2V1CC

Crystal structure and mutational study of recor provide insight into its role in dna repair
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
234
structure length
229
Chain Sequence
SRTANRSGIVIRRRVTPAGDIIVTLLTPQGKLKAIARGLSSSLNLFHHVGVQVYQGPHNDLASVKQAVLEGALPTLAEPERYAFAHLMAEFADALFQEGEFSEQAFDLFAASLRGVAHQPDPEWVALVMSYKLLGLAGVIPQTARCARCGAPDPEHPDPLGGQLLCSKCAALPPYPPAVLDFLRHAVRRTVRASFEQPVPSADRPALWRALEKFVTVQVGGVHSWRQLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Mutational Study of Recor Provide Insight Into its Mode of DNA Binding.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Recombination
molecule keywords RECOMBINATION PROTEIN RECR
total genus 52
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2007-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02565 RecO_C Recombination protein O C terminal
C PF11967 RecO_N Recombination protein O N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.120 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2v1cC02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2v1cC01
3.30.60.100 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2v1cC03
1O7IA 1I3QH 1SE8A 2DUDA 2JA9A 3NBHB 4YY3Q 4X65Q 5M5XH 5LMNL 1DGSA 3PO3G 5C0XI 3PV0A 2E5LL 5JJKA 1VQ9A 3I2ZA 3CD6A 3CPWA 3W1BA 1JJ2A 2VNUD 2CFMA 1HZ9A 2Z6KC 4C3IH 3L2PA 4NXML 2R92H 1N36Q 3M9BA 3BZKA 1YIJA 1PH5A 1TWHH 3KFUA 1KIXA 1SR3A 2HHHL 5IWAQ 4GKKL 1SFOH 1TWCH 4LFAL 1SLJA 1A0IA 4BY1G 4OX9Q 5C44H 2HIXA 1QZHA 4LF8L 4JI8Q 3GTLH 1VCIA 1A63A 4PZ8A 3CAMA 4QY7A 3U4VA 5IY0A 3J81c 3OTOQ 5C3EH 2B3GA 3RR5A 4A3IG 2UXBQ 1E1TA 1VQFA 3PIPA 4P73A 1PHJA 3S2DH 1S72A 1VQ5A 4IPHA 4A3BH 1VQ6A 4UY8C 1UE1A 3HKSA 3NENA 5AJ3Q 1I94L 2YTXA 3I4MG 1UE5A 2KHIA 4LUOA 2YTYA 4A3JG 2BA1A 2NZHA 1H95A 1FJGL 2RHQB 4HJ5A 3PGZA 4DV3L 1KC8C 1D8LA 3PF5A 4DPGA 4B3RL 4BA1I 4X64L 4DR7L 4EX5A 3SGIA 3S1RH 4HIOA 3U58A 1Y1VG 2VUMG 5C4XH 5H1SE 1HR0W 1YHBA 1FJGQ 1KL9A 1WYDA 2UUCL 1UE7A 2A1AA 3I4NH 4A3DG 4A3LH 3W1GA 1VQDA 4K0KL 2D0OA 4LF5L 3HOUG 1E3PA 1P8LA 5ELOA 2UXDL 4DUZL 4GOPA 1WCMH 4DR3Q 3A0JA 3PO2G 1N9WA 1VQ8A 4YCWA 2N3SA 1PH3A 1GM5A 4JBKA 5IWAL 1E1OA 2NZOA 3PO3H 3HOVG 4NB3A 1Z47A 1TWFH 3M85A 3TS2A 1Y1WH 2ZJRA 1VQCA 4BBSH 1CKNA 2VUMH 1EYGA 4DR1Q 4Y7NH 2AWOA 2AHOB 1M1KC 3S2HH 4JI4L 3S1MH 2OQKA 2MFIA 2VL6A 4JOIC 2OTLA 3CCSA 1QVCA 2Z0SA 2OWOA 1X3FA 2NN6I 1KXLA 1C7YA 1W3SA 4X62Q 2WFWA 1LM0A 3KF8B 3CQZH 2UUAL 4A75A 2JEBI 1M90C 4JI6Q 3UE1A 1N33Q 1QVFA 3CCJA 4XTCS 5GAGC 4B3TL 2JQOA 3E0EA 5IP7G 5JJLA 4TQUS 1IBLL 2MQHA 4LWCA 4JG2A 2F4VL 1VQBA 2WB1E 4IPDA 4L5QA 1Q81C 4JI4Q 4A3BG 2CKZB 1PV4A 3UDIA 1VQPA 1YNXA 4DV7Q 4LW1A 3CCRA 1QVGA 4A3IH 2ZTDA 4NXNQ 3K8AA 4LF8Q 1YHQA 2K50A 4DV6Q 3B6YA 3RZDH 4QL5A 4QGUA 4X6AH 3RNUA 3M7NA 1LYLA 4O2DA 1BKBA 1MKHA 5M3FH 4DR3L 1OXTA 1UE6A 3JC66 3T1YQ 1KRTA 4PG3A 4AIMA 3CCEA 2IHEA 2K5VA 2VZAA 1Q7YC 2YU9H 1X3EA 3S24A 4OWWB 4LF4Q 3G4SA 1G6PA 1QUQB 3L7ZC 4OONA 1WOCA 2C35B 4JOIA 3ULPA 1MIUA 1B8AA 4R4CA 4JI7L 2NVTH 5K36G 4BBRH 2EXDA 2BH8A 4PZ6A 3MEFA 3GTJH 4Y52H 1SROA 2XGTA 4NPSA 1XNQQ 2XTIA 1RL2A 3UE0A 1YJ9A 1I5FA 1S40A 4X64Q 4DR7Q 5ELNA 5M3MH 3S15H 4B3RQ 2CWPA 3J80i 3RLFA 5C3EG 3HOYG 4LUVA 4DK6C 3M4OH 5JJIA 3D31A 1BBUA 3PUZA 3PUYA 2OCEA 4GN3B 3CCMA 3A5ZB 4POFA 4BXXG 4KHPQ 4DR6Q 4A3FG 1YBYA 2H5XA 4DV4Q 1AE2A 2L15A 4B3SQ 4P71A 1V1QA 4O0AA 4BBSG 4A3EH 3PF4A 4DV5L 1Y1WG 2QEXA 4JI8L 1X54A 2JA7H 3J81j 3CW2C 1BBWA 1L2FA 3HOVH 1EQRA 1LTLA 2OQ0A 4LFBL 2VY3A 2PI2A 2R92G 2VQFQ 1VQKA 2GVAA 2K5NA 2B63G 2JA6H 4EQ5A 3GTMH 3AFQA 2UXCL 3H0GG 3HFZB 2JA5H 1GO3E 4LFCL 3W5OA 4A4IA 2UU9Q 1VQAA 1PH8A 3KDFB 2F3IA 2KCTA 3HOXH 1AH9A 4DR1L 3HKZG 4JI1L 2D0PA 3I55A 1KHIA 4AYBG 1CKOA 3OYYA 2KHJA 5M5YH 1N36L 3GD7A 2I0QA 1WJJA 3CC7A 4JI0L 2BA0A 2R7DA 3A74A 2GVBA 5IYCG 2LSSA 4LFAQ 4JI2Q 4C2MH 3DLLA 1VQ4A 3F8TA 3J80c 4HJ8A 4LFBQ 3HOWG 1HNWL 4B3ML 4GKJQ 1NBWA 1U0LA 1K0RA 2HIVA 1HZCA 1GKHA 3AEVA 1PVOA 2N49A 4GKKQ 1ASZA 3BZCA 1EWIA 4JI5L 1EUJA 2I5LX 2ZTCA 4GN4B 1K8AC 4B3SL 1UEBA 4DV1Q 2F4VQ 2KCMA 4WJ3M 5C4JH 1XMQQ 4NXNL 2ATWA 4JYAL 2E8GA 2RCNA 5IYBH 5M5WH 4RG1A 5M3FG 1XJVA 4DKAC 4GOPB 1OXUA 1OXXK 4HIDA 5C4XG 2RHSB 1XTDA 2JJQA 2E2IH 4KLKA 2R7FA 5J3BA 1L1OA 3CCLA 3HOXG 1SN8A 3KF6B 1IZ6A 2UXCQ 4BY1H 4DV2Q 3PUVA 3I7FA 3RLOA 1W2BA 4YHHQ 1V9PA 4YWMA 3CMAA 1K3RA 1E24A 1YJNA 2UUBQ 1VQIA 5FJ8H 3CCQA 3EBEA 2HT1A 2Q2HA 3F1ZA 1HZBA 1KD1C 3KDFA 1L1OB 4A3JH 4JI0Q 4JV5Q 1VQJA 4IOCA 4IFDG 1XPUA 3ICEA 3FKIG 3HOWH 4JI1Q 4GLXA 4IFDI 2K14A 4GOPC 4APVA 4LF5Q 1X9NA 1HNXQ 1MJEA 4LF6L 4A3FH 3M4PA 5GROA 3ER0A 3A5UA 2JA8H 2WAQE 1OTCA 4OWTB 2UUCQ 3TRZA 3RLNA 1YVCA 1K8GA 5IYDG 5LMNQ 1K9MC 3S14H 3Q8DA 5M3MG 1YJWA 2VQEL 2UXDQ 5LMNW 3GTQH 4R1JA 3H0GH 3L0OA 3STBC 3RN5A 4MNOA 3ULJA 1VQLA 2JA6G 1L1OC 2YTVA 2MNAA 3UDXA 2E5LQ 2ZTEA 3S1NH 5GADC 1SRUA 1TWAH 4JI3Q 2JEAI 1N32Q 5FJ8G 1FVIA 4UPAA 4KI0A 1PH9A 4KHZA 1GVPA 1Q8KA 2FXQA 1WFQA 4A3CH 5C0XJ 1JMCA 1TWGH 3E9IA 4QIWE 3U4ZA 4YWKA 4OWXB 4DAYB 1XNRL 2ES2A 4PZ7A 1VQEA 3VDYA 1IBKL 1KAWA 4LF9L 5IT9c 3ZJYC 4DUYQ 1X6OA 1MJCA 4TVAB 1EQQA 1J6QA 4UP7A 3KJOA 3CC4A 4IOAA 3CF5A 2OTJA 2AKWB 1X55A 1LUZA 3CCVA 3TEHB 1Y14B 4RMFA 4DV6L 1VQHA 5GAHC 4XIGS 3G48A 1HNXL 4B3MQ 1JB7A 1HNWQ 3F2CA 1YZ6A 1IYJB 1HR0Q 3U50C 2IX1A 2NVQH 3GTOH 4JI2L 4DV0Q 4DUYL 3STBD 2MO1A 2AWNA 4NXMQ 4A3MH 1JJGA 1VQ7A 3KLWA 1B7YB 1Q1BA 2ZJPA 4ALPA 4LF6Q 4BA2I 4A93G 3HOZH 3EN2A 1NY4A 4DR4Q 4J15A 3PIOA 2CQOA 4IPGA 1KRSA 2F52A 2ID0A 2Q2IA 4DK3C 3G6EA 2VQEQ 1U5KA 2K4KA 5DLQE 3J81i 2R7ZG 4WJ4A 4GS3A 4P74A 1EIYB 5IYBG 4B3TQ 2UXBL 2K52A 5GQOA 2YV5A 4GNXA 1VQOA 3FP9A 3K0XA 1XMOL 1B70B 1JJCB 4X65L 4HJ7A 4HJ9A 4DV7L 2B63H 3UDGA 4LNQA 1J5EQ 1N34L 1V43A 5IP7H 1Z9FA 2NVYH 2GN5A 1HH2P 1PYBA 4MTNA 2PMZE 1Q86C 2K5HA 4PMWA 4AQYL 4KHPL 3D0FA 3F2BA 4IJLA 1HNZQ 4YCVA 5IYDH 1NMFA 3GTKH 2D62A 4DV1L 4A76A 2Y0SE 3CP0A 2ZJQA 1QZGA 1QUQA 3LGJA 4X62L 1VQMA 2HHHQ 5IP9G 2IY5B 1JT8A 3AFPA 2ZM6L 2QGQA 4MZ9A 4UP9A 2WAQG 4QQBX 5JEAJ 1IL2A 5C0XG 3OTOL 2UUAQ 1VQNA 4DV2L 3FKIH 5BR8L 1HNZL 1IBMQ 3ULLA 5JEAG 3M3YH 2B29A 4OO1G 2IT1A 4BBRG 2WB1G 4QJFA 1GD7A 3WWVA 5FLMH 3OW2A 1WI5A 1CSPA 1N8RC 3PO2H 4DR2Q 4ME3A 1PYSB 1CUKA 1E22A 4DR6L 3M4QA 1A62A 1FL0A 1RIPA 1E7ZA 4X66Q 3H15A 4HJAA 1S3OA 2K75A 2Q2TA 4H02A 2BH2A 4DV3Q 1PH6A 1IXRA 1XNRQ 4R4QA 3RN2A 1OXVA 1YHAA 2Y0SG 3J7ZC 1Y1VH 5BR8Q 3JAMc 1IBML 2KENA 1ASYA 3PCOB 1X3GA 1HZAA 3DM3A 4JC0A 4R4OA 5LMUQ 1N34Q 5HGQA 4LF7L 3GTPH 3HOZG 4A93H 4IFDJ 4JV5L 1YI2A 3HOYH 1X56A 1XMOQ 2QA4A 1D7QA 1SMXA 4JCVE 4P72A 1IBKQ 3I4OA 2HQLA 3K7UC 4A3KG 1PA6A 2ASBA 3CXCA 4IPCA 4A3MG 1XPOA 1YEZA 3PUXA 2VS1A 3S1QH 5FLMG 1P16A 2PQAA 3KF6A 4LFCQ 4FDBA 1L0WA 3MXNB 3NEMA 1K83H 4L5TA 4DV0L 4IO9A 1PH1A 1YITA 1I6HH 3PSIA 1NMGA 4JI3L 5LMUL 1Q82C 4LF7Q 4OX9L 4GLAC 5FLXc 1N32L 3GDEA 4DR4L 1G291 1Q46A 1CSQA 1IBLQ 3BU2A 2R6GA 3T1HQ 4L5SA 1OXSC 3J7A5 2JA8G 3AQQA 2KBNA 2NN6G 3KJPA 3S17H 3UDFA 3BJUA 3GO5A 4JBJA 4AH6A 3I56A 3H3VH 4AYBE 4A3GG 2EQSA 2DGYA 5C44G 2E2JH 4JBMA 3HKZE 1EOVA 3CC2A 1PFSA 2RF4A 3ERSX 4BY7H 1NJIC 1K73C 3T1YL 4JI6L 1CKNB 1BVSA 1WCMG 3HOUH 2LXJA 2PI2E 4DNIA 2UU9L 4BY7G 1XMQL 4JYAQ 4AQYQ 3E9HA 3IRBA 4DAMA 4A3EG 2AMCB 4A3LG 3TQYA 4A3DH 2JE6I 3GTGH 1HJPA 2WP8J 3G71A 2JA7G 2R93G 1Q1EA 3KOJA 4UP8A 1N33L 1VQGA 4YHHL 3CMEA 1XNQL 3NELA 5GAEC 1PH7A 2CWAA 1PH2A 4C3HH 5AJ3L 4DR5L 1I94Q 3H3VI 4BXXH 3F2DA 4R4TA 4K0KQ 4OO1I 1AE3A 1I50H 1FGUA 2EIFA 3FHWA 4GLVB 2UUBL 1XPRA 4GKJL 2R93H 2IX0A 1CKMA 4YY3L 1NE3A 2A8VA 3TREA 3CCUA 1KQSA 2VW9A 2ZM6Q 3T1HL 1Q12A 3K7AH 1EFWA 3I4MH 4DR2L 2A19A 2N8NA 1EIFA 2E2HH 4A3KH 1J5EL 1TXYA 4GNXB 5IYCH 3I4NG 3S16H 2I5HA 3RZOH 1NTGA 5HY6A 2R7ZH 2LXKA 3EIVA 4POGA 4HIKA 2I5MX 4DUZQ 4L5RC 2IHFA 1C9OA 2ALYB 2Z6KA 4R4IA 3JAMi 4A3CG 2CCZA 5E7NA 4DV4L 1R9TH 2JA5G 4YWLA 4GN5A 4C3JH 2JK8A 2NVXH 2PNHA 2Q2UA 5EAYA 4DV5Q 1UWVA 4DR5Q 1A8VA 1JE5A 3AYHB 4JBWA 4GNXC 3CPFA 5IE8A 2PQAB 3PUWA 1T9HA 2VQFL 1C0AA 4LUZA 4HIMA 4A3GH 2YYZA 4LF9Q 1PH4A 1G51A 1VS0A 1X65A 5IP9H 2V1CC 3K80C 2MO0A 4P75A 4JI5Q 4JI7Q 4YCUA 2N78A 4X66L 3K81C 3TS0A 4IJHA 4OXPA 3KYHC 4LF4L 1HR0L
chains in the Genus database with same CATH superfamily
3S17B 2JA9A 2LY7A 3NBHB 2VUMB 2E5LL 4XYQA 1SYCA 3CPWA 1JJ2A 1HZ9A 1A3VA 4XXEA 1VF5C 4EQNA 1N36Q 3BZKA 1HTLD 4C3HB 3BVGA 1SR3A 2L11A 4GKKL 1TWCH 3E5SA 4LF8L 4FF2A 1A63A 1D1KA 3OTOQ 1CQFA 2F6MB 2B3GA 2UXBQ 2ORVA 4P73A 4MN3A 3HOVB 4IPHA 1VQ6A 2CW0C 3OMGA 2G9HD 3NENA 5AJ3Q 1WGTA 2YTXA 5CR3A 1JOQA 2KHIA 5M3FB 4A3JG 1X32A 4L9MA 5EPKA 1FJGL 1CTMA 2J87A 3PGZA 3T53B 4DV3L 1A6XA 1D8LA 3PF5A 1S5DD 4WP4A 1DS2I 4BA1I 3SXHA 5FO7B 3R8BA 4JK1C 2GKTI 1CI3M 1PRTF 3OIQA 3T51B 3U58A 1HEVA 2VUMG 5H1SE 2MHVA 1QILA 2RCFA 1HR0W 1YHBA 1WYDA 4B9WA 1ILPA 4A3DG 4K8JA 1VQDA 3HOUG 2J4XA 2JYYA 1WTXA 4DUZL 2CH4W 4DR3Q 3A0JA 1FD7D 1PH3A 4JBKA 5IWAL 2NZOA 2ZT9C 2AQ2B 1TWFH 3NSWA 4B9XA 3M85A 4EQOA 1Y1WH 2ZW3A 1VQCA 1G6ZA 1CKNA 1QJOA 4A3JB 1EYGA 4IALA 2NN6H 1M1KC 2WGCA 4CHTB 4YZDA 2VL6A 4JOIC 2I07B 2L1LB 3TJQA 2WFWA 4EVOA 1LM0A 3DWQA 4JI6Q 3CCJA 4B3TL 3OOCA 3UGDA 5EGTA 1JICA 3J80E 1LR9A 2QPOA 1IBLL 4KD4A 1KAAA 1VQBA 4L5QA 2HCCA 4HEDA 1I4HA 1PV4A 3VYRA 5KYIA 1YNXA 2F3WA 4R9WA 4DV7Q 1NR2A 2A69C 2CWHA 2OT2A 3K8AA 4DA2A 1YHQA 4LF8Q 3B6YA 3RZDH 4QGUA 4B6DA 3AU7A 3M7NA 4A24A 4O2DA 5C3WA 5M3FH 4PG3A 1BNZA 1DS3I 4RCNA 2BDOA 3F4MA 1X3EA 2A68D 3S24A 4OWWB 4LF4Q 4OVOA 5M5XB 1WOCA 1HPTA 3TP6A 3ULPA 1B8AA 4UHVA 4OIKA 5K36G 1EOTA 4BBRH 1HUMA 1XNQQ 2XTIA 2O5JC 1CGJI 1YJ9A 3KLSX 4X64Q 3S15H 3HOYG 3J80i 1EY5A 5DAUA 4DK6C 2EY1A 1XA6A 3CCMA 2F66B 4POFA 1HUNA 2M5XA 1Y8NB 1AE2A 4P71A 3SHLA 2YUUA 5I9PA 4A3EH 4DV5L 3PF4A 4JI8L 2NZ1D 2JA8B 2OQ0A 1LTLA 2VY3A 2K03A 2R92G 2VQFQ 1TBNA 2K5NA 2SGEI 1S5BD 4I7ZC 3AFQA 2UXCL 3H0GG 1VMPA 1MJ9A 2FEFA 4LFCL 1EEID 3K5NA 4Z9CB 3HOXH 1AH9A 5EPJA 4DR1L 4JI1L 1KHIA 1BCPB 1CKOA 3BG3A 3CC7A 1PMRA 1RKNA 3LJ1A 1B1ZA 5C4XB 1SXTA 1G91A 4C2MH 1W6JA 5ELBA 4LFBQ 3E6ZX 5LHY1 2EYFA 4B3ML 1U0LA 3NHHA 1HZCA 3UGIA 4RH6A 3GTLB 