8EA 1HDLA 2K19A 4DR3Q 1X56A 1EYGA 2V53A 2OQKA 1CSQA 4DR1Q 5GAEC 1KBEA 1VQMA 5FJ8G 3Q8DA 1EUJA 1VQBA 4YCWA 2JA7G 2VNUD 2QEXA 3IRBA 1AN1I 1IZ6A 1L2FA 1VQJA 3LGJA 1PTRA 3KOJA 2E5RA 4A3DH 1XNRQ 2GKRI 4UP8A 2ORWA 4JI7Q 2RHSB 4X66L 2QQEA 1KMAA 1EWIA 1YO7A 2WAQG 2YV5A 1N34L 4AS2A 4LF4L 2AKWB 2DGYA 3K0XA 3RN2A 2UUBQ 1QVFA 1W3SA 2H5XA 1K83H 4AQYQ 4B3RQ 4JI1L 1Q12A 5M3FH 4A75A 4A3MH 2CKZB 4MZ9A 1OXUA 1UE1A 4BXXG 2YTVA 2BA0A 3S24A 2OVOA 1Y1VH 3WWVA 4LUOA 2R92G 3LJ0A 2DB6A 1J6QA 4X64Q 1R0RI 2F6MB 5IP7G 1K8AC 4A3JH 3RLOA 3KY9A 3SEKC 1I50H 4R1JA 4X62L 2YQPA 1BBWA 4C3HH 1PH9A 3PF4A 2OQ0A 3K8AA 4AH6A 3MEFA 1E24A 2CQOA 3UITA 1GO3E 4OWXB 4WJ3M 4PZ6A 1M1KC 2JA5H 2WFWA 1XX6A 3FP9A 2QQDA 2ZTCA 1GD7A 3CCEA 3JAMc 2QPOA 3UGDA 3TS0A 3PSIA 1XBTA 1SMXA 3PGZA 1N36L 1YBYA 1XPUA 5JJIA 1L1OC 1N9WA 5ELNA 4DUYL 4HIKA 1RL2A 4DR5Q 3ULPA 1NTGA 5IP7H 4GOPB 4JYAL 2UXBQ 1D7QA 1A0IA 4HIOA 2MO1A 3F2CA 3BJIA 3QWPA 4NXNQ 4R4TA 3GTPH 4DR4Q 1IBKQ 3KF8B 4IFDI 2K9HA 4HIMA 4FKDA 2PI2E 4EX5A 5IP9G 1Y1BA 4QGUA 1P8LA 1VQIA 4DUZQ 3HOVH 1NY4A 1YITA 4LFBQ 3FBVA 5AJ3L 5C4JH 2EXDA 4XIGS 3S1MH 4A76A 1CKMA 3KP9A 4LWCA 4RG1A 1OXTA 3DLLA 2R7ZG 4A3BG 4ME3A 5HY6A 1Q8KA 1TURA 1HH2P 3RZDH 4JBKA 1G51A 2C35B 5EX3A 4UP9A 4R4IA 4I1TA 2VUMH 2NVTH 2JA7H 4A93G 1H95A 1CGII 3FC3A 3KYHC 1XNRL 4IJHA 3DM3A 4X66Q 4A3DG 2IP6A 2B29A 1RIPA 4GOPA 2VW9A 4LF9L 1XNQL 5C0XJ 1OMTA 2ASBA 4BBRG 1VQFA 1UVFA 4GLVB 4PZ8A 2EQSA 1L0WA 3PUXA 2P6AC 4DNIA 1NMGA 1KRTA 3CCMA 2UUAQ 2WVJA 3DA3A 1KQSA 1IBLL 5LMUL 2ERWA 3GTLH 4HJ9A 3LJ1A 1TWCH 4JI4L 4QL5A 5M5WH 3K81C 3K7AH 3CCJA 2XTRA 1DS2I 2A2DA 1KAWA 1V1QA 4Y52H 1UVGA 2WB1G 1N13A 4A3GH 3P23A 2J87A 4IPDA 1UE7A 4GNXC 2KMOA 5C3EH 3T1YL 3K80C 2ZTDA 3A74A 3GTJH 4DV2L 1Q82C 1N8RC 2GVAA 3FKIH 4JOIC 1HJAI 3G6EA 5CCLA 4PMWA 4YHHQ 3VE5A 2JQOA 4TQUS 5FLXc 5LMNW 1LM0A 1GVPA 4DR5L 4P75A 4IOAA 1QZGA 4NXNL 4E1RA 1IBKL 2BH2A 4L5TA 1S40A 2VS1A 3UDGA 2KENA 2DIPA 1KRSA 4JI2Q 4G75A 2NVQH 1B70B 1GM5A 1X9NA 2V1CA 4HJ8A 2ES2A 5AJ3Q 2KHJA 1W4RA 1VQDA 2CJSC 3UDFA 1SROA 1TWAH 1CGJI 4QJFA 4DV1L 1TIHA 2VRWB 1VQ8A 4UXHA 3EN2A 1HPTA 4BY7G 3CPFA 5JEAJ 4DV5Q 1YJ9A 1CKOA 3CCSA 4MNOA 1XJVA 3IAS1 4BA2I 2Z6KC 3I4MH 2LXKA 3GO5A 3HOZH 1YHQA 1HNXQ 2KMPA 1YEZA 4HGUA 3OTOL 4A3EG 4DAMA 1V1IA 3U4ZA 5HGQA 4LF9Q 1WI5A 4JI5Q 1VQ4A 4OX9L 1U5KA 3U58A 4YCUA 3ULJA 1R9TH 2A19A 4JI8L 4GXTA 2YTXA 2ZJRA 4KI0A 4HEA1 4RMFA 5LMUQ 1I5FA 3D31A 3E59A 2NVYH 2BH8A 1YI2A 4OXPA 4JI4Q 2PNHA 2ORVA 3VDUA 4QIWE 4DV0L 1G291 2ALYB 2HQLA 4A3LG 3VA9A 3J81c 4Z7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2D A;  4DR6 Q;  1Y1W G;  1BBU A;  1B8A A;  3S1Q H;  1HZC A;  4UPA A;  4AYB G;  5M3F G;  2Q2T A;  5IYD H;  4DAY B;  2Z6K A;  5M3M G;  5IWA Q;  3M3Y H;  1VS0 A;  3I4O A;  4DV2 Q;  4BXX H;  4PZ7 A;  4YWK A;  4YHH L;  2I5M X;  3G4S A;  4DV6 L;  3PIP A;  1N32 Q;  3D0F A;  1MIU A;  2Q2H A;  2Q2I A;  4DV4 Q;  4LFA L;  1VQ5 A;  2E8G A;  3M4Q A;  4BBS G;  1VQC A;  2VQE Q;  4YY3 Q;  4JI0 L;  1VQK A;  2KCT A;  3PIO A;  1PH4 A;  4DR3 L;  3H3V I;  1I3Q H;  4X6A H;  2QGQ A;  3UDX A;  4C2M H;  1WOC A;  1XPO A;  3S1N H;  3BU2 A;  1T9H A;  3KJP A;  3S16 H;  3KF6 B;  4O0A A;  2EIF A;  5GRO A;  3I55 A;  1EIY B;  3BJU A;  2ZM6 L;  2UUB L;  1TWH H;  1PVO A;  1XTD A;  2R93 H;  1SRU A;  2KCM A;  1PYS B;  4JI1 Q;  1C7Y A;  4DR2 L;  1HNW L;  5K36 G;  1EQQ A;  2KHI A;  1PH8 A;  4R4O A;  1QVG A;  5GAD C;  4P72 A;  2PI2 A;  3NEN A;  3PUV A;  1KIX A;  3CCL A;  4A3F H;  2V1C C;  3CW2 C;  4BY1 G;  4JI3 L;  4X64 L;  3T1H L;  4A3I H;  2D0P A;  4LF6 Q;  4KHP Q;  3S17 H;  3KLW A;  3J80 c;  4GN5 A;  1CUK A;  3ULL A;  4X62 Q;  4A3C H;  4DR6 L;  3RNU A;  1Q1B A;  5DLQ E;  1Q86 C;  5BR8 L;  4B3M L;  2JA8 G;  5E7N A;  5IWA L;  2E2J H;  1HZA A;  3M4O H;  2ATW A;  3PO2 H;  2FXQ A;  1CKN B;  1P16 A;  1N36 Q;  2RHQ B;  1K3R A;  2GN5 A;  4JBJ A;  5IYC G;  4YWL A;  3CXC A;  1PH1 A;  2UXC Q;  1A63 A;  1TWG H;  3STB C;  4B3T Q;  4JYA Q;  1SN8 A;  4DR7 L;  2RF4 A;  4HJA A;  1I94 Q;  4MTN A;  1N32 L;  4BA1 I;  4R4C A;  4DR4 L;  1KHI A;  4JOI A;  3JC6 6;  2JA6 H;  3L7Z C;  4UP7 A;  3HOY G;  3FKI G;  2DUD A;  4KHZ A;  3F8T A;  4DKA C;  3PUY A;  5GAG C;  1IBM Q;  5C3E G;  3I4M G;  2HIV A;  4K0K L;  4J15 A;  1MJC A;  3I56 A;  1W2B A;  4GKJ Q;  1E1O A;  1G6P A;  4A3B H;  1ASY A;  2E5L L;  3FHW A;  2F4V Q;  3F1Z A;  1SLJ A;  3J81 j;  1GKH A;  2IY5 B;  1BKB A;  2K5H A;  2Q2U A;  4LNQ A;  1YVC A;  1HR0 L;  3NEM A;  4C3I H;  4LF5 L;  3AQQ A;  4B3S Q;  1XNQ Q;  2BA1 A;  4NXM L;  3I4N G;  1S72 A;  3PO3 G;  2OTJ A;  1O7I A;  4DR2 Q;  1X3G A;  3CPW A;  1QUQ A;  3VDY A;  2Y0S E;  3SGI A;  1KC8 C;  3GTQ H;  4JV5 L;  1IBL Q;  2MO0 A;  2HHH L;  3BZC A;  4A3I G;  4JI3 Q;  2JEA I;  5M5Y H;  4LF6 L;  1X3F A;  4DK3 C;  3G71 A;  3J7Z C;  4GNX A;  4GLX A;  1PH6 A;  1QZH A;  2K5N A;  4DPG A;  2R6G A;  3GTG H;  2AWO A;  3PUW A;  4OWT B;  1OXV A;  1VQG A;  1V43 A;  1L1O A;  2IHF A;  4DK6 C;  3T1Y Q;  3M7N A;  2R7Z H;  2NZH A;  3S15 H;  4IFD G;  2YTY A;  3J7A 5;  3J80 i;  2CFM A;  1JJG A;  3H0G G;  2NZO A;  4GN4 B;  2I0Q A;  4DR7 Q;  5IE8 A;  3MXN B;  1K9M C;  5LMN L;  1YJW A;  2PQA B;  3U4V A;  1Y1V G;  2R92 H;  1Y1W H;  1M90 C;  2ZJP A;  4BBR H;  2L15 A;  4A3M G;  1HZB A;  4L5R C;  5C4X G;  1NE3 A;  3H0G H;  2VQF L;  2N3S A;  3EBE A;  1E1T A;  4HJ7 A;  3AFQ A;  3UDI A;  3K7U C;  1WCM H;  4DV1 Q;  1IBM L;  2PMZ E;  1VQH A;  1X54 A;  2ZTE A;  3AYH B;  5J3B A;  3CCR A;  3CF5 A;  2JA5 G;  4K0K Q;  4IPC A;  2A8V A;  1JE5 A;  5GQO A;  2E5L Q;  2F4V L;  1HNX L;  1C9O A;  4GOP C;  3S1R H;  2JA9 A;  4LFC Q;  1TXY A;  2WP8 J;  5FJ8 H;  1PH7 A;  3OTO Q;  1WYD A;  4POF A;  1TWF H;  1Z47 A;  1AH9 A;  2B63 G;  1V9P A;  2XGT A;  3PO3 H;  4NXM Q;  1CKN A;  3M85 A;  2JJQ A;  3HOZ G;  3CC2 A;  3KDF B;  3GDE A;  2OCE A;  4JI8 Q;  2QA4 A;  3GTK H;  2UXD Q;  3AFP A;  4LF8 L;  4JV5 Q;  1I6H H;  1HJP A;  1AE3 A;  1PHJ A;  1NBW A;  2K75 A;  5GAH C;  1JT8 A;  1VQ6 A;  4JI6 Q;  3CCV A;  3I7F A;  3W5O A;  3AEV A;  3A0J A;  1X3E A;  4C3J H;  2IT1 A;  2K50 A;  3HKS A;  4GKK L;  3PCO B;  3TRZ A;  4JBW A;  1BVS A;  1PH2 A;  5JJL A;  4X65 Q;  1A62 A;  1X65 A;  2AHO B;  1XMO Q;  1X55 A;  4HID A;  3PF5 A;  1EFW A;  3S2H H;  1A8V A;  2CWA A;  4A3F G;  1Q81 C;  1E3P A;  3L0O A;  2OWO A;  1B7Y B;  1Y14 B;  4KLK A;  4QY7 A;  4DV6 Q;  3BZK A;  1Z9F A;  1FJG L;  3F2B A;  2LXJ A;  3KDF A;  5JEA G;  5LMN Q;  3GD7 A;  4LFA Q;  2N78 A;  3NBH B;  5C0X I;  3CMA A;  2OTL A;  3CAM A;  2CCZ A;  2K14 A;  1NJI C;  2ZJQ A;  4NPS A;  4JCV E;  2NN6 I;  1VQL A;  1UWV A;  3M4P A;  2ID0 A;  4GNX B;  4JI7 L;  1KD1 C;  