4GKKQ 3HOYB 4JI5L 1EWIA 2E75C 3A8KE 2ZTCA 5FO8B 1K8AC 3TSSA 1ZYRD 3T16A 4DV1Q 5M5WB 2KCMA 1XMQQ 2ATWA 1YNJD 3FDTA 5M3FG 2XTQA 4GOPB 4HIDA 2A68C 5J3BA 3CCLA 3HOXG 2B8FA 4DV2Q 1SAPA 3I7FA 2M00A 1W4RA 3HKZB 3CMAA 2UUBQ 2H4OA 2IJ0A 3L9AX 2N1AB 1Y1WB 3KDFA 2Z9HA 1BF4A 4IOCA 4PL3A 1FY7A 3FKIG 4KY7A 1Z7TA 1TWHB 4APVA 1M8AA 2J7ZA 5J1ZA 1HNXQ 1MSGA 3OWEB 3M4PA 2A2DA 1TURA 2JA8H 2V53A 2UUCQ 3AJFA 2PW5A 3RLNA 3TRZA 2A74C 3K5MA 3S14H 1K9MC 4RFBA 1SNDA 1Y8OB 2K5DA 5C6AA 3L0OA 3RN5A 4MNOA 1VDZA 2GA4B 1K3BC 5E3PA 5C4HA 3C1EA 2L8EA 1S20A 4UPAA 4KI0A 1PH9A 1TWAB 1LACA 3VR6A 1Q8KA 4L63B 1WFQA 1OO9B 5C0XJ 3E9IA 4HTHA 2E74C 2ES2A 5JHWC 3VR2A 3ZJYC 1X6OA 2VXWA 1J6QA 3U9OA 2E2HB 3KJOA 2B39A 3G7LA 1NSNS 2OTJA 5M5YB 2FUG1 3VA5A 3TEHB 1VQHA 5GAHC 1HNXL 1IY5A 1HNWQ 3CU7A 1HR0Q 1STHA 2WAQB 1RJTA 1LTRD 4JI2L 1E2VA 2R3ZA 1DOMA 4DV0Q 2E2IB 1LV9A 2AWNA 2MO1A 1CE3A 1Q1BA 1KTKA 4BWGB 4A93G 2MUYA 5A35A 2KUMA 3HOZH 2ETDA 4OL7A 5ELEA 1SMYD 1DCZA 2ID0A 2A69D 4J6HA 5DAEA 3J81i 5G3LF 2GVIA 5TSSA 2K52A 3FP9A 2B63B 1ULMA 4AYBB 4X65L 4HJ9A 2OU2A 5EKKA 4LNQA 1N34L 1GUWA 4C3IG 4QMGA 4MTNA 2QDLA 2B0UC 4HGUA 4PMWA 3TN2A 2K1BA 3D0FA 3R3OA 2KVMA 1LLRD 2NVXB 5ELCA 2L5TA 4CDCC 2BDNA 2Y0SE 3GP7A 4KKTA 1AFPA 1VQMA 2HHHQ 4X3SA 1JT8A 2ZM6L 3N6RA 3EFXD 4OEMB 1MGSA 1TS5A 1FAQA 2A73B 2X6LA 4RKLA 3R93A 2WAQG 1BQQT 1QOHA 5C0XG 3OTOL 1VQNA 1IBMQ 1GOZA 3ULLA 5JEAG 4BBRG 1F9SA 1FGBD 2EYMA 1CSPA 4LMQD 2L0CA 2IPKD 1CSOI 4IZ8A 5CV6A 1E22A 1RIPA 3EA6A 3NTKA 4H7BA 2XSCA 5FUXA 4HJAA 2Q2TA 1MD2D 1S3OA 1QNKA 4H02A 1IKMA 1PH6A 3J7ZC 1I4RA 4WJWA 3DM3A 1EY6A 3HOZG 4KN4C 4A93H 2EXZA 1EY9A 1D7QA 1SMXA 2NYZD 1STEA 3K7UC 1PA6A 3CXCA 4G7HC 1SBBB 3FNBA 2ENBA 3PUXA 1YTPA 1RTNA 4X3TA 4ZCKA 2KCNA 1B2TA 4G7OC 4L5TA 4DV0L 2ELIA 4AMLA 1YITA 4OX9L 2KCCA 1G291 3KLSA 1Q46A 1CT1D 3BU2A 4JPBW 3T1HQ 4L5SA 3TO7A 3KBXA 4ABNA 1CZGA 1YNNC 2RKSA 2KBNA 5E4WC 4ZKBB 3KJPA 3S17H 3BJUA 4AH6A 5G3LD 1EQVA 3V2TA 2B8GA 3CC2A 1ENFA 3VYUA 3X3MA 1C48A 2XTRA 2QQCA 5EPLA 1K73C 5J39A 3T1YL 5T1GA 4JI6L 4XYOA 1BVSA 1WCMG 5C3XA 1T5XD 3HOUH 5IODA 4DNIA 1MHWC 3E9HA 4KTAA 2DKVA 4A3EG 4A3LG 3TQYA 2WP8J 3I73A 1V1HA 1Q1EA 1VQGA 4YHHL 1R4PB 1PH7A 1ZXTA 4BXXH 1M8BA 4OO1I 1P9ZA 1AE3A 1KDCA 2RVLA 4RWSC 4KD3A 3DEPA 1FGUA 3FHWA 5FO9B 1JR0D 1WTPA 1TUSA 2R93H 2IX0A 1CKMA 1NE3A 5CBAE 1KQSA 3CCUA 2K01A 2VW9A 5AFWA 3TOAA 1SGPI 3K7AH 1E2ZA 9WGAA 1EIHA 1FYBA 4LK1C 1SGNI 1DXMA 1SNMA 2V1CA 1EFWA 4DR2L 2A19A 4QIWB 3JAME 3GV6A 2E2HH 2DNEA 4A3KH 3I4NG 4IUUA 1GUOA 2Q8TA 2KOLA 2L55A 3EIVA 2X69A 2QSBA 3Q0AA 1EYAA 4F8MA 2ALYB 2RDGA 2Z6KA 1R79A 2Y0MA 2B2UA 3MAQA 1STAA 4DV4L 1R9TH 3H09A 1TBOA 4UDUC 1TGSI 2HDMA 2JK8A 2NVXH 2PNHA 2KA7A 1OVOA 1TY0A 3NTIA 4DR5Q 2VB3X 3MEHA 1CHOI 3AYHB 4GNXC 5IOCA 3CHBD 4HIMA 4A3GH 2YYZA 3S2HB 1G51A 1VS0A 5IP9H 1F9RA 3FRPB 3GTJB 3J81E 1SGEI 3K81C 3TS0A 1XBTA 3KYHC 2K32A 1I3QH 1SE8A 4X65Q 1SGQI 4ID6A 5M5XH 1DGSA 3PV0A 5JJKA 3D4DA 3CD6A 2CHBD 2WCYA 2VNUD 3I3CA 1GUSA 1TWHH 3KFUA 2HHHL 1TVXA 2DIPA 5IWAQ 2F4VQ 3FMCA 3FVVA 4A3DB 2FMCA 2HIXA 2WB1B 4HN7A 4HMIA 1QZHA 4JI8Q 2HGKA 3CAMA 4XT3B 3I4LA 3U4VA 5IY0A 1V1PA 1O78A 3RR5A 1NXUA 2BUSA 2QW7A 3OSOA 1E1TA 2K5QA 2G5DA 3H0GB 1PHJA 2N71A 2Q8RE 1BCPF 3P20A 1VQ5A 4A3BH 1TBQR 3HKSA 2PPBC 1Y8FA 2LKVA 2YTYA 3PIP3 4N9TA 1K7TA 1PFBA 2BA1A 2NZHA 1H95A 3I9V1 4E1RA 2ENZA 4FXKC 1JQYD 1KC8C 1S5FD 4RCOA 4B3RL 3TOBA 2E5RA 4DWLA 2L7XA 5BN4A 1HDLA 2RC4A 1XWEA 1Y1VG 1BDOA 2K6AA 4C1NK 3C2PA 1H0ZA 2WVJA 1UE7A 2A1AA 4A3LH 2D0OA 3SK5A 1E3PA 1P8LA 4MTKA 5ELOA 4WFN3 3PO3B 1WCMH 4CJ2C 1VQ8A 2N3SA 1WTRA 4OO1H 3IAS1 3SK4A 3H3VC 3OXLA 3B55A 3HOVG 1FNWA 1X74A 1B3QA 3QOJA 4LAAA 3TS2A 1ESFA 4BBSH 2AWOA 1CK1A 2KEEA 1IYVA 2MFIA 2OTLA 5CC4A 4C2MB 1WKXA 4H13C 5D14A 2OWOA 1X3FA 4X62Q 4DGZA 3CQZH 2IWHA 4A75A 1PRTC 4XTCS 1H9RA 3QWNA 2EY2A 1U4RA 5IP7G 4NKLA 4TQUS 2E2DC 4IPDA 4A3BG 2PYKA 2R92B 4HFVA 1VF7A 1EIGA 2N88A 3QJYA 1VQPA 1LTBD 3RZDB 2K05A 1QVGA 4A3IH 2K50A 4X6AH 2TMPA 4ULLA 1LYLA 4ZLTF 1BKBA 1MKHA 5I2XA 1SYGA 2VZAA 1IHZA 1H9KA 1SYFA 1XYIA 3I8ZA 2NVTH 1MIUA 2F0OA 3SK6A 1WGCA 1ILQA 3D8GA 4PZ6A 3GTJH 1LTAD 2XGTA 5CCMA 4RA8A 3GQBA 1S40A 4OELB 5ELNA 1ET6A 4B3RQ 2CWPA 3M4OH 4LUVA 3MC0B 1SFOB 3C3LA 4BXXG 2FU2A 1W6KA 3S9WA 4FF1A 2C5CA 1WTHA 4DV4Q 4I7AA 4V190 4BBSG 2ICEC 5CV5A 3OMCA 4G76A 3BVMA 1EQRA 2QEJC 5BN5A 5CMDA 4LFBL 2PI2A 1LT4D 3IAM1 2EYPA 2GVAA 5C44B 4EQ5A 2KECA 4F7XA 2YFAA 2A6EC 1VQAA 3KDFB 4K2KA 2F3IA 3HZXA 3HKZG 2EJGC 3UITA 1ET9A 4JV5L 2I0QA 4FNFA 2CAZB 2GVBA 5IYCG 1PXUA 1UUCA 1KNEA 3DLLA 1WD0A 3F8TA 4HJ8A 1ZEQX 3OVOA 3HOWG 2MGSA 3J81L 4GKJQ 4IUVA 3M4OB 5J8CA 5C4JB 5KNCA 1KNAA 2BE5C 2SDFA 5COYA 5D65A 3VA7A 1KDAA 5IYBH 3P7JA 4RG1A 5I9OA 3GTOB 5C4XG 2RHSB 2R7FA 3NUCA 1L1OA 4PV1C 2UXCQ 2KEDA 3R2IA 2ARPF 4DK0A 1PTOC 2EJFC 2F0EA 4YWMA 2IX3A 1E24A 1VQIA 5FJ8H 1CFMA 2A6HD 3RD4A 2KCXA 1D5MC 3GTPB 1HZBA 1IW7D 1KD1C 1ESRA 4JI0Q 2A6HC 4IFDG 2AQ3B 1HFGA 1XPUA 3HOWH 2JXMB 3MFYA 4IFDI 3DXJC 4GOPC 1EY8A 1JWSD 4LF5Q 1X4SA 1X9NA 1MJEA 3A5UA 2KQ3A 1IYUA 1EQTA 1PTOH 4EQPA 4N9PA 5IT9L 1SJ8A 1WCMB 2F0MA 3Q8DA 3Q6SA 1RHPA 2AQ1B 5EQ0A 4DU9A 4R1JA 1A2TA 1VQLA 5HQ8A 2MNAA 2AUKA 3S1NH 2A6ED 2YQPA 4JI3Q 5FJ8G 1FVIA 4XDXA 4ZQ3A 4I1TA 2F0QA 1GVPA 3U4ZA 4OWXB 4PZ7A 1VQEA 1IBKL 4LF9L 1KAWA 3S15B 2F0TA 5IT9c 1RDPD 1EQQA 3IKJA 4HMJA 3TZUA 3CF5A 1O7LA 1PTQA 1F2ZA 1SNQA 3LNNA 3D4RA 1LUZA 1I4PA 3BJIA 1Y14B 4RMFA 1PZID 1BUVT 3WOFA 2IX1A 2NVQH 1V1IA 5LNK1 4MPIA 4DUYL 3STBD 4NXMQ 4M8AA 5ELFA 2ZJPA 1R4QB 2RDFA 2LS01 5IGCA 3OHXC 1TBRR 3PIOA 1AN8A 4HSPA 1KRSA 4G57A 1II3A 3K0YA 1KBEA 1UUPA 2OF1A 1EIYB 5IYBG 3A8JE 2YV5A 1LTGD 1JJCB 4HJ7A 1SGYI 2CWFA 2R61A 1V43A 1WTVA 1QNUA 2NVYH 3VYSA 1HH2P 1PYBA 2K28A 1Q86C 1Q3LA 1O7ZA 2EY6A 1SJED 4AQYL 1DJRD 4KHPL 2EYJA 2B2YC 4IJLA 1HNZQ 4YCVA 5IYDH 3GTKH 3QIAA 4IN3A 2B2TA 2ZJQA 4O42A 4X62L 5IGDA 3S1NB 2IY5B 3SDZA 3AFPA 2H1EA 4KHVA 3E3XA 1O80A 5JEAJ 1IL2A 2UUAQ 3MXGA 3NQIA 3FKIH 5BR8L 1WD1A 2B29A 1LTID 2IW3A 2WB1G 4QJFA 3OW2A 3PO2H 1WI5A 3O13A 3SEKC 4DK1A 5C4ZA 1CUKA 4A3GB 3M4QA 1FL0A 1E7ZA 4DN4M 4J8QA 2K75A 1XNRQ 2D9UA 3RN2A 1OXVA 2Z6BA 1YHAA 2M2LA 1Y1VH 2EYHA 3PCOB 1X3GA 1U4LA 4JC0A 1I3QB 4R4OA 1N34Q 4CGYB 2DN8A 5HGQA 4LF7L 3GTPH 1OMTA 4CKBA 3T13A 2JXDA 1X56A 4P72A 4JCVE 2EVBA 4GZYC 3I4OA 4A3EB 4A3KG 3I90A 1EEFD 4IPCA 1XPOA 1FNVA 5FLMG 5C3EB 1P16A 3J7YW 3KF6A 3GTKB 3TDQA 3BZDB 4UAIA 5KNDA 4LFCQ 3MXNB 4RHSA 3NEMA 4LF7Q 1STYA 1N32L 2R93G 2Z4IA 4S3SA 3VR3A 2R6GA 4R8NA 2E2JB 4Z7HA 2AUJD 4L8JA 4AYBE 4A3GG 2EQSA 2DGYA 5C44G 2M9VA 1UEAB 4CKCA 1PFSA 2RF4A 1T5EA 2HDLA 5CV8A 4PMCA 3ERSX 4BY7H 4P2CB 5LL6S 4PQXA 2LXJA 3HEJA 2BL8A 1NNXA 1XMQL 2RLDA 4G7ZC 2AMCB 2JE6I 3GTGH 2JA7G 1D5ZC 3G71A 2JZMA 3KOJA 4UP8A 3HOZB 4MIUA 3FC3A 4C3HH 1Q9BA 5HGTA 3D00A 3S2DB 1CHPD 1TOTA 1I50H 1SE3A 1STNA 2EIFA 2FFKB 4GLVB 2UUBL 4BS9A 1XPRA 2KMPA 3QO2A 4YY3L 2A8VA 2EYOA 3TREA 2PZWA 1QCBD 2R93B 1UVFA 2DY7A 4C3JG 1G8ZD 4OGQC 1EIFA 3Q22A 1QB5D 1V1OA 4K5VA 1SYEA 3A7LA 3RZOH 5HY6A 4E6IA 2LXKA 2XRCA 1F9QA 3UFFA 4H0LC 2I5MX 4XQQA 4L5RC 1PJUA 2EJMA 2NU1I 1C9OA 4R4IA 5E7NA 3T56B 2JA5G 2NTTA 1DZ1A 4GN5A 3J7AF 5EBCA 4PL4A 1JE5A 3CPFA 3SGBI 4A3IB 5EJWA 1LO5D 2JW6A 4LF9Q 2SGQI 1SNOA 2B2VA 2MO0A 5JPMC 1SDFA 4JI5Q 2JA6B 1EY0A 4YCUA 2N78A 1PRTD 2NU4I 3DEOA 2BCOA 4LF4L 1O7IA 1C8CA 5C0XI 1FYCA 1VQ9A 3I2ZA 5FOBB 1MBYA 1M8CA 4C3IH 1YU6C 3SDJA 4NXML 2R92H 5KYLA 5BN3A 1YIJA 1PH5A 1Y1VB 1QE6A 1KIXA 4U68A 5JAVA 1D6EC 4YIJA 5KIXA 3URYA 1SFOH 1TQOA 1TDPA 2XVSA 1SLJA 4Z7GA 1A0IA 4BY1G 4J1MA 4ZUJA 3GTLH 4PZ8A 3MXNA 4QY7A 5C3EH 3PO2B 1Q8IA 5HI7A 3PIPA 2NTSA 4HCSA 2FMMA 2SGPI 4KY5A 4UY8C 4K5XA 1UE5A 4KKUA 4LUOA 1PTOD 2RIOA 5IGFA 1B53A 2BOSA 1MJAA 2RHQB 4HJ5A 1F2LA 3HOUB 3V96A 3MFGA 4X3UA 1FARA 4OIJA 4DPGA 1JQOA 1STGA 4X64L 4EX5A 4RKBA 3SGIA 3S1RH 4HIOA 2EYLA 3S1QB 3BDCA 4C3IB 2VRWB 5CYUA 1KL9A 1TU2B 1IW4A 3I4NH 3W1GA 3SVMA 4CKEA 2WKCA 2F0UA 4LF5L 4LJZC 1N9WA 3OXGA 2LFNA 1E1OA 3PO3H 4U6RA 4E1PA 1Z47A 2YFBA 2CWGA 4O1NA 3HP3A 2VUMH 2W0TA 3ITPA 1TIID 3S2HH 2OQKA 2PZUA 3CCSA 2Z0SA 4L6TB 1KXLA 2ZRRA 1BMOA 3KF8B 2QGMA 2JEBI 3UE1A 1N33Q 5GAGC 2JQOA 3S16B 4GI3C 5K36H 4DFAA 2MQHA 2K19A 2JA1A 2EOTA 2CKZB 3CCRA 1CA6A 4NXNQ 2X6GA 5D3DA 3V05A 4QL5A 4R8IA 3RNUA 5E1FA 3K5OA 4DR3L 1EY4A 1UE6A 1ZKOA 3JC66 3T1YQ 5ELDA 4AIMA 4C1NI 1Q7YC 3NWTA 1DD2A 2WINB 2ZXPA 3G4SA 1QUQB 2F0JA 3AB9A 3L7ZC 2C35B 2MJ8A 1PTOF 3TP8A 5E3RA 2L9HA 2BH8A 1UHAA 3S1RB 1Y8PB 5T1IA 2F0LA 3P23A 1CT4I 4EGVA 1JWMD 1XX8A 1I5FA 4KV6A 4NV5A 5JJIA 1HJAI 1BBUA 3PUZA 3PUYA 1K7UA 2XRSD 2OCEA 1OMUA 1LT6D 3A5ZB 4C3HG 4KHPQ 4DR6Q 2P6AC 1YBYA 4B3SQ 1V1QA 4ME5A 2JAEA 3R2TA 1Y1WG 2JA7H 2KHSA 5HURA 2PQ8A 1MSHA 2CH4A 5CBEE 2ENNA 4FXDA 2CQAA 1V1PB 1TS3A 2PQEA 2B63G 2JA6H 3HFZB 2JA5H 1GO3E 3VYTA 1K7VA 1EZ8A 3N52A 1PFNA 5I2YA 2UU9Q 2KCTA 2L1BA 1J9OA 3TBIB 1IKLA 1PDQA 2Z4HA 4AYBG 3T4AC 4BBSB 1N36L 3OYYA 1EL0A 4JI0L 2QQ0A 2DNCA 1WJJA 2BA0A 3S1MB 4U673 2LSSA 1LT5D 4DNCA 1I4XA 2JB2A 2KMQA 1GUNA 2Q8IB 1K8OA 1R9TB 1GKHA 4KY6A 3AEVA 3P1HA 1PVOA 5CORA 2DY8A 3BZCA 1D1IA 1EUJA 2I5LX 1UEBA 2K7VA 4WJ3M 5C4JH 4JYAL 1I6VC 3R5CA 2E8GA 1EFID 4RGOS 3RU0A 1XJVA 2OZUA 2B8TA 4NW2A 5FK9C 1SGDI 3VDPA 1OXXK 2E2IH 1F2YA 1CT0I 4BBRB 1OYVI 2KKMA 2QF7A 1SN8A 3KF6B 1IZ6A 5F2DA 4BY1H 3C46A 3PUVA 3MEKA 2A2CA 3JSBA 1W2BA 2UVOA 4B08A 3IFTA 2OXPA 1YJNA 3A8IE 2F3CI 1MT1A 2HT1A 1PFMA 1L1OB 4A3JH 4JV5Q 1VQJA 5C0XH 5EBDA 3ICEA 3CKIB 3KF8A 2RBMA 4GLXA 3K57A 4G75A 5GROA 2RSNA 3ER0A 5J8FA 1CQVA 2WIIB 2WAQE 1OTCA 4OWTB 3LX0A 5LMNQ 1YNJC 2UXDQ 4HAEA 5LMNW 3GTQH 1B9NA 3ND9A 3H0GH 5KRUA 2K9HA 3ULJA 2JA6G 2YTVA 4A3BB 5KNBA 3UDXA 1AN1I 2ZTEA 5GADC 1N32Q 1TR5A 3QTLD 4DXGA 1N13A 1WTOA 2F0IA 5E3FA 4JVZA 5KGUA 4A3CH 3OW7A 1JMCA 3W3AA 1TWGH 3D6WA 3HGBA 2PW7A 2F0FA 1XNRL 1X3PA 5CV4A 1HPCA 4DUYQ 1BXTA 2HD3A 4UP7A 1H9MA 3TZDA 3CC4A 4IOAA 3TMEA 1WTQA 4DV6L 4RGTA 4XIGS 3G48A 3J80L 1YZ6A 5K5PA 2JYOA 4KKSA 3E0JA 5DEHA 3SE0A 1JJGA 2QDBA 3LJ0A 5CV9A 1B7YB 5IGGA 4ALPA 4BA2I 3EN2A 1NY4A 