1JMC A;  4ALP A;  1VQ9 A;  4LF4 Q;  2JE6 I;  4IPH A;  1N33 Q;  5FLM H;  1IXR A;  1JJ2 A;  3RLF A;  2UUC Q;  3GTM H;  4P73 A;  4JC0 A;  3S14 H;  4AYB E;  4LFC L;  1EIF A;  3ICE A;  4TVA B;  3JAM i;  2ZM6 Q;  2I5H A;  2VUM G;  1PFS A;  1SE8 A;  4A93 H;  1IL2 A;  1LYL A;  1X6O A;  4P74 A;  4IFD J;  4H02 A;  2IX1 A;  1YZ6 A;  2XTI A;  5IYB H;  3CME A;  4BY7 H;  1HNW Q;  1JJC B;  1PYB A;  1UE5 A;  4LF8 Q;  2R93 G;  3W1G A;  2AWN A;  3CD6 A;  3T1H Q;  1L1O B;  1VCI A;  4KHP L;  1E7Z A;  4XTC S;  1Q1E A;  3HKZ E;  1K73 C;  4JI6 L;  5IP9 H;  3HOU H;  4DUY Q;  2HT1 A;  1CSP A;  3A5U A;  4O2D A;  5BR8 Q;  4B3M Q;  1ASZ A;  3HFZ B;  1K0R A;  4AIM A;  4DV3 Q;  4A3C G;  1IYJ B;  3HKZ G;  2D62 A;  1KL9 A;  4JG2 A;  4OON A;  4APV A;  2CWP A;  3UE0 A;  2LSS A;  3OW2 A;  3NEL A;  1PV4 A;  4LF7 Q;  1UE6 A;  2UXC L;  1K8G A;  4B3T L;  3H3V H;  1OTC A;  4LFB L;  2N8N A;  1SFO H;  1VQA A;  1I94 L;  4IOC A;  1EOV A;  1YIJ A;  2I5L X;  1XMQ L;  2VY3 A;  1PA6 A;  1KXL A;  1EQR A;  3H15 A;  2R7D A;  2A1A A;  2VL6 A;  1VQO A;  1YNX A;  2F3I A;  1SR3 A;  2KBN A;  4IJL A;  3W1B A;  5M3M H;  3HOX G;  4PG3 A;  5IYD G;  2YU9 H;  4GKJ L;  1N33 L;  3M9B A;  2B3G A;  3GTO H;  3KF6 A;  5H1S E;  2UUC L;  2F52 A;  4YCV A;  5EAY A;  2UU9 L;  4UY8 C;  3CC4 A;  3CCQ A;  4BY1 H;  4WJ4 A;  3RZO H;  3HOW G;  4L5Q A;  2UUA L;  4NB3 A;  1HR0 Q;  4LF5 Q;  2D0O A;  2WB1 E;  4B3S L;  1YJN A;  1VQ7 A;  1WCM G;  4BBS H;  1UEB A;  1QUQ B;  4DV7 Q;  2NVX H;  1WJJ A;  2E2H H;  2IHE A;  3A5Z B;  1Q46 A;  1YHA A;  3PV0 A;  3ZJY C;  4EQ5 A;  2IX0 A;  2MNA A;  4FDB A;  4OO1 I;  3HOW H;  3CP0 A;  2HHH Q;  1J5E L;  4HJ5 A;  2N49 A;  3HOV G;  2K52 A;  3UE1 A;  3B6Y A;  3I4N H;  1Q7Y C;  3E9I A;  3HOU G;  4A3J G;  5C44 H;  1WFQ A;  4OWW B;  2HIX A;  2B63 H;  4A3L H;  3E9H A;  1FVI A;  2JEB I;  1VQN A;  5ELO A;  4DV3 L;  2VZA A;  1D8L A;  4IO9 A;  1QVC A;  2YYZ A;  4IPG A;  3ER0 A;  1OXX K;  2MFI A;  1LTL A;  3I2Z A;  1VQE A;  3CQZ H;  1HR0 W;  4LF7 L;  4JI2 L;  3RR5 A;  1HNZ Q;  2PQA A;  3TRE A;  1XMQ Q;  1AE2 A;  4DR1 L;  4DV5 L;  1FGU A;  2K5V A;  4POG A;  4A3E H;  3TS2 A;  2VQF Q;  2R7F A;  1MKH A;  1DGS A;  3OYY A;  5IT9 c;  3HOX H;  1VQP A;  5IY0 A;  3PUZ A;  1N34 Q;  2AMC B;  2RCN A;  4A3K G;  3PO2 G;  3TQY A;  4JI5 L;  4OX9 Q;  4AQY L;  1PH3 A;  1MJE A;  3U50 C;  4L5S A;  2E2I H;  4B3R L;  2Z0S A;  3CCU A;  3G48 A;  3J81 i;  2UU9 Q;  5IYC H;  1NMF A;  5JJK A;  1C0A A;  3ERS X;  2JK8 A;  1S3O A;  3KFU A;  1E22 A;  4A3K H;  1YHB A;  3RN5 A;  1FL0 A;  2GVB A;  4DV7 L;  4DV0 Q;  5C0X G;  3KJO A;  2JA6 G;  5FLM G;  2UXD L;  2NN6 G;  3HOY H;  1U0L A;  4GLA C;  1JB7 A;  4GS3 A;  1J5E Q;  1XPR A;  4LW1 A;  3STB D;  4Y7N H;  3L2P A;  2WAQ E;  4YWM A;  4A3G G;  4GKK Q;  2UXB L;  4QQB X;  5C4X H;  4X65 L;  5C44 G;  4LUV A;  4P71 A;  3S2D H;  1XMO L;  4LUZ A;  3E0E A;  4R4Q A;  3TEH B;  5IYB G;  2K4K A;  4DV4 L;  3CC7 A;  4JBM A;  2JA8 H;  2MQH A;  1LUZ A;  3RLN A;  1OXS C;  4DUZ L;  1HNZ L;  4A4I A;  4GN3 B;  2VQE L;  4YY3 L;  1PH5 A;  4JI0 Q;  1FJG Q;  2Y0S G;  1HZ9 A;  3EIV A;  5M5X H;  4DR3 Q;  1X56 A;  1EYG A;  2OQK A;  1CSQ A;  4DR1 Q;  5GAE C;  1VQM A;  5FJ8 G;  3Q8D A;  1EUJ A;  1VQB A;  4YCW A;  2JA7 G;  2VNU D;  2QEX A;  3IRB A;  1IZ6 A;  1L2F A;  1VQJ A;  3LGJ A;  3KOJ A;  4A3D H;  1XNR Q;  4UP8 A;  4JI7 Q;  2RHS B;  4X66 L;  1EWI A;  2YV5 A;  2WAQ G;  1N34 L;  4LF4 L;  4OO1 G;  2AKW B;  2DGY A;  3K0X A;  3RN2 A;  2UUB Q;  1QVF A;  1W3S A;  2H5X A;  1K83 H;  4AQY Q;  4B3R Q;  4JI1 L;  1Q12 A;  5M3F H;  4A75 A;  4A3M H;  2CKZ B;  4MZ9 A;  1OXU A;  1UE1 A;  4BXX G;  2YTV A;  2BA0 A;  3S24 A;  1Y1V H;  3WWV A;  4LUO A;  2R92 G;  1J6Q A;  4X64 Q;  5IP7 G;  1K8A C;  4A3J H;  3RLO A;  1I50 H;  4R1J A;  4X62 L;  1BBW A;  4C3H H;  1PH9 A;  3PF4 A;  2OQ0 A;  3K8A A;  4AH6 A;  3MEF A;  1E24 A;  2CQO A;  1GO3 E;  4OWX B;  4WJ3 M;  4PZ6 A;  1M1K C;  2JA5 H;  2WFW A;  3FP9 A;  2ZTC A;  1GD7 A;  3CCE A;  3JAM c;  3TS0 A;  3PSI A;  1SMX A;  3PGZ A;  1N36 L;  1YBY A;  1XPU A;  5JJI A;  1L1O C;  1N9W A;  5ELN A;  4DUY L;  4HIK A;  1RL2 A;  4DR5 Q;  3ULP A;  1NTG A;  5IP7 H;  4GOP B;  4JYA L;  2UXB Q;  1D7Q A;  1A0I A;  4HIO A;  2MO1 A;  3F2C A;  4NXN Q;  4R4T A;  3GTP H;  4DR4 Q;  1IBK Q;  3KF8 B;  4IFD I;  4HIM A;  2PI2 E;  4EX5 A;  5IP9 G;  4QGU A;  1P8L A;  1VQI A;  4DUZ Q;  3HOV H;  1NY4 A;  1YIT A;  4LFB Q;  5AJ3 L;  5C4J H;  2EXD A;  4XIG S;  3S1M H;  4A76 A;  1CKM A;  4RG1 A;  4LWC A;  2R7Z G;  1OXT A;  3DLL A;  4A3B G;  4ME3 A;  5HY6 A;  1Q8K A;  1HH2 P;  3RZD H;  4JBK A;  1G51 A;  2C35 B;  4UP9 A;  4R4I A;  1H95 A;  2VUM H;  2NVT H;  2JA7 H;  4A93 G;  3KYH C;  1XNR L;  4IJH A;  3DM3 A;  4X66 Q;  4A3D G;  2B29 A;  1RIP A;  4GOP A;  2VW9 A;  4LF9 L;  1XNQ L;  5C0X J;  2ASB A;  4BBR G;  1VQF A;  4GLV B;  4PZ8 A;  2EQS A;  1L0W A;  3PUX A;  4DNI A;  1NMG A;  1KRT A;  3CCM A;  2UUA Q;  1KQS A;  1IBL L;  5LMU L;  3GTL H;  4HJ9 A;  1TWC H;  4JI4 L;  4QL5 A;  5M5W H;  3K81 C;  3K7A H;  3CCJ A;  1KAW A;  1V1Q A;  4Y52 H;  2WB1 G;  4A3G H;  4IPD A;  1UE7 A;  4GNX C;  5C3E H;  3T1Y L;  3K80 C;  2ZTD A;  3A74 A;  3GTJ H;  4DV2 L;  1Q82 C;  1N8R C;  2GVA A;  3FKI H;  4JOI C;  3G6E A;  4PMW A;  4YHH Q;  2JQO A;  4TQU S;  5FLX c;  5LMN W;  1LM0 A;  1GVP A;  4DR5 L;  4P75 A;  4IOA A;  1QZG A;  4NXN L;  1IBK L;  2BH2 A;  4L5T A;  1S40 A;  2VS1 A;  3UDG A;  2KEN A;  1KRS A;  4JI2 Q;  2NVQ H;  1B70 B;  1GM5 A;  1X9N A;  4HJ8 A;  2ES2 A;  5AJ3 Q;  2KHJ A;  1VQD A;  3UDF A;  1SRO A;  1TWA H;  4QJF A;  4DV1 L;  1VQ8 A;  3EN2 A;  4BY7 G;  3CPF A;  5JEA J;  4DV5 Q;  1YJ9 A;  1CKO A;  3CCS A;  4MNO A;  1XJV A;  4BA2 I;  2Z6K C;  3I4M H;  2LXK A;  3GO5 A;  3HOZ H;  1YHQ A;  1HNX Q;  1YEZ A;  3OTO L;  4A3E G;  4DAM A;  3U4Z A;  5HGQ A;  4LF9 Q;  1WI5 A;  4JI5 Q;  1VQ4 A;  4OX9 L;  1U5K A;  3U58 A;  4YCU A;  3ULJ A;  1R9T H;  2A19 A;  4JI8 L;  2YTX A;  2ZJR A;  4KI0 A;  4RMF A;  5LMU Q;  1I5F A;  3D31 A;  2NVY H;  2BH8 A;  1YI2 A;  4OXP A;  4JI4 Q;  2PNH A;  4QIW E;  4DV0 L;  1G29 1;  2ALY B;  2HQL A;  4A3L G;  3J81 c; 
#chains in the Genus database with same CATH topology
 2B2V A;  3D4R A;  1BXT A;  1AFP A;  3S1Q H;  4DXG A;  1HZC A;  4UPA A;  2Q2T A;  2B2Y A;  5IYD H;  4LAA A;  1SGP I;  3I70 A;  1KTK A;  4BXX H;  4RGN A;  4YHH L;  5IT9 L;  1H9S A;  3G4S A;  3PIP A;  4Z9C B;  1TUS A;  3R8B A;  5DM6 3;  4E1P A;  1MIU A;  3K5N A;  5J1Z A;  1LAC A;  4LFA L;  1VQ5 A;  1QB5 D;  2W0T A;  4YY3 Q;  2KCT A;  3PIO A;  1PH4 A;  3H3V I;  1SDF A;  1XPO A;  2A69 C;  3HEJ A;  3IFD A;  2Z6B A;  5E3F A;  4CBV A;  1EIY B;  2ZM6 L;  3LX0 A;  1E2V A;  1CT0 I;  5LNK 1;  2UUB L;  4A3M B;  2QZG A;  2JB1 A;  2KCM A;  1HTL D;  1Y1V B;  1CFM A;  1PH8 A;  1QVG A;  3SGB I;  3PUV A;  2V1C C;  2KMQ A;  3T1H L;  3S17 H;  1EY4 A;  3J80 c;  4HMJ A;  2LEO A;  3SXH A;  2RQX A;  2YUU A;  5BR8 L;  1FNU A;  3DWQ A;  3H6M A;  4BBR B;  3QTL D;  3M4O H;  3PO2 H;  1CKN B;  2RHQ B;  3CXC A;  4YWL A;  1CHO I;  2RF4 A;  4HJA A;  4MTN A;  4BA1 I;  4O1O A;  5LL6 S;  4DR4 L;  2OEO A;  3KBG A;  3JAM L;  2FMM A;  3PUY A;  2NVY B;  1MJC A;  1A3T A;  3R5A A;  4GKJ Q;  1XX8 A;  3FHW A;  1GKH A;  2ZXR A;  4LNQ A;  1YVC A;  2JXD A;  3AQQ A;  3I4N G;  3PO3 G;  2OTJ A;  1O7I A;  4DR2 Q;  2B8F A;  1IBL Q;  3N52 A;  1AZP A;  1STE A;  3QIA A;  4DK3 C;  1PFN A;  1Z7T A;  2UZ3 A;  2R6G A;  1WTX A;  1D1K A;  1V43 A;  1L1O A;  1YNN D;  2AQ1 B;  2OT2 A;  3S9W A;  3M7N A;  2YTY A;  1L0Y B;  1JJG A;  5CC4 A;  4KD3 A;  1Y1W B;  4JVZ A;  3MXN B;  1TII D;  5LMN L;  3U4V A;  1Y1V G;  4HN7 A;  1Y1W H;  1SNP A;  2E2J B;  2L15 A;  1A2U A;  3RD4 A;  4L5R C;  5C4X G;  1NE3 A;  3H0G H;  2HGK A;  4PL3 A;  2ENB A;  3DXJ C;  4JPB W;  4ABN A;  1E1T A;  3RZD B;  1TWC B;  1IBM L;  3K7U C;  1VQH A;  4UXI A;  2KMR A;  2Q8I B;  1NUB A;  2E5L Q;  1HNX L;  2JA9 A;  1XXG A;  2D5D A;  2CH4 A;  3MHB A;  1Z47 A;  1AH9 A;  5M5X B;  1V9P A;  2XGT A;  2B2W A;  3KUP A;  5FO8 B;  1J9O A;  1EEF D;  2JJQ A;  3L3O C;  3CC2 A;  2F1M A;  2OCE A;  3TP7 A;  2UXD Q;  5A35 A;  1HJP A;  1AE3 A;  3NK9 A;  1JT8 A;  1M8B A;  1SYC A;  2FFK B;  1VQ6 A;  1MD2 D;  3W5O A;  5ELE A;  2BE5 D;  4PQX A;  4OAU C;  3PCO B;  3M4Y A;  4C3H G;  1A62 A;  1EFW A;  1DCZ A;  1Z7K B;  2KKM A;  2CWA A;  3VR6 A;  3C3L A;  1WGC A;  4QY7 A;  2BOS A;  3KDF A;  5JEA G;  5LMN Q;  3GD7 A;  4AS3 A;  4IZ8 A;  4LFA Q;  1CZW A;  2OTL A;  2B8T A;  2PQ8 A;  4BY1 B;  3CAM A;  2RSO A;  1NJI C;  1LT5 D;  1PTO F;  4DA2 A;  2NU0 I;  2RLD A;  4OIJ A;  2X3T A;  3C1F A;  1CT2 I;  4KJO A;  1KD1 C;  1JMC A;  4LF4 Q;  3VYU A;  3J7A F;  3HOX B;  2J9R A;  4C1N K;  1IXR A;  1JJ2 A;  3RLF A;  4JC0 A;  4AYB E;  3ICE A;  4TVA B;  2N88 A;  3MZ5 A;  4A93 H;  1PFS A;  1G2S A;  1A6X A;  3H09 A;  2XRC A;  4X3T A;  1VMP A;  2XTI A;  4BY7 H;  4RCO A;  4QMG A;  5IOC A;  2Z9H A;  1HFG A;  2HUG A;  1WGT A;  2K01 A;  2N71 A;  1EY6 A;  3CQZ B;  1L1O B;  1VCI A;  2TMP A;  4EVO A;  1SNC A;  5IP9 H;  3HOU H;  2M5X A;  1EY9 A;  1CSP A;  3M4O B;  2DJG C;  5BR8 Q;  3HFZ B;  2PO4 A;  1X74 A;  2G9H D;  1IYJ B;  4APV A;  4C1N I;  1CZG A;  3UE0 A;  4B3T L;  2ELI A;  1OTC A;  3HKZ B;  1SFO H;  2JA8 B;  2FUG 1;  1XMQ L;  3WOE A;  4MIU A;  1TT2 A;  2F0F A;  2VL6 A;  1P9Z A;  1OMU A;  2F3I A;  4IJL A;  2AUK A;  2QDL A;  5M3M H;  3R93 A;  1SGR I;  4QCL A;  4EGV A;  3SDZ A;  2F3C I;  3I4M B;  1N33 L;  3M9B A;  3GTO H;  2NU1 I;  2UUC L;  4RA8 A;  3B55 A;  4UY8 C;  4G76 A;  1LTS D;  2E76 C;  2D9U A;  2UUA L;  3NQI A;  3URY A;  2WB1 E;  5EX0 A;  4B3S L;  1Q8I A;  2KVM A;  1YJN A;  1WCM G;  2JW6 A;  1PMR A;  2E2H H;  2IHE A;  1SGD I;  1YHA A;  5CR3 A;  3RMH A;  2LY7 A;  4FDB A;  3HOW H;  3S14 B;  2HHH Q;  1GHK A;  2K52 A;  4EQP A;  5D3I B;  1Q7Y C;  3SK8 A;  4OEM B;  1EY7 A;  1D5X C;  3L9A X;  2HIX A;  2B63 H;  4XT3 B;  4BS9 A;  1VQN A;  1PTQ A;  3LJ2 A;  2F0Q A;  4L6T B;  4IO9 A;  1RTO A;  1OXX K;  2E75 C;  1VQE A;  1HR0 W;  5EBD A;  2KED A;  4LF7 L;  2ETD A;  1B9M A;  5CV8 A;  1TGS I;  5D3D A;  5BN4 A;  4N8F A;  1LT4 D;  1F2M A;  4FXD A;  4UXJ A;  2EXZ A;  4POG A;  2VQF Q;  3ND8 A;  5KIX A;  4K14 A;  2XTQ A;  3FSY A;  3PUZ A;  1UUC A;  1CE3 A;  3PO2 G;  1IKL A;  4PMC A;  3CKI B;  4ID6 A;  3KF8 A;  4OX9 Q;  4L5S A;  3U50 C;  2K03 A;  3MXU A;  3ERS X;  5JOB A;  1S3O A;  3KFU A;  4A3K H;  5JPN C;  2A68 C;  4G4K A;  4DV0 Q;  3OXF A;  1DZ1 A;  5LHY 1;  4DFA A;  5KRU A;  5C0X G;  1JB7 A;  4GS3 A;  1Y69 U;  1D5Z C;  1YTP A;  4TRD A;  4A3G B;  1KDB A;  1XPR A;  2N1A B;  1HTP A;  4NW2 A;  3L2P A;  2WAQ E;  4YWM A;  3W2D A;  4GKK Q;  1DYQ A;  2AUJ D;  4LUV A;  4LUZ A;  4JBM A;  2K4K A;  3CC7 A;  2LFN A;  1WD1 A;  2O2L D;  4A4I A;  1HNZ L;  3D3R A;  4YY3 L;  5JVH 3;  1HZ9 A;  1JOR A;  2J4X A;  5M5X H;  4XT1 B;  1M4V A;  2RIJ A;  4WFN 3;  4JW0 A;  3FPU B;  1VQM A;  3Q8D A;  1B3A A;  4YCW A;  1AN1 I;  1B9N A;  1B1Z A;  1PTO C;  1VQJ A;  2P5Z X;  2E5R A;  5JVG 3;  2ORW A;  1RKN A;  4X66 L;  1EWI A;  1YO7 A;  3TZD A;  3VR4 A;  4AS2 A;  3RN2 A;  2UUB Q;  1QVF A;  1W3S A;  4K2L A;  2LMC B;  4JI1 L;  2L0C A;  4CJ1 B;  2CKZ B;  1OXU A;  1HHV A;  5DM7 3;  1Y1V H;  4C56 C;  1J6Q A;  1R0R I;  5IP7 G;  5FKA C;  1JWM D;  4DK0 A;  1ML0 D;  3KY9 A;  3D6W A;  5E4W C;  3OMG A;  4TKO B;  2YQP A;  1BBW A;  3CU7 A;  2OQ0 A;  1QNU A;  3K8A A;  3J80 L;  1RTN A;  2QQD A;  4FXG C;  3CCE A;  3UGD A;  2QPO A;  3PSI A;  1U4R A;  3I73 A;  1SMX A;  4A3E B;  1XBT A;  2VB2 X;  1L1O C;  4DUY L;  1KBF A;  2HCC A;  3ULP A;  5COR A;  5IP7 H;  4GOP B;  3PO2 B;  4R4T A;  4DR4 Q;  1IBK Q;  2K9H A;  4XQQ A;  3T53 B;  2PI2 E;  1JWS D;  3S1M B;  4QGU A;  1P8L A;  1QE6 A;  1Y1B A;  5CV9 A;  3FBV A;  5AJ3 L;  5C4J H;  1CKM A;  1WTR A;  1JE4 A;  1KLU D;  1LTT D;  2RDF A;  1Y8P B;  1HH2 P;  4JBK A;  2C35 B;  5AFW A;  4A93 G;  1CGI I;  1XNR L;  3OPO A;  2O5J C;  1X3Q A;  4A3D G;  1V1O A;  3CRL C;  2BL7 A;  2WAC A;  1EFI D;  7WGA A;  5C0X J;  1T5E A;  4BBR G;  4GLV B;  1Z6H A;  1KRT A;  4XDX A;  4IN3 A;  1SE3 A;  2F0M A;  3LJ1 A;  1TWC H;  4QL5 A;  3SK6 A;  2LS0 1;  3K81 C;  2L12 A;  1KAW A;  1V1Q A;  1N13 A;  4NMZ A;  4U67 3;  1UE7 A;  2QIL A;  4GNX C;  4CKB A;  1HFN A;  4DV2 L;  1Q82 C;  1WTH A;  5E3Q A;  3PO3 B;  1HJA I;  3BYY B;  1S5D D;  4PNY A;  3FNB A;  3NSW A;  4I65 A;  5CV5 A;  3MTS A;  2KOL A;  2K32 A;  1MJB A;  4L5T A;  2A74 C;  1Z2I A;  2DIP A;  4ILW A;  2ES2 A;  1VF5 C;  1VQD A;  2CJS C;  3UDF A;  1SRO A;  4ZRZ A;  1CGJ I;  4QJF A;  4DV1 L;  1TIH A;  5JEA J;  2KA7 A;  1CKO A;  4MNO A;  2B2Y C;  2A73 B;  4KHV A;  4RGT A;  4EQN A;  1TWG B;  4A3I B;  5IIF A;  1ONL A;  3RUZ A;  4A3E G;  3TO6 A;  2F3W A;  1BNZ A;  1GUT A;  3ULJ A;  2A19 A;  2RC4 A;  3T56 B;  3D31 A;  2NVY H;  2BH8 A;  4JI4 Q;  2PNH A;  2ALY B;  3S1Q B;  1II3 A;  1F2Y A;  3VA9 A;  3A56 A;  3F2D A;  4DR6 Q;  2I46 A;  2Z1C A;  1RD9 D;  2Z6K A;  5M3M G;  3N6R A;  1QG7 A;  2QW7 A;  1G8Z D;  1S5B D;  3I4O A;  4A93 B;  5NUC A;  3GTG B;  3QG1 A;  3UGL A;  2I5M X;  2EZV A;  2F0K A;  3FRP B;  1N32 Q;  2NU4 I;  3Q24 A;  5T1I A;  3D8G A;  4RAU C;  1O7Z A;  1BUS A;  2E8G A;  1K8M A;  2VQE Q;  3EQL C;  1UUP A;  