4OAVB 4J15A 3E59A 4TKOB 2PNRC 2F52A 5C5MA 3MZ5A 2VQEQ 1UNSA 4Q0FA 2B2VC 2R7ZG 3MTSA 4WJ4A 3EROA 2UZ3A 3Q23A 4CDEC 5GQOA 1VQOA 1JOKA 3K0XA 1XMOL 1WVLA 3A55A 1BCPC 1SE2A 4DV7L 1ONLA 3MXPA 3UDGA 5JEAH 5CV7A 1H9JA 2GN5A 1BCPD 4FF4A 2F0GA 2D62A 4DV1L 4A76A 3CP0A 1QZGA 1QUQA 2G9DA 3MA2B 3LGJA 3OPOA 1Y69U 5E3QA 2QKIC 3CRKC 4MZ9A 1ULNA 4ZK9B 3QWPA 4UP9A 4K14A 4FP5D 1HCZA 3J7AV 2MPMA 3M3YH 1MJBA 2ROWA 1GD7A 5FLMH 3OWFA 4DR2Q 1EZ6A 3VDUA 4ME3A 1PYSB 1D5XC 4DR6L 4KK7A 4X66Q 5JPNC 5JVG3 4RGMA 5EX0A 1IXRA 4R4QA 1ASYA 5BR8Q 5EKLA 4LFAL 2KENA 3I4MB 4F87A 3ONAB 4IFDJ 1EY7A 3HOYH 2EPBA 1AZQA 1CGII 4DAPA 1IBKQ 1XX6A 3Q24A 5JVH3 2V6EA 2HQLA 4V0BA 5DM63 4A3MG 2EDGA 2N55A 4ZUIA 1I6HB 5EKIA 3I70A 2F1MA 2ICIA 3FVQA 1L0WA 2SGDI 1NMGA 4JI3L 3TP5A 1TWCB 2FJ2A 4IUNA 4GLAC 1L0XB 2JB3A 3GDEA 4DR4L 2CVRA 4C3JB 5FLXL 1CSQA 1IBLQ 4Q9VA 2SNMA 3AQQA 2NN6G 5DM73 5L37A 5DNFA 4JBJA 3I56A 1UVGA 4HCEA 2E2JH 4JBMA 3HKZE 2ZXRA 3FBVA 2XMXA 1EWCA 3HRZC 2HQEA 1NJIC 2LUYA 1TWGB 2JB1A 1EYDA 2PI2E 1HXYD 4QB4A 2UU9L 4BY7G 4QUCA 4DAMA 3TO6A 1HJPA 5M9OA 1N33L 3GTGB 3NELA 5GAEC 3H3VI 2CWAA 1PH2A 1EWHA 5AJ3L 4DR5L 4R4TA 2DB6A 1KDBA 4GKJL 1TY2A 1A15A 2PCFB 2Z8LA 2QZGA 3T1HL 3KBGA 1Q12A 4NV2A 4N8X1 1CHQD 1M4VA 2L12A 3I4MH 1CZWA 1TXYA 3HOWB 5IYCH 2CJSC 1NTGA 2BE5D 2F0PA 2WV6D 4IQZA 3NE5B 3LWEA 4G4KA 4POGA 4TRDA 1FR3A 4K6LA 4DUZQ 2RA4A 2JBWA 2CCZA 1K8MA 4YWLA 4XQNA 4WORA 2QILA 4C3JH 2ODDA 2Q2UA 2B2WA 1DONA 2QCPX 4MHEA 1G2TA 1XXGA 4PL5A 3LWUA 4JBWA 5IE8A 2PQAB 1T9HA 1C0AA 1RTOA 1F2MA 3K58A 3FPUB 4FYDA 1PH4A 3RMHA 1X65A 2V1CC 4P75A 1D2BA 4JI7Q 4X66L 4OXPA 2NU2I 2B2YA 1J8IA 2DUDA 2B2TC 1IW7C 4YY3Q 3SGQI 1B3AA 5LMNL 3PO3G 1LTTD 1CA5A 5FUYA 4ZAIA 4IURA 3W1BA 2CFMA 4QF4A 1EU4A 2Z6KC 3L2PA 1Z7KB 3BS1A 1H9SA 2RQXA 3M9BA 4FXGC 2IP6A 1F9PA 3QOLA 3DA4A 1SNPA 1TS2A 1A3TA 2F0VA 1PCEA 5D3IB 3DMUA 4A3MB 2MP1A 3FEWX 3LJ2A 4OX9Q 5C44H 1B4OA 3D3RA 1VCIA 5I4DA 1I4GA 3J81c 1L0YB 4A3IG 3GTQB 5HGIA 1VQFA 2F0DA 3S2DH 2L4NA 2V4DA 1K0SA 1S72A 3H6MA 5I6WA 4FO2A 1UE1A 4K2LA 1ZYRC 1I94L 4RGNA 4TSSA 2A5HA 3I4MG 5IGEA 1DOKA 3RUZA 2JA5B 4DF7A 3P75A 3NXWA 3HS0C 3HOXB 2HCIA 4DR7L 1AZPA 3NBHA 3RZOB 1JC7A 4NMZA 2B2UC 1ICFB 5C4XH 3QAHA 1PZKD 5FKAC 5EX3A 1AEXA 1RCVD 2UUCL 1FJGQ 1Q90A 3K5LA 3A7AB 1G2SA 3D6CA 2FHTA 2N52A 3W2DA 4K0KL 2JSOA 2XIWA 3A56A 2UXDL 4GOPA 3PO2G 1CT2I 4YCWA 1GM5A 2YU9B 3GOXA 3TP7A 4NB3A 2D2CC 5IGBA 2ZJRA 1RODA 2LMCB 3I91A 4Y7NH 4DR1Q 2AHOB 3BYTB 4JI4L 3S1MH 4BY1B 1QVCA 3F2UA 2NN6I 2PO4A 1C7YA 1W3SA 2QQEA 4NDXA 2UUAL 3X3NA 1M90C 3MWYW 2F0KA 1QVFA 4O1OA 2MJFB 3E0EA 3FSXA 5JJLA 3HH2C 3QB3A 1HHVA 1TIHA 3KY9A 4LWCA 4JG2A 2F4VL 5J22A 2WB1E 4JI4Q 1V8QA 3D4WA 1Q81C 4XT1B 4DXFA 1BO0A 3UDIA 3ZYYX 2O2LD 3QR8A 1JB3A 3PDNA 4LW1A 2ZTDA 3PMFA 1S4ZA 4DV6Q 1U9RA 2F3VA 3UEYA 1NAPA 2ERWA 1OXTA 3K7AB 4DAVA 7WGAA 1KRTA 3DUZA 3CCEA 2IHEA 2K5VA 2KMRA 2YU9H 4IUTA 4AS2A 3C1FA 1G6PA 4OONA 1O7YA 4JOIA 2P22B 4JI7L 4R4CA 1GHJA 5E4XA 3UGLA 2EXDA 4X3KA 3MEFA 4Y52H 1RF2D 1ML0D 1SROA 2JP1A 4ILWA 4NPSA 1YO7A 2NU0I 1RL2A 3UE0A 1X3QA 2LEOA 4DR7Q 5M3MH 3NPPA 2NB0A 3RLFA 2OVOA 5C3EG 1HTPA 3D31A 3IAYA 3AMUA 1HRJA 4GN3B 1VMCA 3SK8A 1GXDC 3PIO3 4A3FG 2H5XA 2L15A 4O0AA 1E0BA 3SR1A 1ENCA 2QEXA 1X54A 3J81j 3CW2C 2KMOA 2XNAC 1BBWA 1L2FA 3HOVH 2JA7B 3NTHA 3KUPA 1ENAA 1VQKA 4Y7NB 4KJOA 3GTMH 1IY6A 2ZXOA 4QCLA 4SGBI 2XWJB 3W5OA 4XQJA 4A4IA 2OEOA 1SGRI 2RADA 1PH8A 2RIJA 4H44C 2D0PA 2Z1CA 3EJIA 2N17A 3I55A 4O1PA 3BDOA 1QWYA 2KHJA 2NBFA 3GD7A 5M5YH 1GJXA 3A74A 2R7DA 1R0RI 2KJXA 2SOBA 1AP0A 1JWUD 1EU3A 4LFAQ 4JI2Q 4UXJA 1LT3D 1VQ4A 4FVMA 4IUQA 3J80c 3TO9A 1HNWL 3I4NB 2EE1A 1NBWA 3L0IA 1K0RA 2HIVA 1HA6A 2Y0SB 2N49A 1MI2A 3DO9A 4HSVA 1ASZA 4GN4B 5JOBA 4B3SL 2BL7A 4NXNL 1S5ED 1TWFB 2RCNA 5M5WH 2D5DA 4DKAC 3DWPA 1OXUA 3MXUA 1XTDA 1S5CD 2JJQA 4KLKA 1ULKA 4HR7B 1A3UA 1SE4A 3GTMB 3RLOA 4CBVA 4YHHQ 3NWSA 2E73A 1V9PA 1K3RA 2SEBD 1SSOA 3ERQA 3CCQA 1A2UA 1SYBA 3EBEA 2Q2HA 3F1ZA 1Z2IA 2X52A 1TS4A 1DOLA 1P9GA 2P5ZX 4JI1Q 3NK9A 2K14A 2PZTA 1PRTB 1U4MA 5A2QE 3WOEA 4LF6L 4A3FH 3H94A 4DNRB 2FINB 3UOEA 1YVCA 4PNYA 1K8GA 5IYDG 2GKRI 4GXTA 5M3MG 1YJWA 2VQEL 2F0WA 3PQIA 1SJHD 4K5WA 3M3YB 3K59A 3STBC 4QUFA 1L1OC 4HEA1 3K6OA 2FNFX 2E5LQ 1SRUA 1TWAH 4OHJA 2JEAI 4OAUC 4ODGA 1XTCD 4JW0A 2EY5A 2XRQD 3BDLA 3DWAA 4KHZA 1RFHA 3R5BA 2E76C 2FXQA 1PLFA 1GUTA 4PMBA 4QIWE 4YZCA 4YWKA 4DAYB 1JORA 2NU3I 3VDYA 1WTWA 3I72A 4TVAB 1MJCA 3MVVA 4A93B 4ZRZA 1TKWB 1LR7A 2AKWB 1SYDA 1X55A 3CCVA 1KLUD 4RAUC 2R7ZB 4DNTB 4B3MQ 1JB7A 3F2CA 1IYJB 1K28A 3U50C 5ISRA 3GTOH 1I50B 1FNUA 4K6DA 1KABA 1U4PA 2F4IA 3R5AA 4A3MH 1WTJA 1VQ7A 3CRLC 3KLWA 4LF6Q 2J0TD 1GHKA 2PMZB 3NQTA 3MHBA 3EVQA 4DR4Q 3FPPA 3QG1A 3OXFA 2CQOA 4IPGA 2JN4A 5I6YA 2Q2IA 4DK3C 3G6EA 1K83B 5CGKA 1U5KA 5FLXE 2K4KA 5DLQE 2O4XA 4GS3A 4P74A 4FF3A 5KEEA 3VR5A 4B3TQ 2UXBL 4GNXA 1B70B 5M3MB 1NUBA 4FKDA 2LB7A 2B63H 3M7GA 4CDFC 1J5EQ 5IP7H 1Z9FA 3L3OC 2PMZE 3EQLC 2F03A 2K5HA 3F2BA 2K04A 1NMFA 2K33A 4K8IA 4KJNA 4ZYSA 1UAPA 5IP9G 5CCLA 2QGQA 1PTRA 1YNND 3VE5A 2I46A 1LR8A 1KBFA 1H9SB 1HFNA 1PZJD 4QQBX 1BR9A 4IFDH 4DV2L 1HNZL 4AS3A 1DYQA 1STBA 4OO1G 2IT1A 2J9RA 3WWVA 1N8RC 2VB2X 4A3KB 3OL0A 5A2QL 1LABA 2XN9C 4M1UB 3IL8A 1A62A 2F0SA 3M4YA 3H15A 2BH2A 1BUSA 5IIFA 2GIVA 4DV3Q 5IT9E 1JOOA 2Y0SG 3JAMc 2C9OA 1IBML 3VA9A 1Y1BA 1HZAA 2RDHA 5LMUQ 3SEBA 4UXIA 1HQMC 3CQZB 4C56C 3H91A 1YI2A 4RHRA 1XMOQ 2NVYB 2QA4A 2TSSA 2ASBA 1YEZA 4UXHA 2VS1A 3S1QH 2PQAA 1AW7A 3KLRA 5C5LA 1CM9A 4FDBA 2QQDA 1K83H 4IO9A 1PTOB 1PH1A 1I6HH 3PSIA 3A54A 5LMUL 1Q82C 1ICWA 5FLXc 3KK7A 5NUCA 3DM1A 1PYWD 3HG9A 1OXSC 3U9SA 3J7A5 2JA8G 1E2WA 5LL6X 1KMAA 3UDFA 3FKIB 3GO5A 4KMUC 3H3VH 1IL8A 1B50A 4KN7C 1EOVA 1NUCA 3IFDA 2NVTB 1LTSD 3DHQA 1VDDA 1QG7A 2HUGA 4YZ9A 3UI2A 2ORWA 4A3FB 1EYCA 1CKNB 3KP9A 1JE4A 4JYAQ 1I4QA 4AQYQ 2EZVA 3IRBA 4A3DH 3VR4A 3OIPA 3NP8A 1PPFI 3CMEA 2F0NA 1NR4A 1XNQL 1I94Q 2A20A 4K0KQ 3F2DA 4N8FA 1SMYC 2B2WC 1F77A 2DJGC 2XWBB 4ZKCB 3B4VC 2IL8A 2SNSA 1SEBD 1Z6HA 1JCKB 1HA5A 2F0HA 2GSCA 2ZM6Q 3UEJA 1BOSA 3DA3A 2SGFI 2RSOA 3WDNA 3E2IA 4WRDA 1SNCA 3FSYA 1DM0B 2N8NA 1J5EL 2NUCA 4GNXB 3S16H 2I5HA 4IUPA 4Q5VA 3JAML 1RD9D 3G6JB 2R7ZH 3BVZA 3NBIA 2WACA 4CJ1B 4HIKA 4BY7B 3R5DA 1B44D 2NVQB 2X3TA 2IHFA 4CDDC 2WKDA 3JAMi 4A3CG 1KLGD 3S14B 1C4QA 2GKVA 1TT2A 4DAYA 1BBXC 1Y1CA 5EAYA 4DV5Q 1UWVA 2CW0D 1A8VA 1B9MA 1NCVA 2K5WA 3PUWA 1HQRD 2NWGA 5FUWA 4F88A 2VQFL 4LUZA 3ND8A 4CJ0B 5JJZA 3BYYB 3CXLA 1GUGA 2O5IC 5FUVA 2OD1A 3K80C 3GV3A 2DJFC 4NP5A 4I65A 4IJHA 1HR0L
chains in the Genus database with same CATH topology
1O7IA 1I3QH 1SE8A 2DUDA 2JA9A 3NBHB 4YY3Q 4X65Q 1SGQI 3SGQI 5M5XH 5LMNL 1DGSA 3PO3G 5C0XI 3PV0A 2E5LL 5JJKA 1VQ9A 3I2ZA 3CD6A 5FUYA 3CPWA 3W1BA 2WCYA 1JJ2A 2VNUD 2CFMA 1HZ9A 2Z6KC 4C3IH 1M8CA 3L2PA 3SDJA 1YU6C 4NXML 2R92H 1Z7KB 1N36Q 3M9BA 3BZKA 1YIJA 1PH5A 1TWHH 3KFUA 2IP6A 1KIXA 2QQ0A 3DA4A 1SR3A 1PCEA 2HHHL 2DIPA 5IWAQ 4GKKL 1SFOH 1TWCH 4LFAL 1SLJA 4Z7GA 1A0IA 4BY1G 3LJ2A 4OX9Q 5C44H 2HIXA 1QZHA 4LF8L 4JI8Q 3GTLH 1VCIA 1A63A 4PZ8A 3CAMA 4QY7A 3U4VA 5IY0A 3J81c 2F6MB 3OTOQ 5C3EH 2B3GA 3RR5A 4A3IG 2BUSA 2UXBQ 5HGIA 1E1TA 1VQFA 3PIPA 5HI7A 2ORVA 4P73A 1PHJA 2N71A 5CCMA 3S2DH 1S72A 1VQ5A 4IPHA 4A3BH 2SGPI 1VQ6A 4UY8C 1UE1A 3HKSA 3NENA 5AJ3Q 1I94L 1TBQR 2YTXA 3I4MG 1UE5A 1Y8FA 2KHIA 4LUOA 2YTYA 4A3JG 2RIOA 4L9MA 2BA1A 2NZHA 1H95A 3I9V1 4E1RA 1FJGL 2ENZA 2RHQB 4HJ5A 2J87A 3PGZA 4DV3L 1KC8C 1D8LA 3PF5A 1FARA 4DPGA 4B3RL 1DS2I 4BA1I 2E5RA 4DWLA 4X64L 4DR7L 2L7XA 4EX5A 1HDLA 3SGIA 3S1RH 4HIOA 2GKTI 3U58A 1Y1VG 2VUMG 5C4XH 5H1SE 2VRWB 5EX3A 1HR0W 1YHBA 1FJGQ 1KL9A 1WYDA 2UUCL 1H0ZA 1IW4A 2WVJA 1UE7A 2A1AA 3I4NH 4A3DG 4A3LH 3W1GA 2N52A 1VQDA 4K0KL 2D0OA 4LF5L 3HOUG 1E3PA 1P8LA 5ELOA 2UXDL 2JYYA 4DUZL 4GOPA 1WCMH 4DR3Q 3A0JA 3PO2G 1N9WA 1VQ8A 4YCWA 2N3SA 1PH3A 1GM5A 3IAS1 4JBKA 1CT2I 4GKKQ 5IWAL 3OXLA 1E1OA 2NZOA 3PO3H 3OXGA 4U6RA 4NB3A 3HOVG 4E1PA 1Z47A 1X74A 1TWFH 3M85A 2YFBA 3TS2A 1Y1WH 2ZJRA 1VQCA 4BBSH 1CKNA 2VUMH 2W0TA 1EYGA 4DR1Q 4Y7NH 2AWOA 2AHOB 1M1KC 3S2HH 4JI4L 3S1MH 4YZDA 2OQKA 2MFIA 2VL6A 4JOIC 2OTLA 3CCSA 1QVCA 2Z0SA 2OWOA 1X3FA 2NN6I 1KXLA 1C7YA 1W3SA 2L1LB 2ZRRA 2WFWA 4X62Q 1LM0A 3KF8B 3CQZH 2UUAL 4A75A 2JEBI 1BMOA 1M90C 4JI6Q 3UE1A 1N33Q 1QVFA 3CCJA 4XTCS 5GAGC 4B3TL 4O1OA 2MJFB 2JQOA 3E0EA 5IP7G 3UGDA 5JJLA 3HH2C 2QPOA 4GI3C 1LR9A 4TQUS 1TIHA 3KY9A 1IBLL 2MQHA 4LWCA 4JG2A 2F4VL 2K19A 1VQBA 2WB1E 4IPDA 4L5QA 1Q81C 4JI4Q 4A3BG 2JA1A 2CKZB 1PV4A 3UDIA 4HFVA 1VQPA 1YNXA 4DV7Q 3PDNA 4LW1A 3CCRA 1QVGA 4A3IH 2ZTDA 4NXNQ 3K8AA 4LF8Q 1YHQA 2K50A 4DV6Q 3B6YA 3RZDH 4QL5A 4QGUA 4X6AH 3RNUA 3M7NA 4A24A 4B6DA 3UEYA 1LYLA 4O2DA 1BKBA 1MKHA 5M3FH 4DR3L 1OXTA 2ERWA 1UE6A 3JC66 3T1YQ 1KRTA 4PG3A 1DS3I 4AIMA 3CCEA 2IHEA 2K5VA 3F4MA 2VZAA 1Q7YC 2YU9H 1X3EA 2KMRA 3S24A 4AS2A 4LF4Q 4OWWB 3G4SA 1G6PA 4OVOA 3FC3A 1QUQB 3L7ZC 4OONA 1WOCA 2C35B 4JOIA 3ULPA 2P22B 1B8AA 1MIUA 4R4CA 4JI7L 2NVTH 4BBRH 2EXDA 2BH8A 5K36G 3UGLA 4PZ6A 3MEFA 3GTJH 3P23A 4Y52H 1SROA 2XGTA 4NPSA 1XNQQ 2XTIA 1CT4I 1YO7A 1CGJI 1RL2A 3UE0A 1YJ9A 2NU0I 1I5FA 2LEOA 1S40A 4X64Q 4DR7Q 5ELNA 5M3MH 3S15H 4NV5A 2CWPA 3J80i 3RLFA 5C3EG 3HOYG 4LUVA 4DK6C 3M4OH 4B3RQ 5JJIA 1HJAI 3D31A 1BBUA 3PUZA 1XA6A 3PUYA 2OCEA 4GN3B 3CCMA 2F66B 3A5ZB 4POFA 4BXXG 4KHPQ 1OMUA 4DR6Q 4A3FG 2M5XA 2P6AC 1YBYA 2H5XA 4DV4Q 1AE2A 2L15A 4B3SQ 4P71A 1V1QA 4O0AA 2YUUA 4BBSG 4A3EH 2JAEA 4DV5L 1Y1WG 2QEXA 4JI8L 1X54A 2JA7H 3J81j 3PF4A 3CW2C 1Y1BA 2KMOA 1BBWA 1L2FA 3HOVH 4G76A 1EQRA 1LTLA 2OQ0A 4LFBL 2VY3A 2ENNA 2PI2A 3IAM1 2R92G 2VQFQ 1VQKA 1TBNA 2GVAA 2K5NA 2SGEI 2B63G 2JA6H 4EQ5A 3GTMH 3AFQA 2UXCL 3H0GG 3HFZB 2JA5H 1GO3E 4LFCL 1IY6A 4SGBI 3W5OA 4A4IA 2YFAA 1SGRI 2UU9Q 1VQAA 1PH8A 3KDFB 2F3IA 2KCTA 3HOXH 1AH9A 4DR1L 3HKZG 4JI1L 2D0PA 2N17A 3I55A 4O1PA 1KHIA 4AYBG 3UITA 1CKOA 3OYYA 2KHJA 5M5YH 1N36L 3GD7A 2I0QA 1WJJA 3CC7A 4JI0L 2BA0A 2R7DA 2CAZB 3A74A 1R0RI 2GVBA 3LJ1A 5IYCG 1UUCA 2LSSA 4LFAQ 4JI2Q 4UXJA 4C2MH 3DLLA 