2JA1 A;  4QUC A;  4X6A H;  2QGQ A;  3UDX A;  4C2M H;  1GUW A;  1I4R A;  1T9H A;  4O0A A;  5GRO A;  3BJU A;  1BCP D;  3EFX D;  1TWH H;  5FO7 B;  1PVO A;  1XTD A;  3NBH A;  4JI1 Q;  5K36 G;  1TWF B;  1HNW L;  3LWU A;  3TOA A;  4R4O A;  1FD7 D;  5GAD C;  4A3J B;  1PLF A;  3S15 B;  2PI2 A;  2R7Z B;  4JI3 L;  3GOX A;  1CA5 A;  3KLW A;  1CUK A;  2GKV A;  2RAD A;  4A3C H;  4K6L A;  1BMO A;  2QSB A;  1TBN A;  4P2C B;  2JXM B;  4HAE A;  4LMQ D;  5E7N A;  3D4W A;  5IWA L;  1SE4 A;  1IY5 A;  2X6L A;  1C48 A;  1K3R A;  1A63 A;  5EKL A;  2KQ3 A;  5IOD A;  1T5X D;  4B3T Q;  5IGE A;  2F3V A;  2L11 A;  5ELB A;  1AEX A;  1V1H A;  5C0X H;  3L7Z C;  2DUD A;  2SEB D;  4KHZ A;  4G57 A;  1IBM Q;  1STH A;  5GAG C;  2PZU A;  1TBO A;  3G6J B;  4A3B H;  1DS3 I;  2N52 A;  4H13 C;  1ASY A;  3F1Z A;  3C2P A;  5IT9 E;  1HR0 L;  3JSB A;  2SGD I;  2F0G A;  4IUN A;  4DAP A;  2BA1 A;  5I2Y A;  4NXM L;  1CI3 M;  3GTQ B;  2B63 B;  2C9O A;  4C3I B;  3TBI B;  2EY6 A;  3SGI A;  3VDY A;  1KC8 C;  3GTQ H;  1FGB D;  3HH2 C;  2EY5 A;  1ZYR C;  5CBA E;  1I4P A;  3A55 A;  2EJM A;  2JEA I;  1PYW D;  4GNX A;  3J7Z C;  5EKI A;  4CGY B;  1QZH A;  1LO5 D;  2K5N A;  4V0B A;  4DPG A;  3PMF A;  4OWT B;  1IW7 C;  3FVQ A;  1OXV A;  1VQG A;  4FO2 A;  3NPP A;  2XN9 C;  3I90 A;  4DK6 C;  1ILQ A;  3VA7 A;  4WRD A;  3VDP A;  1YNN C;  2CFM A;  3TZU A;  1Y8F A;  4QIW B;  5IGC A;  1E0B A;  1VDD A;  2NU2 I;  2R3Z A;  3QO2 A;  4FP5 D;  1YJW A;  2ZRR A;  4UDU C;  1UNS A;  3SEB A;  3SDJ A;  4BBR H;  2EDG A;  1S5C D;  1BQQ T;  1M8A A;  2BE5 C;  3FPP A;  4ZK9 B;  1X3P A;  3AFQ A;  1WCM H;  4K0K Q;  1X54 A;  2ZTE A;  3AYH B;  2JA7 B;  3WOF A;  3OMC A;  2JA5 G;  4IPC A;  2D2C C;  4A3D B;  2A8V A;  2XMX A;  1WTO A;  3S1R H;  3P7J A;  4Q5V A;  3A8I E;  1O78 A;  1YNJ C;  4POF A;  3TJQ A;  2MUY A;  2JZM A;  2IWH A;  3PO3 H;  1CKN A;  2GKT I;  2M00 A;  3AMU A;  3GDE A;  4JI8 Q;  3GTK H;  4LF8 L;  3S17 B;  2LUY A;  1NBW A;  3KLR A;  2V4D A;  5BN3 A;  1CQV A;  2B2U A;  3AEV A;  2PQE A;  1X3E A;  1LTR D;  2K50 A;  3FKI B;  3HKS A;  1SXT A;  2OF1 A;  1BVS A;  2WKD A;  1PJU A;  4HID A;  3PF5 A;  3S2H H;  2O4X A;  1E3P A;  2OWO A;  4KLK A;  3L0I A;  3BZK A;  1FJG L;  3OXG A;  2WV6 D;  4OL7 A;  5COY A;  2NTS A;  2MHV A;  2K14 A;  2ZJQ A;  1GJX A;  1CSO I;  1VQL A;  3M4P A;  4DAV A;  2ID0 A;  4GNX B;  1TS4 A;  4WP4 A;  2F0J A;  5JEA H;  2JE6 I;  2FIN B;  5BN5 A;  1NAP A;  1N33 Q;  5FLM H;  4NV2 A;  2L1L B;  2HQE A;  3JAM i;  3J7A V;  1SE8 A;  1LYL A;  4B9W A;  2IX1 A;  3H3V C;  1FYC A;  1EU3 A;  4UAI A;  1WTV A;  3BDC A;  1PYB A;  1UE5 A;  4LF8 Q;  3W1G A;  1HEV A;  1A15 A;  2F0I A;  1QWY A;  1Q1E A;  4XTC S;  4JI6 L;  1LTG D;  1MSG A;  2Q8R E;  2SGE I;  1KLG D;  2RA4 A;  5DAU A;  1KL9 A;  4JG2 A;  2CWP A;  3DA4 A;  2LSS A;  3FDT A;  4LF7 Q;  4LFB L;  1EOV A;  2I5L X;  2ARP F;  2VY3 A;  3JAM E;  1SJH D;  1PA6 A;  4G7Z C;  3BVM A;  2OD1 A;  3CHB D;  2R7D A;  4B08 A;  1VQO A;  3FMC A;  2XVS A;  2KBN A;  3W1B A;  3HOX G;  4MHE A;  2YU9 H;  4AML A;  3U9O A;  5KGU A;  1NUC A;  4GKJ L;  1H9M A;  3TO9 A;  3KF6 A;  3HOY B;  4FF3 A;  2F52 A;  4YCV A;  3CC4 A;  5FLX E;  3G7L A;  4BY1 H;  5T1G A;  3RZO H;  1K0S A;  1Q9B A;  4G7H C;  4RKB A;  2D0O A;  1RF2 D;  4Y7N B;  1UEB A;  1QUQ B;  2F0S A;  3E5S A;  1WJJ A;  2NVX H;  4A24 A;  2FU2 A;  3R5D A;  1SAP A;  1SGQ I;  3ZJY C;  1BR9 A;  2IX0 A;  1V1P A;  1HPC A;  4XYQ A;  3NQT A;  2N49 A;  2RVL A;  3X3N A;  3UE1 A;  3E9I A;  3HOU G;  4A3J G;  4DAY A;  5C44 H;  5CMD A;  4OWW B;  1K28 A;  3NE5 B;  1FVI A;  3J80 E;  1CK1 A;  4DV3 L;  3PDN A;  4RGM A;  2QF7 A;  4HCE A;  4IPG A;  1TS5 A;  1TR5 A;  3GTM B;  3FSX A;  1LTL A;  3I2Z A;  3CQZ H;  4DN4 M;  1EQT A;  1F9R A;  1U4L A;  1XMQ Q;  2IX3 A;  2NVQ B;  3UFF A;  5EKK A;  3W3A A;  1AE2 A;  1HRJ A;  1NCV A;  4DV5 L;  2DJF C;  4DR1 L;  1K7U A;  1LR7 A;  2XNA C;  5FUW A;  5FO9 B;  4A3E H;  1SEB D;  1MKH A;  5IT9 c;  2R61 A;  2PMZ B;  3MVV A;  2X69 A;  2Y0M A;  2P22 B;  2JBW A;  4JI5 L;  4XYO A;  4AQY L;  1TQO A;  4B3R L;  2E2I H;  2KUM A;  2BL8 A;  3CCU A;  2UU9 Q;  1B2T A;  1C0A A;  4N9P A;  1X4S A;  1LTB D;  3TP6 A;  1YHB A;  3V96 A;  5C4H A;  3RN5 A;  1FL0 A;  2J0T D;  2CHB D;  1KNE A;  4KMU C;  1EOT A;  2A5H A;  1GXD C;  1IY6 A;  1STB A;  5FLM G;  2UXD L;  3P1H A;  3GTP B;  1S4Z A;  4L8J A;  3T16 A;  3R3O A;  2EE1 A;  1ESF A;  4DNR B;  3DMU A;  1KAB A;  5C44 G;  3TME A;  3S2D H;  1XMO L;  4FYD A;  2JA8 H;  3MEK A;  2MQH A;  1LUZ A;  2VQE L;  1TU2 B;  2WCY A;  4JI0 Q;  4YZC A;  2Y0S G;  3EIV A;  2F0D A;  3MEH A;  3T51 B;  1PPF I;  3OIP A;  1C8C A;  1PZK D;  2V53 A;  2OQK A;  2A68 D;  5GAE C;  2JA7 G;  1Y8O B;  2QEX A;  1IZ6 A;  1S5F D;  3SGQ I;  3LGJ A;  1I6V C;  1XNR Q;  3A8K E;  2DGY A;  2OU2 A;  2KHS A;  1K83 H;  1Q12 A;  3SE0 A;  4NKL A;  2A6E D;  4MZ9 A;  1K83 B;  4BXX G;  4HSV A;  2BA0 A;  1V1P B;  1EQV A;  5E3P A;  2G5D A;  3LNN A;  1K8A C;  4A3J H;  3SEK C;  1I50 H;  4R1J A;  3PF4 A;  2EJF C;  4AH6 A;  1E24 A;  3UIT A;  4OWX B;  4PZ6 A;  2JA5 H;  2H1E A;  2ZTC A;  3TS0 A;  1SYE A;  1N36 L;  3PGZ A;  3LWE A;  1WTP A;  4HIK A;  4DR5 Q;  2F0N A;  4JYA L;  2DY8 A;  3BS1 A;  1SND A;  3QWP A;  3KF8 B;  1BF4 A;  5E4X A;  4FKD A;  5IP9 G;  1VQI A;  3HOV H;  1NY4 A;  1YIT A;  4I7A A;  4LFB Q;  2FEF A;  4XIG S;  3VYR A;  4A76 A;  3KP9 A;  4LWC A;  2R7Z G;  2CH4 W;  2NTT A;  3RZD H;  4KTA A;  5EX3 A;  4UP9 A;  4R4I A;  4I1T A;  2NVT H;  2JA7 H;  1NR4 A;  5EJW A;  4IJH A;  1K8O A;  2IP6 A;  3NTK A;  4CJ0 B;  1JIC A;  1HCZ A;  1XNQ L;  1G2T A;  2ASB A;  4RWS C;  4ZCK A;  4DNI A;  3CCM A;  3AB9 A;  4BBS B;  2WVJ A;  1IBL L;  2WB1 B;  5LMU L;  1CT1 D;  1G6Z A;  1GUG A;  3K7A H;  2KCC A;  1SNO A;  3Q0A A;  4A3G H;  2E2D C;  4IPD A;  1A2T A;  2BCO A;  3VR5 A;  4M1U B;  2A69 D;  2ZTD A;  3GTJ H;  3QAH A;  2GVA A;  2EOT A;  3WDN A;  4PMW A;  5C4X B;  2CWF A;  1LM0 A;  1WCM B;  1EIG A;  4IOA A;  2YU9 B;  5EPJ A;  1IKM A;  4NXN L;  2K1B A;  4E1R A;  1IBK L;  2BH2 A;  1S40 A;  3S1R B;  1KRS A;  3NTI A;  2NVQ H;  1B70 B;  4DXF A;  4HJ8 A;  4C3I G;  1R4P B;  4RGO S;  2VRW B;  3NXW A;  1VQ8 A;  3EN2 A;  4O1N A;  1YJ9 A;  3IAS 1;  2MP1 A;  2Z6K C;  4HMI A;  2XSC A;  3UOE A;  1ICW A;  1O7Y A;  2E2I B;  4DAM A;  3U4Z A;  5HGQ A;  1WI5 A;  1VQ4 A;  3U58 A;  2G9D A;  2WIN B;  3F2U A;  3GV6 A;  4JI8 L;  2YTX A;  4KI0 A;  4HEA 1;  5LMU Q;  5CV7 A;  5ELD A;  1YI2 A;  2ORV A;  3VDU A;  1K7V A;  1Y1W G;  1BBU A;  5HQ8 A;  5C6A A;  2L4N A;  4DAY B;  3M3Y H;  1VS0 A;  3K0Y A;  3BVZ A;  4PZ7 A;  2FJ2 A;  1A3V A;  1Q90 A;  2E73 A;  3VR3 A;  1DJR D;  2FNF X;  1JWU D;  2Q2H A;  4N9T A;  2B2U C;  5C4J B;  3NHH A;  4BBS G;  1SYF A;  4XQN A;  4JI0 L;  1GUN A;  1EWC A;  1F2L A;  2H4O A;  1I3Q H;  4U6R A;  3SK4 A;  3IAY A;  5IGF A;  3S1N H;  1ENF A;  4QB4 A;  1D1I A;  3FVV A;  5TSS A;  2RIO A;  3S16 H;  2SGP I;  3GTO B;  1TWH B;  2EIF A;  4IUV A;  1ULN A;  1J8I A;  2KJX A;  5A2Q E;  1C7Y A;  1HUM A;  1D2B A;  2JP1 A;  4RHR A;  5M5W B;  3NEN A;  1KIX A;  4A3F H;  4BY1 G;  3CW2 C;  4X64 L;  4A3I H;  2D0P A;  4LF6 Q;  4KHP Q;  3ULL A;  4X62 Q;  4DR6 L;  1Q1B A;  2LB7 A;  4K5X A;  1Q86 C;  1ENC A;  2PW7 A;  4B3M L;  2JA8 G;  5K36 H;  1STN A;  3F4M A;  1HZA A;  2K33 A;  4B9X A;  2UVO A;  2FXQ A;  1N36 Q;  1D6E C;  3DWP A;  1P16 A;  2GN5 A;  2IJ0 A;  1RFH A;  1PH1 A;  3STB C;  1SN8 A;  1IL8 A;  4DR7 L;  1I94 Q;  3UEY A;  1SMY D;  1SGE I;  1R9T B;  4JOI A;  3RZO B;  1EY0 A;  4ZKB B;  4H44 C;  3FKI G;  5C44 B;  4JK1 C;  3F8T A;  4RH6 A;  4DKA C;  5C3E G;  2HIV A;  1IYV A;  5E3R A;  4J15 A;  1W2B A;  4YZ9 A;  1E1O A;  1G6P A;  2Y0S B;  3HZX A;  3E2I A;  2E5L L;  2EYH A;  1RHP A;  4OIK A;  3H94 A;  2IY5 B;  2K5H A;  5I6Y A;  3OWF A;  2NUC A;  4C3I H;  5M3F B;  1XNQ Q;  1QJO A;  3K58 A;  5JHW C;  1S72 A;  1X3G A;  3CPW A;  3BDL A;  4OHJ A;  4BY7 B;  5L37 A;  4JI3 Q;  1E2Z A;  1F9Q A;  1FNV A;  4O42 A;  2XIW A;  3K5L A;  4ZLT F;  4LF6 L;  3G71 A;  1M8C A;  1WKX A;  3I72 A;  2F4I A;  4GLX A;  1PH6 A;  9WGA A;  2YFB A;  3OIQ A;  2AWO A;  3PUW A;  4C3J G;  2ZXP A;  2IHF A;  4IFD G;  3T1Y Q;  2NZH A;  3DEP A;  3DWA A;  3J7A 5;  3J80 i;  1STY A;  2B0U C;  2NZO A;  2OZU A;  3TP8 A;  4DR7 Q;  5IE8 A;  3ONA B;  5I9O A;  4DF7 A;  3UEJ A;  4FF1 A;  2PQA B;  2PPB C;  2R93 B;  4WJW A;  1LT3 D;  2ZJP A;  4G7O C;  1CT4 I;  1HZB A;  1ROD A;  1SYB A;  3EBE A;  4EQO A;  4HJ7 A;  3UDI A;  2WII B;  1TY2 A;  2PMZ E;  2L5T A;  3MFG A;  4S3S A;  3ERO A;  2K7V A;  1PCE A;  1JE5 A;  5GQO A;  1F9S A;  1YNJ D;  1C9O A;  1PRT C;  2Z4H A;  2NN6 H;  4LFC Q;  1W6J A;  5FJ8 H;  3HS0 C;  1WYD A;  1TWF H;  3O13 A;  2HDM A;  2B63 G;  2A6E C;  1CA6 A;  5DAE A;  3HOZ G;  3E6Z X;  2Z4I A;  2QA4 A;  4JV5 Q;  4H7B A;  1PHJ A;  2K75 A;  3UGI A;  4ZQ3 A;  1BCP F;  4JI6 Q;  3CCV A;  5C3E B;  4HR7 B;  3I3C A;  3T4A C;  4C3J H;  5FUV A;  1MGS A;  3TRZ A;  4HCS A;  4JBW A;  2AQ3 B;  3ERQ A;  5FOB B;  1PH2 A;  5JJL A;  4X65 Q;  1X65 A;  2AHO B;  1XMO Q;  1A8V A;  3R2T A;  4A3F G;  1Q81 C;  1U9R A;  1B7Y B;  4Z7H A;  5DEH A;  2DNE A;  3F2B A;  5C3W A;  3QOJ A;  1E2W A;  5C0X I;  3NBH B;  3IFT A;  4F88 A;  2CCZ A;  2GVI A;  3NBI A;  1SYD A;  1TS3 A;  2NN6 I;  5CCM A;  1TBQ R;  1LTI D;  2XRS D;  4SGB I;  4OVO A;  3AJF A;  1RJT A;  4IPH A;  1FNW A;  4CJ2 C;  1GHJ A;  4NV5 A;  3GTM H;  2UUC Q;  4GZY C;  4P73 A;  2ICE C;  4LFC L;  1TS2 A;  2M2L A;  1VF7 A;  2NYZ D;  2VUM G;  1IL2 A;  4P74 A;  4H02 A;  2GSC A;  1YZ6 A;  2F0W A;  4XQJ A;  3CME A;  1HNW Q;  2R93 G;  4KK7 A;  1O7L A;  3CD6 A;  2JB3 A;  3CRK C;  4IQZ A;  2F0T A;  1E7Z A;  1K73 C;  3HOV B;  1FAQ A;  1OO9 B;  1IYU A;  1F9P A;  3E0J A;  1JCK B;  1HQR D;  3A5U A;  4O2D A;  4B3M Q;  1ASZ A;  1K0R A;  4AIM A;  1KAA A;  3HKZ G;  2GIV A;  3J7Y W;  3OW2 A;  1PV4 A;  1ET6 A;  3FC3 A;  2ICI A;  3RU0 A;  2N8N A;  1VQA A;  1I94 L;  4IOC A;  1YIJ A;  1DON A;  3I8Z A;  5C4Z A;  1KXL A;  1LR9 A;  1EQR A;  3DUZ A;  3H15 A;  2A1A A;  2MJF B;  1YNX A;  1LR8 A;  1JQO A;  1MSH A;  4CDF C;  2VUM B;  2MPM A;  5FK9 C;  1BCP C;  5EAY A;  3CCQ A;  3C46 A;  4L5Q A;  5CYU A;  2N55 A;  4NB3 A;  1HR0 Q;  4BBS H;  1VQ7 A;  2CAZ B;  1PZJ D;  3KK7 A;  2JAE A;  1S5E D;  2MNA A;  4OO1 I;  1Y1C A;  3OL0 A;  1B44 D;  2F0E A;  1BOS A;  4HJ5 A;  1OVO A;  3I4N H;  1QNK A;  1BCP B;  1WFQ A;  3GP7 A;  4A3L H;  3E9H A;  2JEB I;  4X3K A;  1ULK A;  2VZA A;  1D8L A;  3I9V 1;  2J7Z A;  2MFI A;  3MA2 B;  1HUN A;  2LKV A;  3TDQ A;  4ZKC B;  1B4O A;  3OWE B;  3RR5 A;  2PQA A;  4RFB A;  4FF2 A;  4YIJ A;  4IUT A;  3VYT A;  1FGU A;  5IGD A;  3TS2 A;  1WD0 A;  3HOX H;  1DGS A;  1IW7 D;  2I07 B;  1ILP A;  1N34 Q;  1FR3 A;  2DKV A;  1ESR A;  1SNM A;  2IW3 A;  4C3H B;  1PH3 A;  1ZEQ X;  1MJE A;  2Z0S A;  3OW7 A;  3NTH A;  5IYC H;  5FUY A;  1NMF A;  1PZI D;  2RKS A;  2NB0 A;  1E22 A;  5M3M B;  4DV7 L;  3HGB A;  3IAM 1;  1DOM A;  2JA6 G;  3HOY H;  2B8G A;  4GLA C;  1EYC A;  2XWB B;  1J5E Q;  1SJE D;  3HOU B;  3Q23 A;  4C3J B;  3STB D;  4Y7N H;  1H9R A;  3TP5 A;  3M3Y B;  3BG3 A;  4A3G G;  2K6A A;  5KYI A;  2UXB L;  1LV9 A;  1TOT A;  4HFV A;  4QQB X;  4DU9 A;  3BDO A;  4P71 A;  1BBX C;  3C1E A;  3E0E A;  5IYB G;  4DV4 L;  4R9W A;  1SJ8 A;  2E74 C;  1H9S B;  2L7X A;  1OXS C;  1FJG Q;  1EIH A;  2L8E A;  4J1M A;  2K19 A;  1X56 A;  4ULL A;  1MJ9 A;  4DR1 Q;  1MHW C;  5I4D A;  1XTC D;  1EUJ A;  5FJ8 G;  3GTJ B;  1I3Q B;  1Q3L A;  1EL0 A;  3IRB A;  1L2F A;  1PTR A;  2QQE A;  4RKL A;  4UP8 A;  1KMA A;  2F0P A;  2RHS B;  2YV5 A;  1N34 L;  4LF4 L;  1B50 A;  2AKW B;  2H5X A;  4N8X 1;  3V2T A;  4B3R Q;  4HTH A;  4A75 A;  2JA6 B;  1UE1 A;  3K5O A;  4LUO A;  3LJ0 A;  1NNX A;  3EA6 A;  4X64 Q;  2F6M B;  4CKC A;  3MXP A;  4X62 L;  5JJZ A;  3MWY W;  3MEF A;  2CQO A;  1GO3 E;  4QUF A;  1M1K C;  2RCF A;  2WFW A;  2KEE A;  5EGT A;  1XPU A;  3ZYY X;  5JJI A;  5ELN A;  2WGC A;  1D7Q A;  2UXB Q;  1A0I A;  4HIO A;  4ZYS A;  1KDC A;  4XXE A;  3J81 E;  3A8J E;  3GTP H;  4HIM A;  2C5C A;  4DUZ Q;  1I4G A;  4CHT B;  1RDP D;  2EXD A;  5DNF A;  4A3B G;  1PFM A;  3TN2 A;  2HDL A;  2L1B A;  4ME3 A;  1TUR A;  2A6H C;  3K5M A;  2VUM H;  3KYH C;  4C2M B;  3Q6S A;  4F7X A;  1ET9 A;  1TVX A;  3K6O A;  4LF9 L;  1OMT A;  1UVF A;  4PZ8 A;  2EQS A;  2X6G A;  4FNF A;  3PUX A;  1L0W A;  2P6A C;  2B2V C;  1JOO A;  1L0X B;  3K7A B;  1H9J A;  2QGM A;  4HJ9 A;  3CCJ A;  4Y52 H;  1STG A;  3P23 A;  3HRZ C;  2FMC A;  1WTJ A;  4DK1 A;  1EZ8 A;  5C3E H;  1H9K A;  1N8R C;  3MC0 B;  2GA4 B;  3FKI H;  4JOI C;  4YHH Q;  2JQO A;  4TQU S;  5FLX c;  5LMN W;  4DR5 L;  1R4Q B;  1QZG A;  4KN7 C;  2KEN A;  2RBM A;  4G75 A;  2V1C A;  1X9N A;  5I6W A;  1EZ6 A;  5AJ3 Q;  2KHJ A;  3Q22 A;  4UXH A;  3T13 A;  1HPT A;  4BY7 G;  3CPF A;  4DV5 Q;  2WKC A;  5G3L F;  3CCS A;  5C5L A;  2LXK A;  3GO5 A;  1YHQ A;  1YEZ A;  4RHS A;  3AU7 A;  3HP3 A;  3VYS A;  4KKU A;  4OX9 L;  1U5K A;  1SYG A;  4K8J A;  1R9T H;  4KY7 A;  2F0L A;  4GXT A;  5KND A;  1BO0 A;  1F2Z A;  3E59 A;  4QIW E;  4DV0 L;  4A3L G;  2HQL A;  4KY6 A;  1I6H B;  1ULM A;  1RCV D;  4A3B B;  1B8A A;  5M3F G;  4AYB G;  5IWA Q;  2SOB A;  1PXU A;  4DV2 Q;  2KCX A;  