1VQ4A 2JB2A 2KMQA 3F8TA 3J80c 4HJ8A 4LFBQ 3HOWG 1HNWL 3OVOA 4B3ML 4GKJQ 1NBWA 1U0LA 3L0IA 1K0RA 2HIVA 1HZCA 1GKHA 3AEVA 3UGIA 1PVOA 2N49A 3DO9A 1ASZA 3BZCA 1EWIA 4JI5L 1EUJA 2I5LX 2ZTCA 4GN4B 1K8AC 4B3SL 1UEBA 4DV1Q 2F4VQ 2J9RA 2KCMA 4WJ3M 5C4JH 1XMQQ 4NXNL 2ATWA 4JYAL 2E8GA 2RCNA 5IYBH 5M5WH 4RG1A 3RU0A 5M3FG 1XJVA 4DKAC 2B8TA 2XTQA 4GOPB 1SGDI 3VDPA 1OXUA 1OXXK 4HIDA 5C4XG 2RHSB 1XTDA 2JJQA 2E2IH 4KLKA 2R7FA 1CT0I 5J3BA 1OYVI 2KKMA 1L1OA 3CCLA 3HOXG 1SN8A 3KF6B 1IZ6A 2UXCQ 4BY1H 2ARPF 4DV2Q 3PUVA 3MEKA 3I7FA 3RLOA 2A2CA 1W4RA 3JSBA 1W2BA 4YHHQ 2E73A 1V9PA 4YWMA 3CMAA 1K3RA 1E24A 1YJNA 2UUBQ 1VQIA 5FJ8H 3CCQA 2F3CI 2KCXA 1MT1A 3EBEA 2HT1A 2N1AB 2Q2HA 3F1ZA 1HZBA 1KD1C 3KDFA 1L1OB 4A3JH 1HPTA 4JI0Q 4JV5Q 1VQJA 4PL3A 4IOCA 4IFDG 1XPUA 3ICEA 3FKIG 3HOWH 4JI1Q 4GLXA 4IFDI 2K14A 4GOPC 4APVA 1X4SA 4G75A 4LF5Q 1X9NA 1HNXQ 1N32L 1MJEA 4LF6L 4A3FH 3M4PA 2A2DA 3ER0A 5GROA 3A5UA 1TURA 2JA8H 2WAQE 2V53A 1OTCA 4OWTB 2UUCQ 3AJFA 3TRZA 3RLNA 1YVCA 1SJ8A 1K8GA 5IYDG 5LMNQ 1K9MC 3S14H 3Q8DA 4GXTA 5M3MG 2VQEL 1YJWA 2UXDQ 2GKRI 5LMNW 3GTQH 2ROWA 4R1JA 3H0GH 3L0OA 3STBC 3RN5A 4MNOA 3ULJA 1VQLA 2JA6G 1L1OC 2YTVA 4HEA1 2K9HA 2MNAA 5HQ8A 3UDXA 2E5LQ 2ZTEA 3S1NH 1AN1I 2FNFX 5GADC 1SRUA 1TWAH 4JI3Q 2JEAI 1N32Q 2L8EA 4OAUC 2YQPA 5FJ8G 1N13A 3QTLD 1FVIA 4UPAA 4KI0A 1PH9A 4I1TA 4KHZA 1RFHA 1GVPA 1Q8KA 2FXQA 1WFQA 4A3CH 5C0XJ 1JMCA 1TWGH 3E9IA 4QIWE 3U4ZA 4YZCA 4YWKA 4OWXB 4DAYB 1XNRL 2QQEA 2ES2A 2NU3I 4PZ7A 1VQEA 3VDYA 1IBKL 1KAWA 4LF9L 5JHWC 5IT9c 3ZJYC 4DUYQ 1X6OA 1MJCA 4TVAB 1EQQA 1J6QA 4UP7A 3KJOA 3CC4A 4IOAA 3CF5A 1LR7A 1PTQA 2OTJA 2AKWB 2FUG1 1X55A 1LUZA 3CCVA 3BJIA 3TEHB 1Y14B 4RMFA 4DV6L 1VQHA 5GAHC 4XIGS 3G48A 1HNXL 4B3MQ 1IY5A 1JB7A 1HNWQ 3F2CA 1YZ6A 1IYJB 1HR0Q 3U50C 2IX1A 2NVQH 3GTOH 5LNK1 1V1IA 4JI2L 4DV0Q 4DUYL 3STBD 2MO1A 2AWNA 4NXMQ 4A3MH 1JJGA 1CE3A 3LJ0A 1VQ7A 3KLWA 1B7YB 1Q1BA 2ZJPA 4ALPA 4LF6Q 4BA2I 4A93G 3HOZH 3EN2A 1NY4A 4OAVB 4DR4Q 4J15A 1TBRR 3PIOA 3E59A 3OXFA 2CQOA 4IPGA 1KRSA 2F52A 2ID0A 2Q2IA 4DK3C 3G6EA 2VQEQ 1U5KA 1KBEA 2K4KA 5DAEA 5DLQE 3J81i 2R7ZG 4WJ4A 4GS3A 4P74A 1EIYB 2UZ3A 2GVIA 5IYBG 4B3TQ 2UXBL 2K52A 5GQOA 2YV5A 4GNXA 1VQOA 3FP9A 3K0XA 1XMOL 1B70B 1JJCB 4X65L 4HJ7A 1SGYI 4HJ9A 4DV7L 1NUBA 4FKDA 2B63H 3UDGA 4LNQA 1J5EQ 1N34L 1V43A 5IP7H 1Z9FA 2NVYH 2GN5A 1HH2P 1PYBA 4MTNA 2B0UC 4HGUA 2PMZE 1Q86C 2K5HA 4PMWA 4AQYL 4KHPL 3D0FA 3F2BA 4IJLA 1HNZQ 4YCVA 5IYDH 1NMFA 3GTKH 2D62A 4DV1L 4A76A 2Y0SE 3CP0A 2ZJQA 1QZGA 1QUQA 3LGJA 4X62L 1VQMA 2HHHQ 5IP9G 2IY5B 1JT8A 5CCLA 3AFPA 2ZM6L 2QGQA 4MZ9A 1PTRA 3VE5A 1FAQA 1LR8A 1KBFA 3QWPA 4UP9A 2WAQG 4QQBX 2JXDA 5JEAJ 1IL2A 5C0XG 3OTOL 2UUAQ 1VQNA 4DV2L 3FKIH 5BR8L 4AS3A 1HNZL 3ULLA 5JEAG 1IBMQ 2B29A 3M3YH 4OO1G 2IT1A 4BBRG 2WB1G 4QJFA 1GD7A 3WWVA 5FLMH 3OW2A 1WI5A 1CSPA 1N8RC 3PO2H 3SEKC 4DR2Q 3VDUA 4ME3A 1CSOI 1PYSB 1CUKA 1E22A 3OL0A 4DR6L 3M4QA 1A62A 1FL0A 1RIPA 1E7ZA 4X66Q 5FUXA 3H15A 4HJAA 1S3OA 2K75A 2Q2TA 4H02A 2BH2A 1BUSA 4DV3Q 5EX0A 1PH6A 1IXRA 1XNRQ 4R4QA 3RN2A 1OXVA 1YHAA 2Y0SG 3J7ZC 1Y1VH 5BR8Q 3JAMc 3VA9A 2KENA 1IBML 3PCOB 1X3GA 1HZAA 3DM3A 4JC0A 4R4OA 5LMUQ 1N34Q 5HGQA 4LF7L 3GTPH 4UXIA 3HOZG 1OMTA 4A93H 4IFDJ 4JV5L 1YI2A 3HOYH 1X56A 1XMOQ 2QA4A 1D7QA 1CGII 1SMXA 4JCVE 4P72A 1IBKQ 1XX6A 3I4OA 2V6EA 2HQLA 3K7UC 4A3KG 1PA6A 2ASBA 3CXCA 4IPCA 4A3MG 1XPOA 1YEZA 3PUXA 2VS1A 3S1QH 4UXHA 5FLMG 1P16A 2PQAA 1YTPA 3KF6A 4LFCQ 4FDBA 1L0WA 2QQDA 3MXNB 3NEMA 1K83H 4L5TA 4DV0L 4IO9A 1PH1A 1YITA 1I6HH 2ELIA 2SGDI 3PSIA 1NMGA 4JI3L 5LMUL 1Q82C 4LF7Q 4OX9L 4GLAC 5FLXc 1ASYA 2JB3A 3GDEA 4DR4L 1G291 1Q46A 1CSQA 1IBLQ 3BU2A 4Q9VA 2R6GA 3T1HQ 1OXSC 4L5SA 3J7A5 2JA8G 3AQQA 2KBNA 2NN6G 3KJPA 3S17H 3UDFA 1KMAA 4Z7HA 3BJUA 3GO5A 4JBJA 4AH6A 3I56A 3H3VH 4AYBE 4A3GG 2EQSA 2DGYA 5C44G 1UVGA 2E2JH 4JBMA 3HKZE 1EOVA 3CC2A 2OVOA 3FBVA 1PFSA 2RF4A 2XMXA 2XTRA 1VDDA 4YZ9A 3ERSX 4BY7H 2QQCA 1NJIC 1K73C 2LUYA 3T1YL 2JB1A 4JI6L 1CKNB 2ORWA 1BVSA 1WCMG 3HOUH 2LXJA 2PI2E 3KP9A 4DNIA 2UU9L 4BY7G 1XMQL 4JYAQ 4AQYQ 3E9HA 3IRBA 4DAMA 4A3EG 2AMCB 4A3LG 3TQYA 4A3DH 2JE6I 3GTGH 1HJPA 2WP8J 3G71A 2JA7G 2R93G 1V1HA 1Q1EA 2JZMA 3KOJA 4UP8A 1N33L 1VQGA 4YHHL 3CMEA 1PPFI 1XNQL 3NELA 5GAEC 1PH7A 2CWAA 1PH2A 4C3HH 5AJ3L 4DR5L 1I94Q 3H3VI 4BXXH 3F2DA 4R4TA 4K0KQ 4OO1I 1M8BA 2A20A 3D00A 1AE3A 2DB6A 1TOTA 1I50H 1FGUA 2EIFA 3FHWA 4GLVB 2UUBL 1XPRA 2KMPA 4GKJL 1TUSA 2R93H 2IX0A 3B4VC 1CKMA 4YY3L 1NE3A 2A8VA 3TREA 3CCUA 1KQSA 2VW9A 3UEJA 2ZM6Q 3T1HL 1SGPI 3DA3A 1Q12A 4NV2A 3K7AH 1FYBA 2SGFI 1UVFA 1SGNI 2NU4I 1EFWA 3I4MH 2V1CA 4DR2L 3E2IA 2A19A 2N8NA 1EIFA 2E2HH 4A3KH 1J5EL 1TXYA 4GNXB 5IYCH 3I4NG 3S16H 2I5HA 2CJSC 3RZOH 1NTGA 5HY6A 2R7ZH 2LXKA 2XRCA 3EIVA 3UFFA 4POGA 4HIKA 2I5MX 4DUZQ 4L5RC 1PJUA 2NU1I 2IHFA 1C9OA 2ALYB 2Z6KA 4R4IA 3JAMi 4A3CG 1R79A 2CCZA 5E7NA 4DV4L 1R9TH 2JA5G 4YWLA 1TBOA 2GKVA 3TJQA 1TGSI 4GN5A 4C3JH 2ODDA 2JK8A 2NVXH 2PNHA 2Q2UA 1Y1CA 4PL4A 5EAYA 1OVOA 4DV5Q 1UWVA 4DR5Q 1A8VA 1JE5A 1CHOI 4PL5A 3AYHB 4JBWA 4GNXC 3CPFA 5IE8A 2PQAB 3PUWA 5FUWA 1T9HA 3SGBI 2VQFL 1C0AA 4LUZA 4HIMA 3CXLA 2JW6A 4A3GH 2YYZA 4LF9Q 1PH4A 1G51A 2SGQI 5FUVA 1VS0A 1X65A 5IP9H 2V1CC 2OD1A 3K80C 2MO0A 4P75A 4JI5Q 4JI7Q 4YCUA 2N78A 3GOXA 4X66L 3K81C 3TS0A 4IJHA 4OXPA 1SGEI 3KYHC 1XBTA 4LF4L 2NU2I 1HR0L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7I A;  1I3Q H;  1SE8 A;  2DUD A;  2JA9 A;  3NBH B;  4YY3 Q;  4X65 Q;  5M5X H;  5LMN L;  1DGS A;  3PO3 G;  5C0X I;  3PV0 A;  2E5L L;  5JJK A;  1VQ9 A;  3I2Z A;  3CD6 A;  3CPW A;  3W1B A;  1JJ2 A;  2VNU D;  2CFM A;  1HZ9 A;  2Z6K C;  4C3I H;  3L2P A;  4NXM L;  2R92 H;  1N36 Q;  3M9B A;  3BZK A;  1YIJ A;  1PH5 A;  1TWH H;  3KFU A;  1KIX A;  1SR3 A;  2HHH L;  5IWA Q;  4GKK L;  1SFO H;  1TWC H;  4LFA L;  1SLJ A;  1A0I A;  4BY1 G;  4OX9 Q;  5C44 H;  2HIX A;  1QZH A;  4LF8 L;  4JI8 Q;  3GTL H;  1VCI A;  1A63 A;  4PZ8 A;  3CAM A;  4QY7 A;  3U4V A;  5IY0 A;  3J81 c;  3OTO Q;  5C3E H;  2B3G A;  3RR5 A;  4A3I G;  2UXB Q;  1E1T A;  1VQF A;  3PIP A;  4P73 A;  1PHJ A;  3S2D H;  1S72 A;  1VQ5 A;  4IPH A;  4A3B H;  1VQ6 A;  4UY8 C;  1UE1 A;  3HKS A;  3NEN A;  5AJ3 Q;  1I94 L;  2YTX A;  3I4M G;  1UE5 A;  2KHI A;  4LUO A;  2YTY A;  4A3J G;  2BA1 A;  2NZH A;  1H95 A;  1FJG L;  2RHQ B;  4HJ5 A;  3PGZ A;  4DV3 L;  1KC8 C;  1D8L A;  3PF5 A;  4DPG A;  4B3R L;  4BA1 I;  4X64 L;  4DR7 L;  4EX5 A;  3SGI A;  3S1R H;  4HIO A;  3U58 A;  1Y1V G;  2VUM G;  5C4X H;  5H1S E;  1HR0 W;  1YHB A;  1FJG Q;  1KL9 A;  1WYD A;  2UUC L;  1UE7 A;  2A1A A;  3I4N H;  4A3D G;  4A3L H;  3W1G A;  1VQD A;  4K0K L;  2D0O A;  4LF5 L;  3HOU G;  1E3P A;  1P8L A;  5ELO A;  2UXD L;  4DUZ L;  4GOP A;  1WCM H;  4DR3 Q;  3A0J A;  3PO2 G;  1N9W A;  1VQ8 A;  4YCW A;  2N3S A;  1PH3 A;  1GM5 A;  4JBK A;  5IWA L;  1E1O A;  2NZO A;  3PO3 H;  3HOV G;  4NB3 A;  1Z47 A;  1TWF H;  3M85 A;  3TS2 A;  1Y1W H;  2ZJR A;  1VQC A;  4BBS H;  1CKN A;  2VUM H;  1EYG A;  4DR1 Q;  4Y7N H;  2AWO A;  2AHO B;  1M1K C;  3S2H H;  4JI4 L;  3S1M H;  2OQK A;  2MFI A;  2VL6 A;  4JOI C;  2OTL A;  3CCS A;  1QVC A;  2Z0S A;  2OWO A;  1X3F A;  2NN6 I;  1KXL A;  1C7Y A;  1W3S A;  4X62 Q;  2WFW A;  1LM0 A;  3KF8 B;  3CQZ H;  2UUA L;  4A75 A;  2JEB I;  1M90 C;  4JI6 Q;  3UE1 A;  1N33 Q;  1QVF A;  3CCJ A;  4XTC S;  5GAG C;  4B3T L;  2JQO A;  3E0E A;  5IP7 G;  5JJL A;  4TQU S;  1IBL L;  2MQH A;  4LWC A;  4JG2 A;  2F4V L;  1VQB A;  2WB1 E;  4IPD A;  4L5Q A;  1Q81 C;  4JI4 Q;  4A3B G;  2CKZ B;  1PV4 A;  3UDI A;  1VQP A;  1YNX A;  4DV7 Q;  4LW1 A;  3CCR A;  1QVG A;  4A3I H;  2ZTD A;  4NXN Q;  3K8A A;  4LF8 Q;  1YHQ A;  2K50 A;  4DV6 Q;  3B6Y A;  3RZD H;  4QL5 A;  4QGU A;  4X6A H;  3RNU A;  3M7N A;  1LYL A;  4O2D A;  1BKB A;  1MKH A;  5M3F H;  4DR3 L;  1OXT A;  1UE6 A;  3JC6 6;  3T1Y Q;  1KRT A;  4PG3 A;  4AIM A;  3CCE A;  2IHE A;  2K5V A;  2VZA A;  1Q7Y C;  2YU9 H;  1X3E A;  3S24 A;  4OWW B;  4LF4 Q;  3G4S A;  1G6P A;  1QUQ B;  3L7Z C;  4OON A;  1WOC A;  2C35 B;  4JOI A;  3ULP A;  1MIU A;  1B8A A;  4R4C A;  4JI7 L;  2NVT H;  5K36 G;  4BBR H;  2EXD A;  2BH8 A;  4PZ6 A;  3MEF A;  3GTJ H;  4Y52 H;  1SRO A;  2XGT A;  4NPS A;  1XNQ Q;  2XTI A;  1RL2 A;  3UE0 A;  1YJ9 A;  1I5F A;  1S40 A;  4X64 Q;  4DR7 Q;  5ELN A;  5M3M H;  3S15 H;  4B3R Q;  2CWP A;  3J80 i;  3RLF A;  5C3E G;  3HOY G;  4LUV A;  4DK6 C;  3M4O H;  5JJI A;  3D31 A;  1BBU A;  3PUZ A;  3PUY A;  2OCE A;  4GN3 B;  3CCM A;  3A5Z B;  4POF A;  4BXX G;  4KHP Q;  4DR6 Q;  4A3F G;  1YBY A;  2H5X A;  4DV4 Q;  1AE2 A;  2L15 A;  4B3S Q;  4P71 A;  1V1Q A;  4O0A A;  4BBS G;  4A3E H;  3PF4 A;  4DV5 L;  1Y1W G;  2QEX A;  4JI8 L;  1X54 A;  2JA7 H;  3J81 j;  3CW2 C;  1BBW A;  1L2F A;  3HOV H;  1EQR A;  1LTL A;  2OQ0 A;  4LFB L;  2VY3 A;  2PI2 A;  2R92 G;  2VQF Q;  1VQK A;  2GVA A;  2K5N A;  2B63 G;  2JA6 H;  4EQ5 A;  3GTM H;  3AFQ A;  2UXC L;  3H0G G;  3HFZ B;  2JA5 H;  1GO3 E;  4LFC L;  3W5O A;  4A4I A;  2UU9 Q;  1VQA A;  1PH8 A;  3KDF B;  2F3I A;  2KCT A;  3HOX H;  1AH9 A;  4DR1 L;  3HKZ G;  4JI1 L;  2D0P A;  3I55 A;  1KHI A;  4AYB G;  1CKO A;  3OYY A;  2KHJ A;  5M5Y H;  1N36 L;  3GD7 A;  2I0Q A;  1WJJ A;  3CC7 A;  4JI0 L;  2BA0 A;  2R7D A;  3A74 A;  2GVB A;  5IYC G;  2LSS A;  4LFA Q;  4JI2 Q;  4C2M H;  3DLL A;  1VQ4 A;  3F8T A;  3J80 c;  4HJ8 A;  4LFB Q;  3HOW G;  1HNW L;  4B3M L;  4GKJ Q;  1NBW A;  1U0L A;  1K0R A;  2HIV A;  1HZC A;  1GKH A;  3AEV A;  1PVO A;  2N49 A;  4GKK Q;  1ASZ A;  3BZC A;  1EWI A;  4JI5 L;  1EUJ A;  2I5L X;  2ZTC A;  4GN4 B;  1K8A C;  4B3S L;  1UEB A;  4DV1 Q;  2F4V Q;  2KCM A;  4WJ3 M;  5C4J H;  1XMQ Q;  4NXN L;  2ATW A;  4JYA L;  2E8G A;  2RCN A;  5IYB H;  5M5W H;  4RG1 A;  5M3F G;  1XJV A;  4DKA C;  4GOP B;  1OXU A;  1OXX K;  4HID A;  5C4X G;  2RHS B;  1XTD A;  2JJQ A;  2E2I H;  4KLK A;  2R7F A;  5J3B A;  1L1O A;  3CCL A;  3HOX G;  1SN8 A;  3KF6 B;  1IZ6 A;  2UXC Q;  4BY1 H;  4DV2 Q;  3PUV A;  3I7F A;  3RLO A;  1W2B A;  4YHH Q;  1V9P A;  4YWM A;  3CMA A;  1K3R A;  1E24 A;  1YJN A;  2UUB Q;  1VQI A;  5FJ8 H;  3CCQ A;  3EBE A;  2HT1 A;  2Q2H A;  3F1Z A;  1HZB A;  1KD1 C;  3KDF A;  1L1O B;  4A3J H;  4JI0 Q;  4JV5 Q;  1VQJ A;  4IOC A;  4IFD G;  1XPU A;  3ICE A;  3FKI G;  3HOW H;  4JI1 Q;  4GLX A;  4IFD I;  2K14 A;  4GOP C;  4APV A;  4LF5 Q;  1X9N A;  1HNX Q;  1MJE A;  4LF6 L;  4A3F H;  3M4P A;  5GRO A;  3ER0 A;  3A5U A;  2JA8 H;  2WAQ E;  1OTC A;  4OWT B;  2UUC Q;  3TRZ A;  3RLN A;  1YVC A;  1K8G A;  5IYD G;  5LMN Q;  1K9M C;  3S14 H;  3Q8D A;  5M3M G;  1YJW A;  2VQE L;  2UXD Q;  5LMN W;  3GTQ H;  4R1J A;  3H0G H;  3L0O A;  3STB C;  3RN5 A;  4MNO A;  3ULJ A;  1VQL A;  2JA6 G;  1L1O C;  2YTV A;  2MNA A;  3UDX A;  2E5L Q;  2ZTE A;  3S1N H;  5GAD C;  1SRU A;  1TWA H;  4JI3 Q;  2JEA I;  1N32 Q;  5FJ8 G;  1FVI A;  4UPA A;  4KI0 A;  1PH9 A;  4KHZ A;  1GVP A;  1Q8K A;  2FXQ A;  1WFQ A;  4A3C H;  5C0X J;  1JMC A;  1TWG H;  3E9I A;  4QIW E;  3U4Z A;  4YWK A;  4OWX B;  4DAY B;  1XNR L;  2ES2 A;  4PZ7 A;  1VQE A;  3VDY A;  1IBK L;  1KAW A;  4LF9 L;  5IT9 c;  3ZJY C;  4DUY Q;  1X6O A;  1MJC A;  4TVA B;  1EQQ A;  1J6Q A;  4UP7 A;  3KJO A;  3CC4 A;  4IOA A;  3CF5 A;  2OTJ A;  2AKW B;  1X55 A;  1LUZ A;  3CCV A;  3TEH B;  1Y14 B;  4RMF A;  4DV6 L;  1VQH A;  5GAH C;  4XIG S;  3G48 A;  1HNX L;  4B3M Q;  1JB7 A;  1HNW Q;  3F2C A;  1YZ6 A;  1IYJ B;  1HR0 Q;  3U50 C;  2IX1 A;  2NVQ H;  3GTO H;  4JI2 L;  4DV0 Q;  4DUY L;  3STB D;  2MO1 A;  2AWN A;  4NXM Q;  4A3M H;  1JJG A;  1VQ7 A;  3KLW A;  1B7Y B;  1Q1B A;  2ZJP A;  4ALP A;  4LF6 Q;  4BA2 I;  4A93 G;  3HOZ H;  3EN2 A;  1NY4 A;  4DR4 Q;  4J15 A;  3PIO A;  2CQO A;  4IPG A;  1KRS A;  2F52 A;  2ID0 A;  2Q2I A;  4DK3 C;  3G6E A;  2VQE Q;  1U5K A;  2K4K A;  5DLQ E;  3J81 i;  2R7Z G;  4WJ4 A;  4GS3 A;  4P74 A;  1EIY B;  5IYB G;  4B3T Q;  2UXB L;  2K52 A;  5GQO A;  2YV5 A;  4GNX A;  1VQO A;  3FP9 A;  3K0X A;  1XMO L;  1B70 B;  1JJC B;  4X65 L;  4HJ7 A;  4HJ9 A;  4DV7 L;  2B63 H;  3UDG A;  4LNQ A;  1J5E Q;  1N34 L;  1V43 A;  5IP7 H;  1Z9F A;  2NVY H;  2GN5 A;  1HH2 P;  1PYB A;  4MTN A;  2PMZ E;  1Q86 C;  2K5H A;  4PMW A;  4AQY L;  4KHP L;  3D0F A;  3F2B A;  4IJL A;  1HNZ Q;  4YCV A;  5IYD H;  1NMF A;  3GTK H;  2D62 A;  4DV1 L;  4A76 A;  2Y0S E;  3CP0 A;  2ZJQ A;  1QZG A;  1QUQ A;  3LGJ A;  4X62 L;  1VQM A;  2HHH Q;  5IP9 G;  2IY5 B;  1JT8 A;  3AFP A;  2ZM6 L;  2QGQ A;  4MZ9 A;  4UP9 A;  2WAQ G;  4QQB X;  5JEA J;  1IL2 A;  5C0X G;  3OTO L;  2UUA Q;  1VQN A;  4DV2 L;  3FKI H;  5BR8 L;  1HNZ L;  1IBM Q;  3ULL A;  5JEA G;  3M3Y H;  2B29 A;  4OO1 G;  2IT1 A;  4BBR G;  2WB1 G;  4QJF A;  1GD7 A;  3WWV A;  5FLM H;  3OW2 A;  1WI5 A;  1CSP A;  1N8R C;  3PO2 H;  4DR2 Q;  4ME3 A;  1PYS B;  1CUK A;  1E22 A;  4DR6 L;  3M4Q A;  1A62 A;  1FL0 A;  1RIP A;  1E7Z A;  4X66 Q;  3H15 A;  4HJA A;  1S3O A;  2K75 A;  2Q2T A;  4H02 A;  2BH2 A;  4DV3 Q;  1PH6 A;  1IXR A;  1XNR Q;  4R4Q A;  3RN2 A;  1OXV A;  1YHA A;  2Y0S G;  3J7Z C;  1Y1V H;  5BR8 Q;  3JAM c;  1IBM L;  2KEN A;  1ASY A;  3PCO B;  1X3G A;  1HZA A;  3DM3 A;  4JC0 A;  4R4O A;  5LMU Q;  1N34 Q;  5HGQ A;  4LF7 L;  3GTP H;  3HOZ G;  4A93 H;  4IFD J;  4JV5 L;  1YI2 A;  3HOY H;  1X56 A;  1XMO Q;  2QA4 A;  1D7Q A;  1SMX A;  4JCV E;  4P72 A;  1IBK Q;  3I4O A;  2HQL A;  3K7U C;  4A3K G;  1PA6 A;  2ASB A;  3CXC A;  4IPC A;  4A3M G;  1XPO A;  1YEZ A;  3PUX A;  2VS1 A;  3S1Q H;  5FLM G;  1P16 A;  2PQA A;  3KF6 A;  4LFC Q;  4FDB A;  1L0W A;  3MXN B;  3NEM A;  1K83 H;  4L5T A;  4DV0 L;  4IO9 A;  1PH1 A;  1YIT A;  1I6H H;  3PSI A;  1NMG A;  4JI3 L;  5LMU L;  1Q82 C;  4LF7 Q;  4OX9 L;  4GLA C;  5FLX c;  1N32 L;  3GDE A;  4DR4 L;  1G29 1;  1Q46 A;  1CSQ A;  1IBL Q;  3BU2 A;  2R6G A;  3T1H Q;  4L5S A;  1OXS C;  3J7A 5;  2JA8 G;  3AQQ A;  2KBN A;  2NN6 G;  3KJP A;  3S17 H;  3UDF A;  3BJU A;  3GO5 A;  4JBJ A;  4AH6 A;  3I56 A;  3H3V H;  4AYB E;  4A3G G;  2EQS A;  2DGY A;  5C44 G;  2E2J H;  4JBM A;  3HKZ E;  1EOV A;  3CC2 A;  1PFS A;  2RF4 A;  3ERS X;  4BY7 H;  1NJI C;  1K73 C;  3T1Y L;  4JI6 L;  1CKN B;  1BVS A;  1WCM G;  3HOU H;  2LXJ A;  2PI2 E;  4DNI A;  2UU9 L;  4BY7 G;  1XMQ L;  4JYA Q;  4AQY Q;  3E9H A;  3IRB A;  4DAM A;  4A3E G;  2AMC B;  4A3L G;  3TQY A;  4A3D H;  2JE6 I;  3GTG H;  1HJP A;  2WP8 J;  3G71 A;  2JA7 G;  2R93 G;  1Q1E A;  3KOJ A;  4UP8 A;  1N33 L;  1VQG A;  4YHH L;  3CME A;  1XNQ L;  3NEL A;  5GAE C;  1PH7 A;  2CWA A;  1PH2 A;  4C3H H;  5AJ3 L;  4DR5 L;  1I94 Q;  3H3V I;  4BXX H;  3F2D A;  4R4T A;  4K0K Q;  4OO1 I;  1AE3 A;  1I50 H;  1FGU A;  2EIF A;  3FHW A;  4GLV B;  2UUB L;  1XPR A;  4GKJ L;  2R93 H;  2IX0 A;  1CKM A;  4YY3 L;  1NE3 A;  2A8V A;  3TRE A;  3CCU A;  1KQS A;  2VW9 A;  2ZM6 Q;  3T1H L;  1Q12 A;  3K7A H;  1EFW A;  3I4M H;  4DR2 L;  2A19 A;  2N8N A;  1EIF A;  2E2H H;  4A3K H;  1J5E L;  1TXY A;  4GNX B;  5IYC H;  3I4N G;  3S16 H;  2I5H A;  3RZO H;  1NTG A;  5HY6 A;  2R7Z H;  2LXK A;  3EIV A;  4POG A;  4HIK A;  2I5M X;  4DUZ Q;  4L5R C;  2IHF A;  1C9O A;  2ALY B;  2Z6K A;  4R4I A;  3JAM i;  4A3C G;  2CCZ A;  5E7N A;  4DV4 L;  1R9T H;  2JA5 G;  4YWL A;  4GN5 A;  4C3J H;  2JK8 A;  2NVX H;  2PNH A;  2Q2U A;  5EAY A;  4DV5 Q;  1UWV A;  4DR5 Q;  1A8V A;  1JE5 A;  3AYH B;  4JBW A;  4GNX C;  3CPF A;  5IE8 A;  2PQA B;  3PUW A;  1T9H A;  2VQF L;  1C0A A;  4LUZ A;  4HIM A;  4A3G H;  2YYZ A;  4LF9 Q;  1PH4 A;  1G51 A;  1VS0 A;  1X65 A;  5IP9 H;  2V1C C;  3K80 C;  2MO0 A;  4P75 A;  4JI5 Q;  4JI7 Q;  4YCU A;  2N78 A;  4X66 L;  3K81 C;  3TS0 A;  4IJH A;  4OXP A;  3KYH C;  4LF4 L;  1HR0 L; 
#chains in the Genus database with same CATH topology
 3S17 B;  2JA9 A;  2LY7 A;  3NBH B;  2VUM B;  2E5L L;  4XYQ A;  1SYC A;  3CPW A;  1JJ2 A;  1HZ9 A;  1A3V A;  4XXE A;  1VF5 C;  4EQN A;  1N36 Q;  3BZK A;  1HTL D;  4C3H B;  3BVG A;  1SR3 A;  2L11 A;  4GKK L;  1TWC H;  3E5S A;  4LF8 L;  4FF2 A;  1A63 A;  1D1K A;  3OTO Q;  1CQF A;  2F6M B;  2B3G A;  2UXB Q;  2ORV A;  4P73 A;  4MN3 A;  3HOV B;  4IPH A;  1VQ6 A;  2CW0 C;  3OMG A;  2G9H D;  3NEN A;  5AJ3 Q;  1WGT A;  2YTX A;  5CR3 A;  1JOQ A;  2KHI A;  5M3F B;  4A3J G;  1X32 A;  4L9M A;  5EPK A;  1FJG L;  1CTM A;  2J87 A;  3PGZ A;  3T53 B;  4DV3 L;  1A6X A;  1D8L A;  3PF5 A;  1S5D D;  4WP4 A;  1DS2 I;  4BA1 I;  3SXH A;  5FO7 B;  3R8B A;  4JK1 C;  2GKT I;  1CI3 M;  1PRT F;  3OIQ A;  3T51 B;  3U58 A;  1HEV A;  2VUM G;  5H1S E;  2MHV A;  1QIL A;  2RCF A;  1HR0 W;  1YHB A;  1WYD A;  4B9W A;  1ILP A;  4A3D G;  4K8J A;  1VQD A;  3HOU G;  2J4X A;  2JYY A;  1WTX A;  4DUZ L;  2CH4 W;  4DR3 Q;  3A0J A;  1FD7 D;  1PH3 A;  4JBK A;  5IWA L;  2NZO A;  2ZT9 C;  2AQ2 B;  1TWF H;  3NSW A;  4B9X A;  3M85 A;  4EQO A;  1Y1W H;  2ZW3 A;  1VQC A;  1G6Z A;  1CKN A;  1QJO A;  4A3J B;  1EYG A;  4IAL A;  2NN6 H;  1M1K C;  2WGC A;  4CHT B;  4YZD A;  2VL6 A;  4JOI C;  2I07 B;  2L1L B;  3TJQ A;  2WFW A;  4EVO A;  1LM0 A;  3DWQ A;  4JI6 Q;  3CCJ A;  4B3T L;  3OOC A;  3UGD A;  5EGT A;  1JIC A;  3J80 E;  1LR9 A;  2QPO A;  1IBL L;  4KD4 A;  1KAA A;  1VQB A;  4L5Q A;  2HCC A;  4HED A;  1I4H A;  1PV4 A;  3VYR A;  5KYI A;  1YNX A;  2F3W A;  4R9W A;  4DV7 Q;  1NR2 A;  2A69 C;  2CWH A;  2OT2 A;  3K8A A;  4DA2 A;  1YHQ A;  4LF8 Q;  3B6Y A;  3RZD H;  4QGU A;  4B6D A;  3AU7 A;  3M7N A;  4A24 A;  4O2D A;  5C3W A;  5M3F H;  4PG3 A;  1BNZ A;  1DS3 I;  4RCN A;  2BDO A;  3F4M A;  1X3E A;  2A68 D;  3S24 A;  4OWW B;  4LF4 Q;  4OVO A;  5M5X B;  1WOC A;  1HPT A;  3TP6 A;  3ULP A;  1B8A A;  4UHV A;  4OIK A;  5K36 G;  1EOT A;  4BBR H;  1HUM A;  1XNQ Q;  2XTI A;  2O5J C;  1CGJ I;  1YJ9 A;  3KLS X;  4X64 Q;  3S15 H;  3HOY G;  3J80 i;  1EY5 A;  5DAU A;  4DK6 C;  2EY1 A;  1XA6 A;  3CCM A;  2F66 B;  4POF A;  1HUN A;  2M5X A;  1Y8N B;  1AE2 A;  4P71 A;  3SHL A;  2YUU A;  5I9P A;  4A3E H;  4DV5 L;  3PF4 A;  4JI8 L;  2NZ1 D;  2JA8 B;  2OQ0 A;  1LTL A;  2VY3 A;  2K03 A;  2R92 G;  2VQF Q;  1TBN A;  2K5N A;  2SGE I;  1S5B D;  4I7Z C;  3AFQ A;  2UXC L;  3H0G G;  1VMP A;  1MJ9 A;  2FEF A;  4LFC L;  1EEI D;  3K5N A;  4Z9C B;  3HOX H;  1AH9 A;  5EPJ A;  4DR1 L;  4JI1 L;  1KHI A;  1BCP B;  1CKO A;  3BG3 A;  3CC7 A;  1PMR A;  1RKN A;  3LJ1 A;  1B1Z A;  5C4X B;  1SXT A;  1G91 A;  4C2M H;  1W6J A;  5ELB A;  4LFB Q;  3E6Z X;  5LHY 1;  2EYF A;  4B3M L;  1U0L A;  3NHH A;  1HZC A;  3UGI A;  4RH6 A;  3GTL B;  4GKK Q;  3HOY B;  4JI5 L;  1EWI A;  2E75 C;  3A8K E;  2ZTC A;  5FO8 B;  1K8A C;  3TSS A;  1ZYR D;  3T16 A;  4DV1 Q;  5M5W B;  2KCM A;  1XMQ Q;  2ATW A;  1YNJ D;  3FDT A;  5M3F G;  2XTQ A;  4GOP B;  4HID A;  2A68 C;  5J3B A;  3CCL A;  3HOX G;  2B8F A;  4DV2 Q;  1SAP A;  3I7F A;  2M00 A;  1W4R A;  3HKZ B;  3CMA A;  2UUB Q;  2H4O A;  2IJ0 A;  3L9A X;  2N1A B;  1Y1W B;  3KDF A;  2Z9H A;  1BF4 A;  4IOC A;  4PL3 A;  1FY7 A;  3FKI G;  4KY7 A;  1Z7T A;  1TWH B;  4APV A;  1M8A A;  2J7Z A;  5J1Z A;  1HNX Q;  1MSG A;  3OWE B;  3M4P A;  2A2D A;  1TUR A;  2JA8 H;  2V53 A;  2UUC Q;  3AJF A;  2PW5 A;  3RLN A;  3TRZ A;  2A74 C;  3K5M A;  3S14 H;  1K9M C;  4RFB A;  1SND A;  1Y8O B;  2K5D A;  5C6A A;  3L0O A;  3RN5 A;  4MNO A;  1VDZ A;  2GA4 B;  1K3B C;  5E3P A;  5C4H A;  3C1E A;  2L8E A;  1S20 A;  4UPA A;  4KI0 A;  1PH9 A;  1TWA B;  1LAC A;  3VR6 A;  1Q8K A;  4L63 B;  1WFQ A;  1OO9 B;  5C0X J;  3E9I A;  4HTH A;  2E74 C;  2ES2 A;  5JHW C;  3VR2 A;  3ZJY C;  1X6O A;  2VXW A;  1J6Q A;  3U9O A;  2E2H B;  3KJO A;  2B39 A;  3G7L A;  1NSN S;  2OTJ A;  5M5Y B;  2FUG 1;  3VA5 A;  3TEH B;  1VQH A;  5GAH C;  1HNX L;  1IY5 A;  1HNW Q;  3CU7 A;  1HR0 Q;  1STH A;  2WAQ B;  1RJT A;  1LTR D;  4JI2 L;  1E2V A;  2R3Z A;  1DOM A;  4DV0 Q;  2E2I B;  1LV9 A;  2AWN A;  2MO1 A;  1CE3 A;  1Q1B A;  1KTK A;  4BWG B;  4A93 G;  2MUY A;  5A35 A;  2KUM A;  3HOZ H;  2ETD A;  4OL7 A;  5ELE A;  