4YWK A;  2ROW A;  3GV3 A;  2DNC A;  2CQA A;  1AZQ A;  2JYY A;  4DV6 L;  3NWT A;  2MGS A;  2A20 A;  3D0F A;  2EYO A;  2EYJ A;  2CWH A;  2Q2I A;  4DV4 Q;  2PCF B;  4KJN A;  1O80 A;  3M4Q A;  2CW0 D;  1VQC A;  3K57 A;  5K5P A;  1VQK A;  3QWN A;  4DR3 L;  2F0O A;  2QQ0 A;  1WOC A;  3QB3 A;  1Y8N B;  3BU2 A;  3KJP A;  5JAV A;  3KF6 B;  3I55 A;  2QEJ C;  1BUV T;  4V19 0;  1I4Q A;  3SVM A;  2R93 H;  1SRU A;  2OXP A;  4K6D A;  1PYS B;  3IL8 A;  2F03 A;  4DR2 L;  4A3F B;  1EQQ A;  2KHI A;  2L9H A;  4P72 A;  1TDP A;  1PRT B;  3CCL A;  1MI2 A;  2ENN A;  1XYI A;  3I91 A;  4GN5 A;  4J6H A;  3RNU A;  1TWA B;  5DLQ E;  2E2J H;  2CVR A;  2ATW A;  1ZYR D;  3HOZ B;  4JBJ A;  5IYC G;  1CQF A;  2UXC Q;  1TWG H;  4JYA Q;  1SMY C;  1N32 L;  1OYV I;  1SGN I;  4DNC A;  1CHQ D;  4R4C A;  2ENZ A;  4DGZ A;  2XWJ B;  1KHI A;  4NP5 A;  3JC6 6;  2JA6 H;  4UP7 A;  3HOY G;  1STA A;  4KY5 A;  4YZD A;  4B6D A;  3I4M G;  3R2I A;  3A54 A;  2K5W A;  4K0K L;  3I56 A;  5JPM C;  4BWG B;  2NWG A;  2F4V Q;  1SLJ A;  3J81 j;  2BUS A;  1G91 A;  1FY7 A;  1BKB A;  2Q2U A;  3NEM A;  4LF5 L;  4B3S Q;  3U9S A;  4IUU A;  1P9G A;  2SNM A;  5IGB A;  1QUQ A;  4ZUI A;  2Y0S E;  2QDB A;  2F0V A;  4JV5 L;  5HI7 A;  2MO0 A;  1IHZ A;  3BZC A;  4A3I G;  2HHH L;  5M5Y H;  3BZD B;  1NSN S;  1X3F A;  2JN4 A;  1HA6 A;  4Q9V A;  5ELF A;  5FLX L;  3GTG H;  1U4M A;  1HA5 A;  2R7Z H;  3S15 H;  1K3B C;  3P75 A;  5EQ0 A;  4OEL B;  1JC7 A;  3H0G G;  3OVO A;  1MT1 A;  1XWE A;  4GN4 B;  2I0Q A;  1SGY I;  4MPI A;  1MBY A;  3CXL A;  2JB2 A;  1K9M C;  2DN8 A;  2R92 H;  3DEO A;  2CWG A;  1M90 C;  2QCP X;  4GI3 C;  4A3M G;  2WAQ B;  1BDO A;  2Q8T A;  4NDX A;  3OOC A;  1U4P A;  2VQF L;  2N3S A;  4DV1 Q;  1ZXT A;  4FVM A;  3CF5 A;  5J3B A;  3CCR A;  3H91 A;  2XRQ D;  3TSS A;  3K59 A;  4F87 A;  2ODD A;  1NR2 A;  3QJY A;  2F4V L;  3I4M H;  4UHV A;  4GOP C;  1TXY A;  1TY0 A;  2WP8 J;  4ME5 A;  1PH7 A;  3OTO Q;  4E6I A;  1PRT D;  4FF4 A;  2F0H A;  5EBC A;  4NXM Q;  5M9O A;  3M85 A;  1IW4 A;  3KDF B;  3KLS A;  3AFP A;  1I6H H;  3D6C A;  4OO1 H;  3NWS A;  1QCB D;  5GAH C;  2NU3 I;  2SGQ I;  3I7F A;  3NP8 A;  3A0J A;  2EY1 A;  4QF4 A;  2IT1 A;  4GKK L;  1JR0 D;  1I4H A;  2B2T C;  3A7L A;  5D65 A;  1X55 A;  1CM9 A;  1SNQ A;  3OXL A;  2IL8 A;  3L0O A;  1F77 A;  2K05 A;  4K2K A;  1Y14 B;  3SHL A;  4OAV B;  4DV6 Q;  1V8Q A;  1Z9F A;  4MN3 A;  2QQC A;  2LXJ A;  1UEA B;  3EVQ A;  2N78 A;  3CMA A;  2MJ8 A;  3ITP A;  3X3M A;  3I4N B;  1DD2 A;  5C5M A;  4NPS A;  1PDQ A;  4JCV E;  4X3S A;  5I9P A;  1UWV A;  1HQM C;  3DHQ A;  4OGQ C;  4HSP A;  4JI7 L;  3D4D A;  3FEW X;  3GQB A;  1ICF B;  2ZT9 C;  1VQ9 A;  4ALP A;  2NVT B;  5D14 A;  2JSO A;  1C4Q A;  5IGG A;  4F8M A;  2L55 A;  3S14 H;  4FXK C;  1EIF A;  2ZM6 Q;  3V05 A;  2I5H A;  1GOZ A;  5ISR A;  1SBB B;  4Q0F A;  1X6O A;  3MAQ A;  4IFD J;  5FUX A;  1AP0 A;  5IYB H;  1JJC B;  1XA6 A;  2AWN A;  2EY2 A;  3T1H Q;  2KEC A;  4KHP L;  3HKZ E;  3H0G B;  2EYP A;  1FAR A;  2FHT A;  2A2C A;  4DUY Q;  2HT1 A;  4DV3 Q;  2M9V A;  1UAP A;  4A3C G;  2D62 A;  4OON A;  3NEL A;  2UXC L;  1UE6 A;  1K8G A;  3H3V H;  2PZT A;  3QOL A;  5HGI A;  1SFO B;  1CHP D;  1EYA A;  4DWL A;  1SR3 A;  4CDE C;  4PG3 A;  2AQ2 B;  4CKE A;  5IYD G;  2B3G A;  5H1S E;  4L9M A;  2UU9 L;  4WJ4 A;  1EYD A;  3EJI A;  4J8Q A;  4R8N A;  1AN8 A;  4KKS A;  3HOW G;  2VB3 X;  1PTO B;  4LF5 Q;  3TO7 A;  5CV6 A;  1X32 A;  1DM0 B;  3KBX A;  1LAB A;  4CDC C;  4DV7 Q;  3D00 A;  5J39 A;  1VMC A;  4CDD C;  2EYL A;  3A5Z B;  1Q46 A;  1VDZ A;  3PV0 A;  4EQ5 A;  1TBR R;  2IPK D;  3BYT B;  3CP0 A;  1J5E L;  2E2H B;  3HOV G;  2HD3 A;  4IUP A;  2K5Q A;  2EYF A;  3B6Y A;  5J8F A;  1PRT F;  2ZXO A;  2JA5 B;  1WVL A;  2PW5 A;  1EY8 A;  5F2D A;  3B4V C;  2RDH A;  5ELO A;  4RCN A;  2YYZ A;  1QVC A;  2B39 A;  2K28 A;  2RSN A;  3ER0 A;  2CW0 C;  3MXN A;  3PIP 3;  3DO9 A;  1PFB A;  1B3Q A;  4JI2 L;  2F66 B;  1HNZ Q;  1I50 B;  2EPB A;  4LK1 C;  5G3L D;  5KEE A;  5CGK A;  3TRE A;  1QOH A;  1S20 A;  5J8C A;  1EY5 A;  2F0U A;  4I7Z C;  5A2Q L;  4ZAI A;  1JQY D;  4O1P A;  3ND9 A;  2EVB A;  1A3U A;  2K5V A;  2V6E A;  3DM1 A;  2R7F A;  1VQP A;  1SE2 A;  2RDG A;  3OYY A;  5LL6 X;  5IY0 A;  3S1N B;  3OHX C;  2AMC B;  2RCN A;  4PL5 A;  4A3K G;  3TQY A;  3E3X A;  1H0Z A;  3NUC A;  1W6K A;  3G48 A;  3J81 i;  1DXM A;  5C3X A;  2K04 A;  5CBE E;  5JJK A;  3SK5 A;  2YFA A;  2JK8 A;  2N17 A;  4K5V A;  1LTA D;  2GVB A;  4KKT A;  4M8A A;  3KJO A;  2NN6 G;  1U0L A;  3R5C A;  1FYB A;  3VR2 A;  1JOK A;  3BVG A;  2SGF I;  2R92 B;  4PL4 A;  4L63 B;  5HGT A;  4LW1 A;  5HUR A;  2PZW A;  2B2T A;  2BDN A;  2NVX B;  1YU6 C;  4ZUJ A;  3QR8 A;  2NZ1 D;  1AW7 A;  5C4X H;  4X65 L;  3UI2 A;  4X3U A;  4R4Q A;  3TEH B;  3S16 B;  2DY7 A;  3RLN A;  1LT6 D;  4DUZ L;  3SR1 A;  4GN3 B;  1PH5 A;  4KN4 C;  5ELC A;  1HDL A;  1SSO A;  4DR3 Q;  1EYG A;  1UHA A;  1CSQ A;  1KBE A;  4IFD H;  1QIL A;  1VQB A;  4R8I A;  1R79 A;  1KNA A;  2VNU D;  2GKR I;  3HOW B;  3KOJ A;  1GUS A;  4A3D H;  4JI7 Q;  2WAQ G;  4OO1 G;  1PTO D;  3K0X A;  4U68 A;  3P20 A;  4AQY Q;  1MJA A;  5M3F H;  4A3M H;  4IAL A;  2YTV A;  3S24 A;  2OVO A;  3WWV A;  2R92 G;  1K7T A;  2DB6 A;  2EJG C;  3MXG A;  3GTK B;  3RLO A;  1JB3 A;  4IUR A;  1PH9 A;  4C3H H;  1GUO A;  3TOB A;  4WJ3 M;  1XX6 A;  3FP9 A;  1GD7 A;  3JAM c;  3I4L A;  1YBY A;  1N9W A;  1RL2 A;  1NTG A;  4WOR A;  1WTW A;  3S2H B;  3KLS X;  2MO1 A;  3F2C A;  3BJI A;  4NXN Q;  4IFD I;  4EX5 A;  2O5I C;  4K5W A;  4AYB B;  3MFY A;  4A3K B;  3S1M H;  4RG1 A;  1JOQ A;  1OXT A;  3OSO A;  3DLL A;  1NXU A;  2VXW A;  1DOL A;  1Q8K A;  5HY6 A;  1G51 A;  4LJZ C;  3S2D B;  1CTM A;  1H95 A;  5I2X A;  4H0L C;  2A6H D;  3DM3 A;  4X66 Q;  2PYK A;  5M5Y B;  2B29 A;  1RIP A;  4GOP A;  2VW9 A;  1I4X A;  1VQF A;  4ODG A;  1PTO H;  3GTL B;  1NMG A;  4KD4 A;  2UUA Q;  1EWH A;  3DA3 A;  1KQS A;  2ERW A;  1EEI D;  3GTL H;  4JI4 L;  4DNT B;  5M5W H;  2XTR A;  2JYO A;  2A2D A;  2EYM A;  1DS2 I;  1UVG A;  2WB1 G;  5EPK A;  3HG9 A;  1ZKO A;  2J87 A;  3VA5 A;  1D5M C;  4TSS A;  2SNS A;  2KMO A;  1B53 A;  3T1Y L;  3K80 C;  3A74 A;  5J22 A;  3G6E A;  4MTK A;  2X52 A;  2ZW3 A;  3VE5 A;  5CCL A;  3R5B A;  1GVP A;  3A7A B;  4K8I A;  1HXY D;  4P75 A;  5E1F A;  4HED A;  1ENA A;  2VS1 A;  2K5D A;  3UDG A;  4JI2 Q;  1LLR D;  1GM5 A;  2PNR C;  2B2W C;  2NBF A;  3PIO 3;  1W4R A;  1TWA H;  5KNB A;  5KYL A;  2QKI C;  5EPL A;  3J81 L;  1KDA A;  3IKJ A;  3M7G A;  1XJV A;  4BA2 I;  3HOZ H;  1HNX Q;  5CV4 A;  2KMP A;  4HGU A;  1EU4 A;  2TSS A;  3OTO L;  1TKW B;  1V1I A;  4PMB A;  4LF9 Q;  4JI5 Q;  4YCU A;  4IUQ A;  1DOK A;  1WTQ A;  2KCN A;  2ZJR A;  4RMF A;  1I5F A;  2HCI A;  4PV1 C;  4OXP A;  2Z8L A;  1G29 1;  2BDO A;  5KNC A;  2SDF A;  4KV6 A;  3PQI A;  3J81 c;  4Z7G A; 