1SMY D;  1DCZ A;  2ID0 A;  2A69 D;  4J6H A;  5DAE A;  3J81 i;  5G3L F;  2GVI A;  5TSS A;  2K52 A;  3FP9 A;  2B63 B;  1ULM A;  4AYB B;  4X65 L;  4HJ9 A;  2OU2 A;  5EKK A;  4LNQ A;  1N34 L;  1GUW A;  4C3I G;  4QMG A;  4MTN A;  2QDL A;  2B0U C;  4HGU A;  4PMW A;  3TN2 A;  2K1B A;  3D0F A;  3R3O A;  2KVM A;  1LLR D;  2NVX B;  5ELC A;  2L5T A;  4CDC C;  2BDN A;  2Y0S E;  3GP7 A;  4KKT A;  1AFP A;  1VQM A;  2HHH Q;  4X3S A;  1JT8 A;  2ZM6 L;  3N6R A;  3EFX D;  4OEM B;  1MGS A;  1TS5 A;  1FAQ A;  2A73 B;  2X6L A;  4RKL A;  3R93 A;  2WAQ G;  1BQQ T;  1QOH A;  5C0X G;  3OTO L;  1VQN A;  1IBM Q;  1GOZ A;  3ULL A;  5JEA G;  4BBR G;  1F9S A;  1FGB D;  2EYM A;  1CSP A;  4LMQ D;  2L0C A;  2IPK D;  1CSO I;  4IZ8 A;  5CV6 A;  1E22 A;  1RIP A;  3EA6 A;  3NTK A;  4H7B A;  2XSC A;  5FUX A;  4HJA A;  2Q2T A;  1MD2 D;  1S3O A;  1QNK A;  4H02 A;  1IKM A;  1PH6 A;  3J7Z C;  1I4R A;  4WJW A;  3DM3 A;  1EY6 A;  3HOZ G;  4KN4 C;  4A93 H;  2EXZ A;  1EY9 A;  1D7Q A;  1SMX A;  2NYZ D;  1STE A;  3K7U C;  1PA6 A;  3CXC A;  4G7H C;  1SBB B;  3FNB A;  2ENB A;  3PUX A;  1YTP A;  1RTN A;  4X3T A;  4ZCK A;  2KCN A;  1B2T A;  4G7O C;  4L5T A;  4DV0 L;  2ELI A;  4AML A;  1YIT A;  4OX9 L;  2KCC A;  1G29 1;  3KLS A;  1Q46 A;  1CT1 D;  3BU2 A;  4JPB W;  3T1H Q;  4L5S A;  3TO7 A;  3KBX A;  4ABN A;  1CZG A;  1YNN C;  2RKS A;  2KBN A;  5E4W C;  4ZKB B;  3KJP A;  3S17 H;  3BJU A;  4AH6 A;  5G3L D;  1EQV A;  3V2T A;  2B8G A;  3CC2 A;  1ENF A;  3VYU A;  3X3M A;  1C48 A;  2XTR A;  2QQC A;  5EPL A;  1K73 C;  5J39 A;  3T1Y L;  5T1G A;  4JI6 L;  4XYO A;  1BVS A;  1WCM G;  5C3X A;  1T5X D;  3HOU H;  5IOD A;  4DNI A;  1MHW C;  3E9H A;  4KTA A;  2DKV A;  4A3E G;  4A3L G;  3TQY A;  2WP8 J;  3I73 A;  1V1H A;  1Q1E A;  1VQG A;  4YHH L;  1R4P B;  1PH7 A;  1ZXT A;  4BXX H;  1M8B A;  4OO1 I;  1P9Z A;  1AE3 A;  1KDC A;  2RVL A;  4RWS C;  4KD3 A;  3DEP A;  1FGU A;  3FHW A;  5FO9 B;  1JR0 D;  1WTP A;  1TUS A;  2R93 H;  2IX0 A;  1CKM A;  1NE3 A;  5CBA E;  1KQS A;  3CCU A;  2K01 A;  2VW9 A;  5AFW A;  3TOA A;  1SGP I;  3K7A H;  1E2Z A;  9WGA A;  1EIH A;  1FYB A;  4LK1 C;  1SGN I;  1DXM A;  1SNM A;  2V1C A;  1EFW A;  4DR2 L;  2A19 A;  4QIW B;  3JAM E;  3GV6 A;  2E2H H;  2DNE A;  4A3K H;  3I4N G;  4IUU A;  1GUO A;  2Q8T A;  2KOL A;  2L55 A;  3EIV A;  2X69 A;  2QSB A;  3Q0A A;  1EYA A;  4F8M A;  2ALY B;  2RDG A;  2Z6K A;  1R79 A;  2Y0M A;  2B2U A;  3MAQ A;  1STA A;  4DV4 L;  1R9T H;  3H09 A;  1TBO A;  4UDU C;  1TGS I;  2HDM A;  2JK8 A;  2NVX H;  2PNH A;  2KA7 A;  1OVO A;  1TY0 A;  3NTI A;  4DR5 Q;  2VB3 X;  3MEH A;  1CHO I;  3AYH B;  4GNX C;  5IOC A;  3CHB D;  4HIM A;  4A3G H;  2YYZ A;  3S2H B;  1G51 A;  1VS0 A;  5IP9 H;  1F9R A;  3FRP B;  3GTJ B;  3J81 E;  1SGE I;  3K81 C;  3TS0 A;  1XBT A;  3KYH C;  2K32 A;  1I3Q H;  1SE8 A;  4X65 Q;  1SGQ I;  4ID6 A;  5M5X H;  1DGS A;  3PV0 A;  5JJK A;  3D4D A;  3CD6 A;  2CHB D;  2WCY A;  2VNU D;  3I3C A;  1GUS A;  1TWH H;  3KFU A;  2HHH L;  1TVX A;  2DIP A;  5IWA Q;  2F4V Q;  3FMC A;  3FVV A;  4A3D B;  2FMC A;  2HIX A;  2WB1 B;  4HN7 A;  4HMI A;  1QZH A;  4JI8 Q;  2HGK A;  3CAM A;  4XT3 B;  3I4L A;  3U4V A;  5IY0 A;  1V1P A;  1O78 A;  3RR5 A;  1NXU A;  2BUS A;  2QW7 A;  3OSO A;  1E1T A;  2K5Q A;  2G5D A;  3H0G B;  1PHJ A;  2N71 A;  2Q8R E;  1BCP F;  3P20 A;  1VQ5 A;  4A3B H;  1TBQ R;  3HKS A;  2PPB C;  1Y8F A;  2LKV A;  2YTY A;  3PIP 3;  4N9T A;  1K7T A;  1PFB A;  2BA1 A;  2NZH A;  1H95 A;  3I9V 1;  4E1R A;  2ENZ A;  4FXK C;  1JQY D;  1KC8 C;  1S5F D;  4RCO A;  4B3R L;  3TOB A;  2E5R A;  4DWL A;  2L7X A;  5BN4 A;  1HDL A;  2RC4 A;  1XWE A;  1Y1V G;  1BDO A;  2K6A A;  4C1N K;  3C2P A;  1H0Z A;  2WVJ A;  1UE7 A;  2A1A A;  4A3L H;  2D0O A;  3SK5 A;  1E3P A;  1P8L A;  4MTK A;  5ELO A;  4WFN 3;  3PO3 B;  1WCM H;  4CJ2 C;  1VQ8 A;  2N3S A;  1WTR A;  4OO1 H;  3IAS 1;  3SK4 A;  3H3V C;  3OXL A;  3B55 A;  3HOV G;  1FNW A;  1X74 A;  1B3Q A;  3QOJ A;  4LAA A;  3TS2 A;  1ESF A;  4BBS H;  2AWO A;  1CK1 A;  2KEE A;  1IYV A;  2MFI A;  2OTL A;  5CC4 A;  4C2M B;  1WKX A;  4H13 C;  5D14 A;  2OWO A;  1X3F A;  4X62 Q;  4DGZ A;  3CQZ H;  2IWH A;  4A75 A;  1PRT C;  4XTC S;  1H9R A;  3QWN A;  2EY2 A;  1U4R A;  5IP7 G;  4NKL A;  4TQU S;  2E2D C;  4IPD A;  4A3B G;  2PYK A;  2R92 B;  4HFV A;  1VF7 A;  1EIG A;  2N88 A;  3QJY A;  1VQP A;  1LTB D;  3RZD B;  2K05 A;  1QVG A;  4A3I H;  2K50 A;  4X6A H;  2TMP A;  4ULL A;  1LYL A;  4ZLT F;  1BKB A;  1MKH A;  5I2X A;  1SYG A;  2VZA A;  1IHZ A;  1H9K A;  1SYF A;  1XYI A;  3I8Z A;  2NVT H;  1MIU A;  2F0O A;  3SK6 A;  1WGC A;  1ILQ A;  3D8G A;  4PZ6 A;  3GTJ H;  1LTA D;  2XGT A;  5CCM A;  4RA8 A;  3GQB A;  1S40 A;  4OEL B;  5ELN A;  1ET6 A;  4B3R Q;  2CWP A;  3M4O H;  4LUV A;  3MC0 B;  1SFO B;  3C3L A;  4BXX G;  2FU2 A;  1W6K A;  3S9W A;  4FF1 A;  2C5C A;  1WTH A;  4DV4 Q;  4I7A A;  4V19 0;  4BBS G;  2ICE C;  5CV5 A;  3OMC A;  4G76 A;  3BVM A;  1EQR A;  2QEJ C;  5BN5 A;  5CMD A;  4LFB L;  2PI2 A;  1LT4 D;  3IAM 1;  2EYP A;  2GVA A;  5C44 B;  4EQ5 A;  2KEC A;  4F7X A;  2YFA A;  2A6E C;  1VQA A;  3KDF B;  4K2K A;  2F3I A;  3HZX A;  3HKZ G;  2EJG C;  3UIT A;  1ET9 A;  4JV5 L;  2I0Q A;  4FNF A;  2CAZ B;  2GVB A;  5IYC G;  1PXU A;  1UUC A;  1KNE A;  3DLL A;  1WD0 A;  3F8T A;  4HJ8 A;  1ZEQ X;  3OVO A;  3HOW G;  2MGS A;  3J81 L;  4GKJ Q;  4IUV A;  3M4O B;  5J8C A;  5C4J B;  5KNC A;  1KNA A;  2BE5 C;  2SDF A;  5COY A;  5D65 A;  3VA7 A;  1KDA A;  5IYB H;  3P7J A;  4RG1 A;  5I9O A;  3GTO B;  5C4X G;  2RHS B;  2R7F A;  3NUC A;  1L1O A;  4PV1 C;  2UXC Q;  2KED A;  3R2I A;  2ARP F;  4DK0 A;  1PTO C;  2EJF C;  2F0E A;  4YWM A;  2IX3 A;  1E24 A;  1VQI A;  5FJ8 H;  1CFM A;  2A6H D;  3RD4 A;  2KCX A;  1D5M C;  3GTP B;  1HZB A;  1IW7 D;  1KD1 C;  1ESR A;  4JI0 Q;  2A6H C;  4IFD G;  2AQ3 B;  1HFG A;  1XPU A;  3HOW H;  2JXM B;  3MFY A;  4IFD I;  3DXJ C;  4GOP C;  1EY8 A;  1JWS D;  4LF5 Q;  1X4S A;  1X9N A;  1MJE A;  3A5U A;  2KQ3 A;  1IYU A;  1EQT A;  1PTO H;  4EQP A;  4N9P A;  5IT9 L;  1SJ8 A;  1WCM B;  2F0M A;  3Q8D A;  3Q6S A;  1RHP A;  2AQ1 B;  5EQ0 A;  4DU9 A;  4R1J A;  1A2T A;  1VQL A;  5HQ8 A;  2MNA A;  2AUK A;  3S1N H;  2A6E D;  2YQP A;  4JI3 Q;  5FJ8 G;  1FVI A;  4XDX A;  4ZQ3 A;  4I1T A;  2F0Q A;  1GVP A;  3U4Z A;  4OWX B;  4PZ7 A;  1VQE A;  1IBK L;  4LF9 L;  1KAW A;  3S15 B;  2F0T A;  5IT9 c;  1RDP D;  1EQQ A;  3IKJ A;  4HMJ A;  3TZU A;  3CF5 A;  1O7L A;  1PTQ A;  1F2Z A;  1SNQ A;  3LNN A;  3D4R A;  1LUZ A;  1I4P A;  3BJI A;  1Y14 B;  4RMF A;  1PZI D;  1BUV T;  3WOF A;  2IX1 A;  2NVQ H;  1V1I A;  5LNK 1;  4MPI A;  4DUY L;  3STB D;  4NXM Q;  4M8A A;  5ELF A;  2ZJP A;  1R4Q B;  2RDF A;  2LS0 1;  5IGC A;  3OHX C;  1TBR R;  3PIO A;  1AN8 A;  4HSP A;  1KRS A;  4G57 A;  1II3 A;  3K0Y A;  1KBE A;  1UUP A;  2OF1 A;  1EIY B;  5IYB G;  3A8J E;  2YV5 A;  1LTG D;  1JJC B;  4HJ7 A;  1SGY I;  2CWF A;  2R61 A;  1V43 A;  1WTV A;  1QNU A;  2NVY H;  3VYS A;  1HH2 P;  1PYB A;  2K28 A;  1Q86 C;  1Q3L A;  1O7Z A;  2EY6 A;  1SJE D;  4AQY L;  1DJR D;  4KHP L;  2EYJ A;  2B2Y C;  4IJL A;  1HNZ Q;  4YCV A;  5IYD H;  3GTK H;  3QIA A;  4IN3 A;  2B2T A;  2ZJQ A;  4O42 A;  4X62 L;  5IGD A;  3S1N B;  2IY5 B;  3SDZ A;  3AFP A;  2H1E A;  4KHV A;  3E3X A;  1O80 A;  5JEA J;  1IL2 A;  2UUA Q;  3MXG A;  3NQI A;  3FKI H;  5BR8 L;  1WD1 A;  2B29 A;  1LTI D;  2IW3 A;  2WB1 G;  4QJF A;  3OW2 A;  3PO2 H;  1WI5 A;  3O13 A;  3SEK C;  4DK1 A;  5C4Z A;  1CUK A;  4A3G B;  3M4Q A;  1FL0 A;  1E7Z A;  4DN4 M;  4J8Q A;  2K75 A;  1XNR Q;  2D9U A;  3RN2 A;  1OXV A;  2Z6B A;  1YHA A;  2M2L A;  1Y1V H;  2EYH A;  3PCO B;  1X3G A;  1U4L A;  4JC0 A;  1I3Q B;  4R4O A;  1N34 Q;  4CGY B;  2DN8 A;  5HGQ A;  4LF7 L;  3GTP H;  1OMT A;  4CKB A;  3T13 A;  2JXD A;  1X56 A;  4P72 A;  4JCV E;  2EVB A;  4GZY C;  3I4O A;  4A3E B;  4A3K G;  3I90 A;  1EEF D;  4IPC A;  1XPO A;  1FNV A;  5FLM G;  5C3E B;  1P16 A;  3J7Y W;  3KF6 A;  3GTK B;  3TDQ A;  3BZD B;  4UAI A;  5KND A;  4LFC Q;  3MXN B;  4RHS A;  3NEM A;  4LF7 Q;  1STY A;  1N32 L;  2R93 G;  2Z4I A;  4S3S A;  3VR3 A;  2R6G A;  4R8N A;  2E2J B;  4Z7H A;  2AUJ D;  4L8J A;  4AYB E;  4A3G G;  2EQS A;  2DGY A;  5C44 G;  2M9V A;  1UEA B;  4CKC A;  1PFS A;  2RF4 A;  1T5E A;  2HDL A;  5CV8 A;  4PMC A;  3ERS X;  4BY7 H;  4P2C B;  5LL6 S;  4PQX A;  2LXJ A;  3HEJ A;  2BL8 A;  1NNX A;  1XMQ L;  2RLD A;  4G7Z C;  2AMC B;  2JE6 I;  3GTG H;  2JA7 G;  1D5Z C;  3G71 A;  2JZM A;  3KOJ A;  4UP8 A;  3HOZ B;  4MIU A;  3FC3 A;  4C3H H;  1Q9B A;  5HGT A;  3D00 A;  3S2D B;  1CHP D;  1TOT A;  1I50 H;  1SE3 A;  1STN A;  2EIF A;  2FFK B;  4GLV B;  2UUB L;  4BS9 A;  1XPR A;  2KMP A;  3QO2 A;  4YY3 L;  2A8V A;  2EYO A;  3TRE A;  2PZW A;  1QCB D;  2R93 B;  1UVF A;  2DY7 A;  4C3J G;  1G8Z D;  4OGQ C;  1EIF A;  3Q22 A;  1QB5 D;  1V1O A;  4K5V A;  1SYE A;  3A7L A;  3RZO H;  5HY6 A;  4E6I A;  2LXK A;  2XRC A;  1F9Q A;  3UFF A;  4H0L C;  2I5M X;  4XQQ A;  4L5R C;  1PJU A;  2EJM A;  2NU1 I;  1C9O A;  4R4I A;  5E7N A;  3T56 B;  2JA5 G;  2NTT A;  1DZ1 A;  4GN5 A;  3J7A F;  5EBC A;  4PL4 A;  1JE5 A;  3CPF A;  3SGB I;  4A3I B;  5EJW A;  1LO5 D;  2JW6 A;  4LF9 Q;  2SGQ I;  1SNO A;  2B2V A;  2MO0 A;  5JPM C;  1SDF A;  4JI5 Q;  2JA6 B;  1EY0 A;  4YCU A;  2N78 A;  1PRT D;  2NU4 I;  3DEO A;  2BCO A;  4LF4 L;  1O7I A;  1C8C A;  5C0X I;  1FYC A;  1VQ9 A;  3I2Z A;  5FOB B;  1MBY A;  1M8C A;  4C3I H;  1YU6 C;  3SDJ A;  4NXM L;  2R92 H;  5KYL A;  5BN3 A;  1YIJ A;  1PH5 A;  1Y1V B;  1QE6 A;  1KIX A;  4U68 A;  5JAV A;  1D6E C;  4YIJ A;  5KIX A;  3URY A;  1SFO H;  1TQO A;  1TDP A;  2XVS A;  1SLJ A;  4Z7G A;  1A0I A;  4BY1 G;  4J1M A;  4ZUJ A;  3GTL H;  4PZ8 A;  3MXN A;  4QY7 A;  5C3E H;  3PO2 B;  1Q8I A;  5HI7 A;  3PIP A;  2NTS A;  4HCS A;  2FMM A;  2SGP I;  4KY5 A;  4UY8 C;  4K5X