#chains in the Genus database with same CATH homology
 3F2D A;  4DR6 Q;  1Y1W G;  1BBU A;  1B8A A;  3S1Q H;  5HQ8 A;  1HZC A;  4UPA A;  4AYB G;  5M3F G;  2Q2T A;  5IYD H;  4DAY B;  2Z6K A;  5M3M G;  5IWA Q;  3M3Y H;  1VS0 A;  1SGP I;  3I4O A;  4DV2 Q;  2KCX A;  4BXX H;  4PZ7 A;  3UGL A;  4YWK A;  4YHH L;  2I5M X;  2ROW A;  2E73 A;  3G4S A;  2JYY A;  4DV6 L;  3PIP A;  1N32 Q;  1TUS A;  2A20 A;  2NU4 I;  2FNF X;  4E1P A;  3D0F A;  1MIU A;  2Q2H A;  2Q2I A;  4DV4 Q;  4LFA L;  1VQ5 A;  1BUS A;  2E8G A;  3M4Q A;  4BBS G;  1VQC A;  2VQE Q;  2W0T A;  4YY3 Q;  4JI0 L;  1VQK A;  2KCT A;  3PIO A;  1PH4 A;  4DR3 L;  3H3V I;  1I3Q H;  2JA1 A;  4U6R A;  2QQ0 A;  4X6A H;  2QGQ A;  3UDX A;  4C2M H;  1WOC A;  1XPO A;  3S1N H;  3BU2 A;  1T9H A;  3KJP A;  2SGP I;  2RIO A;  3S16 H;  3SGQ I;  3KF6 B;  4O0A A;  2EIF A;  5GRO A;  3I55 A;  1EIY B;  3BJU A;  2ZM6 L;  1CT0 I;  5LNK 1;  2UUB L;  1TWH H;  1PVO A;  1XTD A;  2R93 H;  2JB1 A;  1SRU A;  2KCM A;  1PYS B;  4JI1 Q;  1C7Y A;  4DR2 L;  1HNW L;  5K36 G;  1EQQ A;  2KHI A;  1PH8 A;  4R4O A;  1QVG A;  3SGB I;  5GAD C;  4P72 A;  2PI2 A;  3NEN A;  3PUV A;  1KIX A;  3CCL A;  4A3F H;  2V1C C;  3CW2 C;  4BY1 G;  4JI3 L;  4X64 L;  3T1H L;  2KMQ A;  4A3I H;  2D0P A;  4LF6 Q;  4KHP Q;  3S17 H;  2ENN A;  3GOX A;  3KLW A;  3J80 c;  4GN5 A;  1CUK A;  2GKV A;  3ULL A;  4X62 Q;  2LEO A;  4A3C H;  4DR6 L;  3RNU A;  1Q1B A;  5DLQ E;  1BMO A;  1Q86 C;  2YUU A;  5BR8 L;  4B3M L;  2JA8 G;  5E7N A;  5IWA L;  1TBN A;  3F4M A;  1HZA A;  2E2J H;  1IY5 A;  3QTL D;  3M4O H;  2ATW A;  3PO2 H;  2FXQ A;  1CKN B;  1P16 A;  1N36 Q;  2RHQ B;  1K3R A;  2GN5 A;  4JBJ A;  5IYC G;  4YWL A;  3CXC A;  1PH1 A;  2UXC Q;  1A63 A;  1TWG H;  3STB C;  4B3T Q;  4JYA Q;  1CHO I;  1SN8 A;  4DR7 L;  2RF4 A;  4HJA A;  1I94 Q;  4MTN A;  1N32 L;  1OYV I;  1SGN I;  4BA1 I;  4O1O A;  4R4C A;  3UEY A;  4DR4 L;  2ENZ A;  1SGE I;  1V1H A;  1KHI A;  4JOI A;  3JC6 6;  2JA6 H;  3L7Z C;  4UP7 A;  3HOY G;  3FKI G;  2DUD A;  4YZD A;  4KHZ A;  3F8T A;  4DKA C;  3PUY A;  5GAG C;  1IBM Q;  5C3E G;  3I4M G;  4B6D A;  2HIV A;  4K0K L;  4J15 A;  1MJC A;  3I56 A;  1W2B A;  4YZ9 A;  1TBO A;  4GKJ Q;  1E1O A;  1G6P A;  3E2I A;  4A3B H;  1DS3 I;  2N52 A;  1ASY A;  2E5L L;  3FHW A;  2F4V Q;  3F1Z A;  1SLJ A;  3J81 j;  1GKH A;  2BUS A;  2IY5 B;  3MEK A;  1BKB A;  2K5H A;  2Q2U A;  4LNQ A;  1YVC A;  1HR0 L;  3JSB A;  3NEM A;  4C3I H;  4LF5 L;  2JXD A;  3AQQ A;  2SGD I;  4B3S Q;  1XNQ Q;  2BA1 A;  4NXM L;  3I4N G;  1S72 A;  5JHW C;  3PO3 G;  2OTJ A;  1O7I A;  4DR2 Q;  1X3G A;  3CPW A;  1QUQ A;  3VDY A;  2Y0S E;  3SGI A;  1KC8 C;  3GTQ H;  4JV5 L;  1IBL Q;  3HH2 C;  5HI7 A;  2MO0 A;  2HHH L;  3BZC A;  4A3I G;  4JI3 Q;  2JEA I;  5M5Y H;  4LF6 L;  1X3F A;  4DK3 C;  3G71 A;  3J7Z C;  4GNX A;  1M8C A;  4GLX A;  4Q9V A;  1PH6 A;  1QZH A;  2K5N A;  2YFB A;  4DPG A;  2R6G A;  2UZ3 A;  3GTG H;  2AWO A;  3PUW A;  4OWT B;  1OXV A;  1VQG A;  1V43 A;  1L1O A;  2IHF A;  4DK6 C;  3T1Y Q;  3M7N A;  2R7Z H;  2NZH A;  3S15 H;  4IFD G;  1RFH A;  2YTY A;  3J7A 5;  3VDP A;  3J80 i;  2CFM A;  1JJG A;  2B0U C;  3H0G G;  3OVO A;  1Y8F A;  1MT1 A;  2NZO A;  4GN4 B;  2I0Q A;  4DR7 Q;  5IE8 A;  1SGY I;  1VDD A;  2NU2 I;  3MXN B;  3CXL A;  2JB2 A;  1K9M C;  5LMN L;  1YJW A;  2PQA B;  3UEJ A;  2ZRR A;  1Y1V G;  3U4V A;  1Y1W H;  2R92 H;  1M90 C;  2ZJP A;  3SDJ A;  4BBR H;  2L15 A;  4A3M G;  1HZB A;  4L5R C;  5C4X G;  1CT4 I;  4GI3 C;  1NE3 A;  3H0G H;  4PL3 A;  2VQF L;  2N3S A;  3EBE A;  1E1T A;  4HJ7 A;  3AFQ A;  3UDI A;  3K7U C;  1WCM H;  4DV1 Q;  1IBM L;  2PMZ E;  1VQH A;  1X54 A;  2ZTE A;  3AYH B;  5J3B A;  3CCR A;  3CF5 A;  2JA5 G;  4K0K Q;  4IPC A;  1NUB A;  2KMR A;  2A8V A;  2XMX A;  1PCE A;  1JE5 A;  2ODD A;  5GQO A;  2E5L Q;  2F4V L;  1HNX L;  1C9O A;  4GOP C;  3S1R H;  2JA9 A;  4LFC Q;  1TXY A;  2WP8 J;  5FJ8 H;  1PH7 A;  3OTO Q;  1WYD A;  3TJQ A;  4POF A;  1TWF H;  2JZM A;  1Z47 A;  1AH9 A;  2B63 G;  1V9P A;  2XGT A;  3PO3 H;  4UXI A;  4NXM Q;  1CKN A;  5DAE A;  2GKT I;  3M85 A;  2JJQ A;  3HOZ G;  3CC2 A;  1IW4 A;  3KDF B;  3GDE A;  2OCE A;  4JI8 Q;  2QA4 A;  3GTK H;  2UXD Q;  3AFP A;  4LF8 L;  4JV5 Q;  1I6H H;  1HJP A;  1AE3 A;  1PHJ A;  2LUY A;  1NBW A;  2K75 A;  5GAH C;  1JT8 A;  1M8B A;  2NU3 I;  1VQ6 A;  3UGI A;  4JI6 Q;  2SGQ I;  3CCV A;  3I7F A;  3W5O A;  3AEV A;  3A0J A;  1X3E A;  4C3J H;  4OAU C;  2IT1 A;  2K50 A;  3HKS A;  3PCO B;  3TRZ A;  4GKK L;  4JBW A;  5FUV A;  1BVS A;  1PH2 A;  5JJL A;  4X65 Q;  1A62 A;  1X65 A;  2AHO B;  1PJU A;  1XMO Q;  1X55 A;  4HID A;  2KKM A;  3PF5 A;  1EFW A;  1A8V A;  2CWA A;  4A3F G;  1Q81 C;  1E3P A;  3L0O A;  2OWO A;  3OXL A;  1B7Y B;  1Y14 B;  4OAV B;  4Z7H A;  3L0I A;  4KLK A;  4QY7 A;  4DV6 Q;  3BZK A;  1Z9F A;  1FJG L;  3F2B A;  2QQC A;  2LXJ A;  3KDF A;  3OXG A;  5JEA G;  5LMN Q;  3GD7 A;  4AS3 A;  4LFA Q;  2N78 A;  3NBH B;  5C0X I;  3CMA A;  2OTL A;  2B8T A;  3CAM A;  2CCZ A;  2K14 A;  1NJI C;  2ZJQ A;  2GVI A;  4NPS A;  2NU0 I;  4JCV E;  2NN6 I;  1VQL A;  1UWV A;  3M4P A;  2ID0 A;  4GNX B;  1CSO I;  1TBQ R;  5CCM A;  4JI7 L;  1CT2 I;  1KD1 C;  1JMC A;  4ALP A;  1VQ9 A;  4LF4 Q;  4SGB I;  2JE6 I;  4OVO A;  3AJF A;  4IPH A;  2J9R A;  1N33 Q;  5FLM H;  1IXR A;  4NV5 A;  1JJ2 A;  3RLF A;  2UUC Q;  3GTM H;  4P73 A;  4JC0 A;  4NV2 A;  3S14 H;  2L1L B;  4AYB E;  4LFC L;  1EIF A;  3ICE A;  4TVA B;  3JAM i;  2ZM6 Q;  2I5H A;  2VUM G;  1PFS A;  1SE8 A;  4A93 H;  1IL2 A;  1LYL A;  1X6O A;  4P74 A;  4IFD J;  4H02 A;  2IX1 A;  2XRC A;  5FUX A;  1YZ6 A;  2XTI A;  5IYB H;  4OO1 G;  3CME A;  4BY7 H;  1HNW Q;  1JJC B;  1PYB A;  1UE5 A;  4LF8 Q;  2R93 G;  3W1G A;  1XA6 A;  2AWN A;  2N71 A;  3CD6 A;  3T1H Q;  2JB3 A;  1L1O B;  1VCI A;  4KHP L;  1E7Z A;  4XTC S;  1Q1E A;  3HKZ E;  1K73 C;  4JI6 L;  5IP9 H;  1FAR A;  1FAQ A;  2A2C A;  3HOU H;  2M5X A;  2SGE I;  4DUY Q;  2HT1 A;  1CSP A;  3A5U A;  4O2D A;  5BR8 Q;  4B3M Q;  1ASZ A;  3HFZ B;  1K0R A;  4AIM A;  4DV3 Q;  4A3C G;  1X74 A;  1IYJ B;  3HKZ G;  2D62 A;  1KL9 A;  4JG2 A;  4OON A;  4APV A;  2CWP A;  1R79 A;  3DA4 A;  2LSS A;  3UE0 A;  3OW2 A;  3NEL A;  1PV4 A;  4LF7 Q;  1UE6 A;  2UXC L;  1K8G A;  4B3T L;  3H3V H;  2ELI A;  1OTC A;  4LFB L;  3RU0 A;  2N8N A;  1SFO H;  1VQA A;  2FUG 1;  1I94 L;  4IOC A;  1EOV A;  1YIJ A;  2I5L X;  1XMQ L;  2VY3 A;  5HGI A;  2ARP F;  1PA6 A;  1KXL A;  1LR9 A;  1EQR A;  3H15 A;  2OD1 A;  2R7D A;  2A1A A;  2VL6 A;  1VQO A;  2MJF B;  4DWL A;  1OMU A;  1YNX A;  2F3I A;  1SR3 A;  2KBN A;  4IJL A;  3W1B A;  5M3M H;  1LR8 A;  1SGR I;  3HOX G;  2F3C I;  4PG3 A;  1KBF A;  5IYD G;  2YU9 H;  4GKJ L;  1N33 L;  3M9B A;  2B3G A;  3GTO H;  3KF6 A;  2NU1 I;  5H1S E;  2UUC L;  2F52 A;  4YCV A;  5EAY A;  2UU9 L;  4UY8 C;  4G76 A;  3CCQ A;  3CC4 A;  4BY1 H;  3RZO H;  4WJ4 A;  4L9M A;  3HOW G;  4L5Q A;  2UUA L;  4NB3 A;  1HR0 Q;  4LF5 Q;  2D0O A;  2WB1 E;  5EX0 A;  4B3S L;  2JW6 A;  1YJN A;  1VQ7 A;  1WCM G;  4BBS H;  1UEB A;  2CAZ B;  1QUQ B;  4DV7 Q;  1WJJ A;  2NVX H;  3D00 A;  4A24 A;  1Z7K B;  2E2H H;  2JAE A;  2IHE A;  1SGD I;  3A5Z B;  1Q46 A;  1YHA A;  3PV0 A;  3ZJY C;  4EQ5 A;  1SGQ I;  2IX0 A;  2MNA A;  4FDB A;  4OO1 I;  3HOW H;  3CP0 A;  1TBR R;  2HHH Q;  1J5E L;  1Y1C A;  3OL0 A;  4HJ5 A;  2N49 A;  3HOV G;  2K52 A;  3UE1 A;  1OVO A;  3B6Y A;  3I4N H;  1Q7Y C;  3E9I A;  3HOU G;  4A3J G;  5C44 H;  1WFQ A;  4OWW B;  2HIX A;  2B63 H;  4A3L H;  3B4V C;  3E9H A;  1FVI A;  2JEB I;  1VQN A;  5ELO A;  3S2H H;  1PTQ A;  3LJ2 A;  4DV3 L;  3PDN A;  2VZA A;  1D8L A;  4IO9 A;  3I9V 1;  1QVC A;  2YYZ A;  4IPG A;  3ER0 A;  1OXX K;  2MFI A;  1LTL A;  3I2Z A;  3DO9 A;  1VQE A;  3CQZ H;  1HR0 W;  4LF7 L;  4JI2 L;  2F66 B;  3RR5 A;  1HNZ Q;  1TGS I;  2PQA A;  3TRE A;  1XMQ Q;  3UFF A;  1AE2 A;  4O1P A;  1LR7 A;  4DR1 L;  4DV5 L;  4UXJ A;  1FGU A;  2K5V A;  4POG A;  5FUW A;  2V6E A;  4A3E H;  3TS2 A;  2VQF Q;  2R7F A;  1MKH A;  1DGS A;  3OYY A;  5IT9 c;  3HOX H;  1VQP A;  5IY0 A;  2XTQ A;  3PUZ A;  1N34 Q;  2AMC B;  2RCN A;  4PL5 A;  4A3K G;  3PO2 G;  1UUC A;  1CE3 A;  3TQY A;  2P22 B;  4JI5 L;  4OX9 Q;  1H0Z A;  4AQY L;  1PH3 A;  1MJE A;  3U50 C;  4L5S A;  2E2I H;  4B3R L;  2Z0S A;  3CCU A;  3G48 A;  3J81 i;  2UU9 Q;  5IYC H;  5FUY A;  1NMF A;  5JJK A;  1C0A A;  2YFA A;  3ERS X;  1X4S A;  2JK8 A;  2N17 A;  1S3O A;  3KFU A;  1E22 A;  4A3K H;  1YHB A;  3RN5 A;  1FL0 A;  2GVB A;  4DV7 L;  4DV0 Q;  3OXF A;  3IAM 1;  1IY6 A;  5C0X G;  3KJO A;  2JA6 G;  5FLM G;  2UXD L;  2NN6 G;  3HOY H;  1U0L A;  4GLA C;  1JB7 A;  1FYB A;  2SGF I;  4GS3 A;  1J5E Q;  1YTP A;  4PL4 A;  1XPR A;  4LW1 A;  3STB D;  2N1A B;  4Y7N H;  3L2P A;  2WAQ E;  4YWM A;  4A3G G;  1YU6 C;  4GKK Q;  2UXB L;  1TOT A;  4HFV A;  4QQB X;  5C4X H;  4X65 L;  5C44 G;  4LUV A;  4P71 A;  3S2D H;  1XMO L;  4LUZ A;  3E0E A;  4R4Q A;  3TEH B;  5IYB G;  2K4K A;  4DV4 L;  1SJ8 A;  3CC7 A;  4JBM A;  2MQH A;  2JA8 H;  1LUZ A;  3RLN A;  2L7X A;  1OXS C;  4DUZ L;  1HNZ L;  4A4I A;  4GN3 B;  2VQE L;  4YY3 L;  1PH5 A;  2WCY A;  4JI0 Q;  4YZC A;  2Y0S G;  1HZ9 A;  3EIV A;  5M5X H;  1FJG Q;  1PPF I;  2L8E A;  1HDL A;  2K19 A;  4DR3 Q;  1X56 A;  1EYG A;  2V53 A;  2OQK A;  1CSQ A;  4DR1 Q;  5GAE C;  1KBE A;  1VQM A;  5FJ8 G;  3Q8D A;  1EUJ A;  1VQB A;  4YCW A;  2JA7 G;  2VNU D;  2QEX A;  3IRB A;  1AN1 I;  1IZ6 A;  1L2F A;  1VQJ A;  3LGJ A;  1PTR A;  3KOJ A;  2E5R A;  4A3D H;  1XNR Q;  2GKR I;  4UP8 A;  2ORW A;  4JI7 Q;  2RHS B;  4X66 L;  2QQE A;  1KMA A;  1EWI A;  1YO7 A;  2WAQ G;  2YV5 A;  1N34 L;  4AS2 A;  4LF4 L;  2AKW B;  2DGY A;  3K0X A;  3RN2 A;  2UUB Q;  1QVF A;  1W3S A;  2H5X A;  1K83 H;  4AQY Q;  4B3R Q;  4JI1 L;  1Q12 A;  5M3F H;  4A75 A;  4A3M H;  2CKZ B;  4MZ9 A;  1OXU A;  1UE1 A;  4BXX G;  2YTV A;  2BA0 A;  3S24 A;  2OVO A;  1Y1V H;  3WWV A;  4LUO A;  2R92 G;  3LJ0 A;  2DB6 A;  1J6Q A;  4X64 Q;  1R0R I;  2F6M B;  5IP7 G;  1K8A C;  4A3J H;  3RLO A;  3KY9 A;  3SEK C;  1I50 H;  4R1J A;  4X62 L;  2YQP A;  1BBW A;  4C3H H;  1PH9 A;  3PF4 A;  2OQ0 A;  3K8A A;  4AH6 A;  3MEF A;  1E24 A;  2CQO A;  3UIT A;  1GO3 E;  4OWX B;  4WJ3 M;  4PZ6 A;  1M1K C;  2JA5 H;  2WFW A;  1XX6 A;  3FP9 A;  2QQD A;  2ZTC A;  1GD7 A;  3CCE A;  3JAM c;  2QPO A;  3UGD A;  3TS0 A;  3PSI A;  1XBT A;  1SMX A;  3PGZ A;  1N36 L;  1YBY A;  1XPU A;  5JJI A;  1L1O C;  1N9W A;  5ELN A;  4DUY L;  4HIK A;  1RL2 A;  4DR5 Q;  3ULP A;  1NTG A;  5IP7 H;  4GOP B;  4JYA L;  2UXB Q;  1D7Q A;  1A0I A;  4HIO A;  2MO1 A;  3F2C A;  3BJI A;  3QWP A;  4NXN Q;  4R4T A;  3GTP H;  4DR4 Q;  1IBK Q;  3KF8 B;  4IFD I;  2K9H A;  4HIM A;  4FKD A;  2PI2 E;  4EX5 A;  5IP9 G;  1Y1B A;  4QGU A;  1P8L A;  1VQI A;  4DUZ Q;  3HOV H;  1NY4 A;  1YIT A;  4LFB Q;  3FBV A;  5AJ3 L;  5C4J H;  2EXD A;  4XIG S;  3S1M H;  4A76 A;  1CKM A;  3KP9 A;  4LWC A;  4RG1 A;  1OXT A;  3DLL A;  2R7Z G;  4A3B G;  4ME3 A;  5HY6 A;  1Q8K A;  1TUR A;  1HH2 P;  3RZD H;  4JBK A;  1G51 A;  2C35 B;  5EX3 A;  4UP9 A;  4R4I A;  4I1T A;  2VUM H;  2NVT H;  2JA7 H;  4A93 G;  1H95 A;  1CGI I;  3FC3 A;  3KYH C;  1XNR L;  4IJH A;  3DM3 A;  4X66 Q;  4A3D G;  2IP6 A;  2B29 A;  1RIP A;  4GOP A;  2VW9 A;  4LF9 L;  1XNQ L;  5C0X J;  1OMT A;  2ASB A;  4BBR G;  1VQF A;  1UVF A;  4GLV B;  4PZ8 A;  2EQS A;  1L0W A;  3PUX A;  2P6A C;  4DNI A;  1NMG A;  1KRT A;  3CCM A;  2UUA Q;  2WVJ A;  3DA3 A;  1KQS A;  1IBL L;  5LMU L;  2ERW A;  3GTL H;  4HJ9 A;  3LJ1 A;  1TWC H;  4JI4 L;  4QL5 A;  5M5W H;  3K81 C;  3K7A H;  3CCJ A;  2XTR A;  1DS2 I;  2A2D A;  1KAW A;  1V1Q A;  4Y52 H;  1UVG A;  2WB1 G;  1N13 A;  4A3G H;  3P23 A;  2J87 A;  4IPD A;  1UE7 A;  4GNX C;  2KMO A;  5C3E H;  3T1Y L;  3K80 C;  2ZTD A;  3A74 A;  3GTJ H;  4DV2 L;  1Q82 C;  1N8R C;  2GVA A;  3FKI H;  4JOI C;  1HJA I;  3G6E A;  5CCL A;  4PMW A;  4YHH Q;  3VE5 A;  2JQO A;  4TQU S;  5FLX c;  5LMN W;  1LM0 A;  1GVP A;  4DR5 L;  4P75 A;  4IOA A;  1QZG A;  4NXN L;  4E1R A;  1IBK L;  2BH2 A;  4L5T A;  1S40 A;  2VS1 A;  3UDG A;  2KEN A;  2DIP A;  1KRS A;  4JI2 Q;  4G75 A;  2NVQ H;  1B70 B;  1GM5 A;  1X9N A;  2V1C A;  4HJ8 A;  2ES2 A;  5AJ3 Q;  2KHJ A;  1W4R A;  1VQD A;  2CJS C;  3UDF A;  1SRO A;  1TWA H;  1CGJ I;  4QJF A;  4DV1 L;  1TIH A;  2VRW B;  1VQ8 A;  4UXH A;  3EN2 A;  1HPT A;  4BY7 G;  3CPF A;  5JEA J;  4DV5 Q;  1YJ9 A;  1CKO A;  3CCS A;  4MNO A;  1XJV A;  3IAS 1;  4BA2 I;  2Z6K C;  3I4M H;  2LXK A;  3GO5 A;  3HOZ H;  1YHQ A;  1HNX Q;  2KMP A;  1YEZ A;  4HGU A;  3OTO L;  4A3E G;  4DAM A;  1V1I A;  3U4Z A;  5HGQ A;  4LF9 Q;  1WI5 A;  4JI5 Q;  1VQ4 A;  4OX9 L;  1U5K A;  3U58 A;  4YCU A;  3ULJ A;  1R9T H;  2A19 A;  4JI8 L;  4GXT A;  2YTX A;  2ZJR A;  4KI0 A;  4HEA 1;  4RMF A;  5LMU Q;  1I5F A;  3D31 A;  3E59 A;  2NVY H;  2BH8 A;  1YI2 A;  4OXP A;  4JI4 Q;  2PNH A;  2ORV A;  3VDU A;  4QIW E;  4DV0 L;  1G29 1;  2ALY B;  2HQL A;  4A3L G;  3VA9 A;  3J81 c;  4Z7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...