A;  1UE5 A;  4KKU A;  4LUO A;  1PTO D;  2RIO A;  5IGF A;  1B53 A;  2BOS A;  1MJA A;  2RHQ B;  4HJ5 A;  1F2L A;  3HOU B;  3V96 A;  3MFG A;  4X3U A;  1FAR A;  4OIJ A;  4DPG A;  1JQO A;  1STG A;  4X64 L;  4EX5 A;  4RKB A;  3SGI A;  3S1R H;  4HIO A;  2EYL A;  3S1Q B;  3BDC A;  4C3I B;  2VRW B;  5CYU A;  1KL9 A;  1TU2 B;  1IW4 A;  3I4N H;  3W1G A;  3SVM A;  4CKE A;  2WKC A;  2F0U A;  4LF5 L;  4LJZ C;  1N9W A;  3OXG A;  2LFN A;  1E1O A;  3PO3 H;  4U6R A;  4E1P A;  1Z47 A;  2YFB A;  2CWG A;  4O1N A;  3HP3 A;  2VUM H;  2W0T A;  3ITP A;  1TII D;  3S2H H;  2OQK A;  2PZU A;  3CCS A;  2Z0S A;  4L6T B;  1KXL A;  2ZRR A;  1BMO A;  3KF8 B;  2QGM A;  2JEB I;  3UE1 A;  1N33 Q;  5GAG C;  2JQO A;  3S16 B;  4GI3 C;  5K36 H;  4DFA A;  2MQH A;  2K19 A;  2JA1 A;  2EOT A;  2CKZ B;  3CCR A;  1CA6 A;  4NXN Q;  2X6G A;  5D3D A;  3V05 A;  4QL5 A;  4R8I A;  3RNU A;  5E1F A;  3K5O A;  4DR3 L;  1EY4 A;  1UE6 A;  1ZKO A;  3JC6 6;  3T1Y Q;  5ELD A;  4AIM A;  4C1N I;  1Q7Y C;  3NWT A;  1DD2 A;  2WIN B;  2ZXP A;  3G4S A;  1QUQ B;  2F0J A;  3AB9 A;  3L7Z C;  2C35 B;  2MJ8 A;  1PTO F;  3TP8 A;  5E3R A;  2L9H A;  2BH8 A;  1UHA A;  3S1R B;  1Y8P B;  5T1I A;  2F0L A;  3P23 A;  1CT4 I;  4EGV A;  1JWM D;  1XX8 A;  1I5F A;  4KV6 A;  4NV5 A;  5JJI A;  1HJA I;  1BBU A;  3PUZ A;  3PUY A;  1K7U A;  2XRS D;  2OCE A;  1OMU A;  1LT6 D;  3A5Z B;  4C3H G;  4KHP Q;  4DR6 Q;  2P6A C;  1YBY A;  4B3S Q;  1V1Q A;  4ME5 A;  2JAE A;  3R2T A;  1Y1W G;  2JA7 H;  2KHS A;  5HUR A;  2PQ8 A;  1MSH A;  2CH4 A;  5CBE E;  2ENN A;  4FXD A;  2CQA A;  1V1P B;  1TS3 A;  2PQE A;  2B63 G;  2JA6 H;  3HFZ B;  2JA5 H;  1GO3 E;  3VYT A;  1K7V A;  1EZ8 A;  3N52 A;  1PFN A;  5I2Y A;  2UU9 Q;  2KCT A;  2L1B A;  1J9O A;  3TBI B;  1IKL A;  1PDQ A;  2Z4H A;  4AYB G;  3T4A C;  4BBS B;  1N36 L;  3OYY A;  1EL0 A;  4JI0 L;  2QQ0 A;  2DNC A;  1WJJ A;  2BA0 A;  3S1M B;  4U67 3;  2LSS A;  1LT5 D;  4DNC A;  1I4X A;  2JB2 A;  2KMQ A;  1GUN A;  2Q8I B;  1K8O A;  1R9T B;  1GKH A;  4KY6 A;  3AEV A;  3P1H A;  1PVO A;  5COR A;  2DY8 A;  3BZC A;  1D1I A;  1EUJ A;  2I5L X;  1UEB A;  2K7V A;  4WJ3 M;  5C4J H;  4JYA L;  1I6V C;  3R5C A;  2E8G A;  1EFI D;  4RGO S;  3RU0 A;  1XJV A;  2OZU A;  2B8T A;  4NW2 A;  5FK9 C;  1SGD I;  3VDP A;  1OXX K;  2E2I H;  1F2Y A;  1CT0 I;  4BBR B;  1OYV I;  2KKM A;  2QF7 A;  1SN8 A;  3KF6 B;  1IZ6 A;  5F2D A;  4BY1 H;  3C46 A;  3PUV A;  3MEK A;  2A2C A;  3JSB A;  1W2B A;  2UVO A;  4B08 A;  3IFT A;  2OXP A;  1YJN A;  3A8I E;  2F3C I;  1MT1 A;  2HT1 A;  1PFM A;  1L1O B;  4A3J H;  4JV5 Q;  1VQJ A;  5C0X H;  5EBD A;  3ICE A;  3CKI B;  3KF8 A;  2RBM A;  4GLX A;  3K57 A;  4G75 A;  5GRO A;  2RSN A;  3ER0 A;  5J8F A;  1CQV A;  2WII B;  2WAQ E;  1OTC A;  4OWT B;  3LX0 A;  5LMN Q;  1YNJ C;  2UXD Q;  4HAE A;  5LMN W;  3GTQ H;  1B9N A;  3ND9 A;  3H0G H;  5KRU A;  2K9H A;  3ULJ A;  2JA6 G;  2YTV A;  4A3B B;  5KNB A;  3UDX A;  1AN1 I;  2ZTE A;  5GAD C;  1N32 Q;  1TR5 A;  3QTL D;  4DXG A;  1N13 A;  1WTO A;  2F0I A;  5E3F A;  4JVZ A;  5KGU A;  4A3C H;  3OW7 A;  1JMC A;  3W3A A;  1TWG H;  3D6W A;  3HGB A;  2PW7 A;  2F0F A;  1XNR L;  1X3P A;  5CV4 A;  1HPC A;  4DUY Q;  1BXT A;  2HD3 A;  4UP7 A;  1H9M A;  3TZD A;  3CC4 A;  4IOA A;  3TME A;  1WTQ A;  4DV6 L;  4RGT A;  4XIG S;  3G48 A;  3J80 L;  1YZ6 A;  5K5P A;  2JYO A;  4KKS A;  3E0J A;  5DEH A;  3SE0 A;  1JJG A;  2QDB A;  3LJ0 A;  5CV9 A;  1B7Y B;  5IGG A;  4ALP A;  4BA2 I;  3EN2 A;  1NY4 A;  4OAV B;  4J15 A;  3E59 A;  4TKO B;  2PNR C;  2F52 A;  5C5M A;  3MZ5 A;  2VQE Q;  1UNS A;  4Q0F A;  2B2V C;  2R7Z G;  3MTS A;  4WJ4 A;  3ERO A;  2UZ3 A;  3Q23 A;  4CDE C;  5GQO A;  1VQO A;  1JOK A;  3K0X A;  1XMO L;  1WVL A;  3A55 A;  1BCP C;  1SE2 A;  4DV7 L;  1ONL A;  3MXP A;  3UDG A;  5JEA H;  5CV7 A;  1H9J A;  2GN5 A;  1BCP D;  4FF4 A;  2F0G A;  2D62 A;  4DV1 L;  4A76 A;  3CP0 A;  1QZG A;  1QUQ A;  2G9D A;  3MA2 B;  3LGJ A;  3OPO A;  1Y69 U;  5E3Q A;  2QKI C;  3CRK C;  4MZ9 A;  1ULN A;  4ZK9 B;  3QWP A;  4UP9 A;  4K14 A;  4FP5 D;  1HCZ A;  3J7A V;  2MPM A;  3M3Y H;  1MJB A;  2ROW A;  1GD7 A;  5FLM H;  3OWF A;  4DR2 Q;  1EZ6 A;  3VDU A;  4ME3 A;  1PYS B;  1D5X C;  4DR6 L;  4KK7 A;  4X66 Q;  5JPN C;  5JVG 3;  4RGM A;  5EX0 A;  1IXR A;  4R4Q A;  1ASY A;  5BR8 Q;  5EKL A;  4LFA L;  2KEN A;  3I4M B;  4F87 A;  3ONA B;  4IFD J;  1EY7 A;  3HOY H;  2EPB A;  1AZQ A;  1CGI I;  4DAP A;  1IBK Q;  1XX6 A;  3Q24 A;  5JVH 3;  2V6E A;  2HQL A;  4V0B A;  5DM6 3;  4A3M G;  2EDG A;  2N55 A;  4ZUI A;  1I6H B;  5EKI A;  3I70 A;  2F1M A;  2ICI A;  3FVQ A;  1L0W A;  2SGD I;  1NMG A;  4JI3 L;  3TP5 A;  1TWC B;  2FJ2 A;  4IUN A;  4GLA C;  1L0X B;  2JB3 A;  3GDE A;  4DR4 L;  2CVR A;  4C3J B;  5FLX L;  1CSQ A;  1IBL Q;  4Q9V A;  2SNM A;  3AQQ A;  2NN6 G;  5DM7 3;  5L37 A;  5DNF A;  4JBJ A;  3I56 A;  1UVG A;  4HCE A;  2E2J H;  4JBM A;  3HKZ E;  2ZXR A;  3FBV A;  2XMX A;  1EWC A;  3HRZ C;  2HQE A;  1NJI C;  2LUY A;  1TWG B;  2JB1 A;  1EYD A;  2PI2 E;  1HXY D;  4QB4 A;  2UU9 L;  4BY7 G;  4QUC A;  4DAM A;  3TO6 A;  1HJP A;  5M9O A;  1N33 L;  3GTG B;  3NEL A;  5GAE C;  3H3V I;  2CWA A;  1PH2 A;  1EWH A;  5AJ3 L;  4DR5 L;  4R4T A;  2DB6 A;  1KDB A;  4GKJ L;  1TY2 A;  1A15 A;  2PCF B;  2Z8L A;  2QZG A;  3T1H L;  3KBG A;  1Q12 A;  4NV2 A;  4N8X 1;  1CHQ D;  1M4V A;  2L12 A;  3I4M H;  1CZW A;  1TXY A;  3HOW B;  5IYC H;  2CJS C;  1NTG A;  2BE5 D;  2F0P A;  2WV6 D;  4IQZ A;  3NE5 B;  3LWE A;  4G4K A;  4POG A;  4TRD A;  1FR3 A;  4K6L A;  4DUZ Q;  2RA4 A;  2JBW A;  2CCZ A;  1K8M A;  4YWL A;  4XQN A;  4WOR A;  2QIL A;  4C3J H;  2ODD A;  2Q2U A;  2B2W A;  1DON A;  2QCP X;  4MHE A;  1G2T A;  1XXG A;  4PL5 A;  3LWU A;  4JBW A;  5IE8 A;  2PQA B;  1T9H A;  1C0A A;  1RTO A;  1F2M A;  3K58 A;  3FPU B;  4FYD A;  1PH4 A;  3RMH A;  1X65 A;  2V1C C;  4P75 A;  1D2B A;  4JI7 Q;  4X66 L;  4OXP A;  2NU2 I;  2B2Y A;  1J8I A;  2DUD A;  2B2T C;  1IW7 C;  4YY3 Q;  3SGQ I;  1B3A A;  5LMN L;  3PO3 G;  1LTT D;  1CA5 A;  5FUY A;  4ZAI A;  4IUR A;  3W1B A;  2CFM A;  4QF4 A;  1EU4 A;  2Z6K C;  3L2P A;  1Z7K B;  3BS1 A;  1H9S A;  2RQX A;  3M9B A;  4FXG C;  2IP6 A;  1F9P A;  3QOL A;  3DA4 A;  1SNP A;  1TS2 A;  1A3T A;  2F0V A;  1PCE A;  5D3I B;  3DMU A;  4A3M B;  2MP1 A;  3FEW X;  3LJ2 A;  4OX9 Q;  5C44 H;  1B4O A;  3D3R A;  1VCI A;  5I4D A;  1I4G A;  3J81 c;  1L0Y B;  4A3I G;  3GTQ B;  5HGI A;  1VQF A;  2F0D A;  3S2D H;  2L4N A;  2V4D A;  1K0S A;  1S72 A;  3H6M A;  5I6W A;  4FO2 A;  1UE1 A;  4K2L A;  1ZYR C;  1I94 L;  4RGN A;  4TSS A;  2A5H A;  3I4M G;  5IGE A;  1DOK A;  3RUZ A;  2JA5 B;  4DF7 A;  3P75 A;  3NXW A;  3HS0 C;  3HOX B;  2HCI A;  4DR7 L;  1AZP A;  3NBH A;  3RZO B;  1JC7 A;  4NMZ A;  2B2U C;  1ICF B;  5C4X H;  3QAH A;  1PZK D;  5FKA C;  5EX3 A;  1AEX A;  1RCV D;  2UUC L;  1FJG Q;  1Q90 A;  3K5L A;  3A7A B;  1G2S A;  3D6C A;  2FHT A;  2N52 A;  3W2D A;  4K0K L;  2JSO A;  2XIW A;  3A56 A;  2UXD L;  4GOP A;  3PO2 G;  1CT2 I;  4YCW A;  1GM5 A;  2YU9 B;  3GOX A;  3TP7 A;  4NB3 A;  2D2C C;  5IGB A;  2ZJR A;  1ROD A;  2LMC B;  3I91 A;  4Y7N H;  4DR1 Q;  2AHO B;  3BYT B;  4JI4 L;  3S1M H;  4BY1 B;  1QVC A;  3F2U A;  2NN6 I;  2PO4 A;  1C7Y A;  1W3S A;  2QQE A;  4NDX A;  2UUA L;  3X3N A;  1M90 C;  3MWY W;  2F0K A;  1QVF A;  4O1O A;  2MJF B;  3E0E A;  3FSX A;  5JJL A;  3HH2 C;  3QB3 A;  1HHV A;  1TIH A;  3KY9 A;  4LWC A;  4JG2 A;  2F4V L;  5J22 A;  2WB1 E;  4JI4 Q;  1V8Q A;  3D4W A;  1Q81 C;  4XT1 B;  4DXF A;  1BO0 A;  3UDI A;  3ZYY X;  2O2L D;  3QR8 A;  1JB3 A;  3PDN A;  4LW1 A;  2ZTD A;  3PMF A;  1S4Z A;  4DV6 Q;  1U9R A;  2F3V A;  3UEY A;  1NAP A;  2ERW A;  1OXT A;  3K7A B;  4DAV A;  7WGA A;  1KRT A;  3DUZ A;  3CCE A;  2IHE A;  2K5V A;  2KMR A;  2YU9 H;  4IUT A;  4AS2 A;  3C1F A;  1G6P A;  4OON A;  1O7Y A;  4JOI A;  2P22 B;  4JI7 L;  4R4C A;  1GHJ A;  5E4X A;  3UGL A;  2EXD A;  4X3K A;  3MEF A;  4Y52 H;  1RF2 D;  1ML0 D;  1SRO A;  2JP1 A;  4ILW A;  4NPS A;  1YO7 A;  2NU0 I;  1RL2 A;  3UE0 A;  1X3Q A;  2LEO A;  4DR7 Q;  5M3M H;  3NPP A;  2NB0 A;  3RLF A;  2OVO A;  5C3E G;  1HTP A;  3D31 A;  3IAY A;  3AMU A;  1HRJ A;  4GN3 B;  1VMC A;  3SK8 A;  1GXD C;  3PIO 3;  4A3F G;  2H5X A;  2L15 A;  4O0A A;  1E0B A;  3SR1 A;  1ENC A;  2QEX A;  1X54 A;  3J81 j;  3CW2 C;  2KMO A;  2XNA C;  1BBW A;  1L2F A;  3HOV H;  2JA7 B;  3NTH A;  3KUP A;  1ENA A;  1VQK A;  4Y7N B;  4KJO A;  3GTM H;  1IY6 A;  2ZXO A;  4QCL A;  4SGB I;  2XWJ B;  3W5O A;  4XQJ A;  4A4I A;  2OEO A;  1SGR I;  2RAD A;  1PH8 A;  2RIJ A;  4H44 C;  2D0P A;  2Z1C A;  3EJI A;  2N17 A;  3I55 A;  4O1P A;  3BDO A;  1QWY A;  2KHJ A;  2NBF A;  3GD7 A;  5M5Y H;  1GJX A;  3A74 A;  2R7D A;  1R0R I;  2KJX A;  2SOB A;  1AP0 A;  1JWU D;  1EU3 A;  4LFA Q;  4JI2 Q;  4UXJ A;  1LT3 D;  1VQ4 A;  4FVM A;  4IUQ A;  3J80 c;  3TO9 A;  1HNW L;  3I4N B;  2EE1 A;  1NBW A;  3L0I A;  1K0R A;  2HIV A;  1HA6 A;  2Y0S B;  2N49 A;  1MI2 A;  3DO9 A;  4HSV A;  1ASZ A;  4GN4 B;  5JOB A;  4B3S L;  2BL7 A;  4NXN L;  1S5E D;  1TWF B;  2RCN A;  5M5W H;  2D5D A;  4DKA C;  3DWP A;  1OXU A;  3MXU A;  1XTD A;  1S5C D;  2JJQ A;  4KLK A;  1ULK A;  4HR7 B;  1A3U A;  1SE4 A;  3GTM B;  3RLO A;  4CBV A;  4YHH Q;  3NWS A;  2E73 A;  1V9P A;  1K3R A;  2SEB D;  1SSO A;  3ERQ A;  3CCQ A;  1A2U A;  1SYB A;  3EBE A;  2Q2H A;  3F1Z A;  1Z2I A;  2X52 A;  1TS4 A;  1DOL A;  1P9G A;  2P5Z X;  4JI1 Q;  3NK9 A;  2K14 A;  2PZT A;  1PRT B;  1U4M A;  5A2Q E;  3WOE A;  4LF6 L;  4A3F H;  3H94 A;  4DNR B;  2FIN B;  3UOE A;  1YVC A;  4PNY A;  1K8G A;  5IYD G;  2GKR I;  4GXT A;  5M3M G;  1YJW A;  2VQE L;  2F0W A;  3PQI A;  1SJH D;  4K5W A;  3M3Y B;  3K59 A;  3STB C;  4QUF A;  1L1O C;  4HEA 1;  3K6O A;  2FNF X;  2E5L Q;  1SRU A;  1TWA H;  4OHJ A;  2JEA I;  4OAU C;  4ODG A;  1XTC D;  4JW0 A;  2EY5 A;  2XRQ D;  3BDL A;  3DWA A;  4KHZ A;  1RFH A;  3R5B A;  2E76 C;  2FXQ A;  1PLF A;  1GUT A;  4PMB A;  4QIW E;  4YZC A;  4YWK A;  4DAY B;  1JOR A;  2NU3 I;  3VDY A;  1WTW A;  3I72 A;  4TVA B;  1MJC A;  3MVV A;  4A93 B;  4ZRZ A;  1TKW B;  1LR7 A;  2AKW B;  1SYD A;  1X55 A;  3CCV A;  1KLU D;  4RAU C;  2R7Z B;  4DNT B;  4B3M Q;  1JB7 A;  3F2C A;  1IYJ B;  1K28 A;  3U50 C;  5ISR A;  3GTO H;  1I50 B;  1FNU A;  4K6D A;  1KAB A;  1U4P A;  2F4I A;  3R5A A;  4A3M H;  1WTJ A;  1VQ7 A;  3CRL C;  3KLW A;  4LF6 Q;  2J0T D;  1GHK A;  2PMZ B;  3NQT A;  3MHB A;  3EVQ A;  4DR4 Q;  3FPP A;  3QG1 A;  3OXF A;  2CQO A;  4IPG A;  2JN4 A;  5I6Y A;  2Q2I A;  4DK3 C;  3G6E A;  1K83 B;  5CGK A;  1U5K A;  5FLX E;  2K4K A;  5DLQ E;  2O4X A;  4GS3 A;  4P74 A;  4FF3 A;  5KEE A;  3VR5 A;  4B3T Q;  2UXB L;  4GNX A;  1B70 B;  5M3M B;  1NUB A;  4FKD A;  2LB7 A;  2B63 H;  3M7G A;  4CDF C;  1J5E Q;  5IP7 H;  1Z9F A;  3L3O C;  2PMZ E;  3EQL C;  2F03 A;  2K5H A;  3F2B A;  2K04 A;  1NMF A;  2K33 A;  4K8I A;  4KJN A;  4ZYS A;  1UAP A;  5IP9 G;  5CCL A;  2QGQ A;  1PTR A;  1YNN D;  3VE5 A;  2I46 A;  1LR8 A;  1KBF A;  1H9S B;  1HFN A;  1PZJ D;  4QQB X;  1BR9 A;  4IFD H;  4DV2 L;  1HNZ L;  4AS3 A;  1DYQ A;  1STB A;  4OO1 G;  2IT1 A;  2J9R A;  3WWV A;  1N8R C;  2VB2 X;  4A3K B;  3OL0 A;  5A2Q L;  1LAB A;  2XN9 C;  4M1U B;  3IL8 A;  1A62 A;  2F0S A;  3M4Y A;  3H15 A;  2BH2 A;  1BUS A;  5IIF A;  2GIV A;  4DV3 Q;  5IT9 E;  1JOO A;  2Y0S G;  3JAM c;  2C9O A;  1IBM L;  3VA9 A;  1Y1B A;  1HZA A;  2RDH A;  5LMU Q;  3SEB A;  4UXI A;  1HQM C;  3CQZ B;  4C56 C;  3H91 A;  1YI2 A;  4RHR A;  1XMO Q;  2NVY B;  2QA4 A;  2TSS A;  2ASB A;  1YEZ A;  4UXH A;  2VS1 A;  3S1Q H;  2PQA A;  1AW7 A;  3KLR A;  5C5L A;  1CM9 A;  4FDB A;  2QQD A;  1K83 H;  4IO9 A;  1PTO B;  1PH1 A;  1I6H H;  3PSI A;  3A54 A;  5LMU L;  1Q82 C;  1ICW A;  5FLX c;  3KK7 A;  5NUC A;  3DM1 A;  1PYW D;  3HG9 A;  1OXS C;  3U9S A;  3J7A 5;  2JA8 G;  1E2W A;  5LL6 X;  1KMA A;  3UDF A;  3FKI B;  3GO5 A;  4KMU C;  3H3V H;  1IL8 A;  1B50 A;  4KN7 C;  1EOV A;  1NUC A;  3IFD A;  2NVT B;  1LTS D;  3DHQ A;  1VDD A;  1QG7 A;  2HUG A;  4YZ9 A;  3UI2 A;  2ORW A;  4A3F B;  1EYC A;  1CKN B;  3KP9 A;  1JE4 A;  4JYA Q;  1I4Q A;  4AQY Q;  2EZV A;  3IRB A;  4A3D H;  3VR4 A;  3OIP A;  3NP8 A;  1PPF I;  3CME A;  2F0N A;  1NR4 A;  1XNQ L;  1I94 Q;  2A20 A;  4K0K Q;  3F2D A;  4N8F A;  1SMY C;  2B2W C;  1F77 A;  2DJG C;  2XWB B;  4ZKC B;  3B4V C;  2IL8 A;  2SNS A;  1SEB D;  1Z6H A;  1JCK B;  1HA5 A;  2F0H A;  2GSC A;  2ZM6 Q;  3UEJ A;  1BOS A;  3DA3 A;  2SGF I;  2RSO A;  3WDN A;  3E2I A;  4WRD A;  1SNC A;  3FSY A;  1DM0 B;  2N8N A;  1J5E L;  2NUC A;  4GNX B;  3S16 H;  2I5H A;  4IUP A;  4Q5V A;  3JAM L;  1RD9 D;  3G6J B;  2R7Z H;  3BVZ A;  3NBI A;  2WAC A;  4CJ1 B;  4HIK A;  4BY7 B;  3R5D A;  1B44 D;  2NVQ B;  2X3T A;  2IHF A;  4CDD C;  2WKD A;  3JAM i;  4A3C G;  1KLG D;  3S14 B;  1C4Q A;  2GKV A;  1TT2 A;  4DAY A;  1BBX C;  1Y1C A;  5EAY A;  4DV5 Q;  1UWV A;  2CW0 D;  1A8V A;  1B9M A;  1NCV A;  2K5W A;  3PUW A;  1HQR D;  2NWG A;  5FUW A;  4F88 A;  2VQF L;  4LUZ A;  3ND8 A;  4CJ0 B;  5JJZ A;  3BYY B;  3CXL A;  1GUG A;  2O5I C;  5FUV A;  2OD1 A;  3K80 C;  3GV3 A;  2DJF C;  4NP5 A;  4I65 A;  4IJH A;  1HR0 L; 
#chains in the Genus database with same CATH homology
 1O7I A;  1I3Q H;  1SE8 A;  2DUD A;  2JA9 A;  3NBH B;  4YY3 Q;  4X65 Q;  1SGQ I;  3SGQ I;  5M5X H;  5LMN L;  1DGS A;  3PO3 G;  5C0X I;  3PV0 A;  2E5L L;  5JJK A;  1VQ9 A;  3I2Z A;  3CD6 A;  5FUY A;  3CPW A;  3W1B A;  2WCY A;  1JJ2 A;  2VNU D;  2CFM A;  1HZ9 A;  2Z6K C;  4C3I H;  1M8C A;  3L2P A;  3SDJ A;  1YU6 C;  4NXM L;  2R92 H;  1Z7K B;  1N36 Q;  3M9B A;  3BZK A;  1YIJ A;  1PH5 A;  1TWH H;  3KFU A;  2IP6 A;  1KIX A;  2QQ0 A;  3DA4 A;  1SR3 A;  1PCE A;  2HHH L;  2DIP A;  5IWA Q;  4GKK L;  1SFO H;  1TWC H;  4LFA L;  1SLJ A;  4Z7G A;  1A0I A;  4BY1 G;  3LJ2 A;  4OX9 Q;  5C44 H;  2HIX A;  1QZH A;  4LF8 L;  4JI8 Q;  3GTL H;  1VCI A;  1A63 A;  4PZ8 A;  3CAM A;  4QY7 A;  3U4V A;  5IY0 A;  3J81 c;  2F6M B;  3OTO Q;  5C3E H;  2B3G A;  3RR5 A;  4A3I G;  2BUS A;  2UXB Q;  5HGI A;  1E1T A;  1VQF A;  3PIP A;  5HI7 A;  2ORV A;  4P73 A;  1PHJ A;  2N71 A;  5CCM A;  3S2D H;  1S72 A;  1VQ5 A;  4IPH A;  4A3B H;  2SGP I;  1VQ6 A;  4UY8 C;  1UE1 A;  3HKS A;  3NEN A;  5AJ3 Q;  1I94 L;  1TBQ R;  2YTX A;  3I4M G;  1UE5 A;  1Y8F A;  2KHI A;  4LUO A;  2YTY A;  4A3J G;  2RIO A;  4L9M A;  2BA1 A;  2NZH A;  1H95 A;  3I9V 1;  4E1R A;  1FJG L;  2ENZ A;  2RHQ B;  4HJ5 A;  2J87 A;  3PGZ A;  4DV3 L;  1KC8 C;  1D8L A;  3PF5 A;  1FAR A;  4DPG A;  4B3R L;  1DS2 I;  4BA1 I;  2E5R A;  4DWL A;  4X64 L;  4DR7 L;  2L7X A;  4EX5 A;  1HDL A;  3SGI A;  3S1R H;  4HIO A;  2GKT I;  3U58 A;  1Y1V G;  2VUM G;  5C4X H;  5H1S E;  2VRW B;  5EX3 A;  1HR0 W;  1YHB A;  1FJG Q;  1KL9 A;  1WYD A;  2UUC L;  1H0Z A;  1IW4 A;  2WVJ A;  1UE7 A;  2A1A A;  3I4N H;  4A3D G;  4A3L H;  3W1G A;  2N52 A;  1VQD A;  4K0K L;  2D0O A;  4LF5 L;  3HOU G;  1E3P A;  1P8L A;  5ELO A;  2UXD L;  2JYY A;  4DUZ L;  4GOP A;  1WCM H;  4DR3 Q;  3A0J A;  3PO2 G;  1N9W A;  1VQ8 A;  4YCW A;  2N3S A;  1PH3 A;  1GM5 A;  3IAS 1;  4JBK A;  1CT2 I;  4GKK Q;  5IWA L;  3OXL A;  1E1O A;  2NZO A;  3PO3 H;  3OXG A;  4U6R A;  4NB3 A;  3HOV G;  4E1P A;  1Z47 A;  1X74 A;  1TWF H;  3M85 A;  2YFB A;  3TS2 A;  1Y1W H;  2ZJR A;  1VQC A;  4BBS H;  1CKN A;  2VUM H;  2W0T A;  1EYG A;  4DR1 Q;  4Y7N H;  2AWO A;  2AHO B;  1M1K C;  3S2H H;  4JI4 L;  3S1M H;  4YZD A;  2OQK A;  2MFI A;  2VL6 A;  4JOI C;  2OTL A;  3CCS A;  1QVC A;  2Z0S A;  2OWO A;  1X3F A;  2NN6 I;  1KXL A;  1C7Y A;  1W3S A;  2L1L B;  2ZRR A;  2WFW A;  4X62 Q;  1LM0 A;  3KF8 B;  3CQZ H;  2UUA L;  4A75 A;  2JEB I;  1BMO A;  1M90 C;  4JI6 Q;  3UE1 A;  1N33 Q;  1QVF A;  3CCJ A;  4XTC S;  5GAG C;  4B3T L;  4O1O A;  2MJF B;  2JQO A;  3E0E A;  5IP7 G;  3UGD A;  5JJL A;  3HH2 C;  2QPO A;  4GI3 C;  1LR9 A;  4TQU S;  1TIH A;  3KY9 A;  1IBL L;  2MQH A;  4LWC A;  4JG2 A;  2F4V L;  2K19 A;  1VQB A;  2WB1 E;  4IPD A;  4L5Q A;  1Q81 C;  4JI4 Q;  4A3B G;  2JA1 A;  2CKZ B;  1PV4 A;  3UDI A;  4HFV A;  1VQP A;  1YNX A;  4DV7 Q;  3PDN A;  4LW1 A;  3CCR A;  1QVG A;  4A3I H;  2ZTD A;  4NXN Q;  3K8A A;  4LF8 Q;  1YHQ A;  2K50 A;  4DV6 Q;  3B6Y A;  3RZD H;  4QL5 A;  4QGU A;  4X6A H;  3RNU A;  3M7N A;  4A24 A;  4B6D A;  3UEY A;  1LYL A;  4O2D A;  1BKB A;  1MKH A;  5M3F H;  4DR3 L;  1OXT A;  2ERW A;  1UE6 A;  3JC6 6;  3T1Y Q;  1KRT A;  4PG3 A;  1DS3 I;  4AIM A;  3CCE A;  2IHE A;  2K5V A;  3F4M A;  2VZA A;  1Q7Y C;  2YU9 H;  1X3E A;  2KMR A;  3S24 A;  4AS2 A;  4LF4 Q;  4OWW B;  3G4S A;  1G6P A;  4OVO A;  3FC3 A;  1QUQ B;  3L7Z C;  4OON A;  1WOC A;  2C35 B;  4JOI A;  3ULP A;  2P22 B;  1B8A A;  1MIU A;  4R4C A;  4JI7 L;  2NVT H;  4BBR H;  2EXD A;  2BH8 A;  5K36 G;  3UGL A;  4PZ6 A;  3MEF A;  3GTJ H;  3P23 A;  4Y52 H;  1SRO A;  2XGT A;  4NPS A;  1XNQ Q;  2XTI A;  1CT4 I;  1YO7 A;  1CGJ I;  1RL2 A;  3UE0 A;  1YJ9 A;  2NU0 I;  1I5F A;  2LEO A;  1S40 A;  4X64 Q;  4DR7 Q;  5ELN A;  5M3M H;  3S15 H;  4NV5 A;  2CWP A;  3J80 i;  3RLF A;  5C3E G;  3HOY G;  4LUV A;  4DK6 C;  3M4O H;  4B3R Q;  5JJI A;  1HJA I;  3D31 A;  1BBU A;  3PUZ A;  1XA6 A;  3PUY A;  2OCE A;  4GN3 B;  3CCM A;  2F66 B;  3A5Z B;  4POF A;  4BXX G;  4KHP Q;  1OMU A;  4DR6 Q;  4A3F G;  2M5X A;  2P6A C;  1YBY A;  2H5X A;  4DV4 Q;  1AE2 A;  2L15 A;  4B3S Q;  4P71 A;  1V1Q A;  4O0A A;  2YUU A;  4BBS G;  4A3E H;  2JAE A;  4DV5 L;  1Y1W G;  2QEX A;  4JI8 L;  1X54 A;  2JA7 H;  3J81 j;  3PF4 A;  3CW2 C;  1Y1B A;  2KMO A;  1BBW A;  1L2F A;  3HOV H;  4G76 A;  1EQR A;  1LTL A;  2OQ0 A;  4LFB L;  2VY3 A;  2ENN A;  2PI2 A;  3IAM 1;  2R92 G;  2VQF Q;  1VQK A;  1TBN A;  2GVA A;  2K5N A;  2SGE I;  2B63 G;  2JA6 H;  4EQ5 A;  3GTM H;  3AFQ A;  2UXC L;  3H0G G;  3HFZ B;  2JA5 H;  1GO3 E;  4LFC L;  1IY6 A;  4SGB I;  3W5O A;  4A4I A;  2YFA A;  1SGR I;  2UU9 Q;  1VQA A;  1PH8 A;  3KDF B;  2F3I A;  2KCT A;  3HOX H;  1AH9 A;  4DR1 L;  3HKZ G;  4JI1 L;  2D0P A;  2N17 A;  3I55 A;  4O1P A;  1KHI A;  4AYB G;  3UIT A;  1CKO A;  3OYY A;  2KHJ A;  5M5Y H;  1N36 L;  3GD7 A;  2I0Q A;  1WJJ A;  3CC7 A;  4JI0 L;  2BA0 A;  2R7D A;  2CAZ B;  3A74 A;  1R0R I;  2GVB A;  3LJ1 A;  5IYC G;  1UUC A;  2LSS A;  4LFA Q;  4JI2 Q;  4UXJ A;  4C2M H;  3DLL A;  1VQ4 A;  2JB2 A;  2KMQ A;  3F8T A;  3J80 c;  4HJ8 A;  4LFB Q;  3HOW G;  1HNW L;  3OVO A;  4B3M L;  4GKJ Q;  1NBW A;  1U0L A;  3L0I A;  1K0R A;  2HIV A;  1HZC A;  1GKH A;  3AEV A;  3UGI A;  1PVO A;  2N49 A;  3DO9 A;  1ASZ A;  3BZC A;  1EWI A;  4JI5 L;  1EUJ A;  2I5L X;  2ZTC A;  4GN4 B;  1K8A C;  4B3S L;  1UEB A;  4DV1 Q;  2F4V Q;  2J9R A;  2KCM A;  4WJ3 M;  5C4J H;  1XMQ Q;  4NXN L;  2ATW A;  4JYA L;  2E8G A;  2RCN A;  5IYB H;  5M5W H;  4RG1 A;  3RU0 A;  5M3F G;  1XJV A;  4DKA C;  2B8T A;  2XTQ A;  4GOP B;  1SGD I;  3VDP A;  1OXU A;  1OXX K;  4HID A;  5C4X G;  2RHS B;  1XTD A;  2JJQ A;  2E2I H;  4KLK A;  2R7F A;  1CT0 I;  5J3B A;  1OYV I;  2KKM A;  1L1O A;  3CCL A;  3HOX G;  1SN8 A;  3KF6 B;  1IZ6 A;  2UXC Q;  4BY1 H;  2ARP F;  4DV2 Q;  3PUV A;  3MEK A;  3I7F A;  3RLO A;  2A2C A;  1W4R A;  3JSB A;  1W2B A;  4YHH Q;  2E73 A;  1V9P A;  4YWM A;  3CMA A;  1K3R A;  1E24 A;  1YJN A;  2UUB Q;  1VQI A;  5FJ8 H;  3CCQ A;  2F3C I;  2KCX A;  1MT1 A;  3EBE A;  2HT1 A;  2N1A B;  2Q2H A;  3F1Z A;  1HZB A;  1KD1 C;  3KDF A;  1L1O B;  4A3J H;  1HPT A;  4JI0 Q;  4JV5 Q;  1VQJ A;  4PL3 A;  4IOC A;  4IFD G;  1XPU A;  3ICE A;  3FKI G;  3HOW H;  4JI1 Q;  4GLX A;  4IFD I;  2K14 A;  4GOP C;  4APV A;  1X4S A;  4G75 A;  4LF5 Q;  1X9N A;  1HNX Q;  1N32 L;  1MJE A;  4LF6 L;  4A3F H;  3M4P A;  2A2D A;  3ER0 A;  5GRO A;  3A5U A;  1TUR A;  2JA8 H;  2WAQ E;  2V53 A;  1OTC A;  4OWT B;  2UUC Q;  3AJF A;  3TRZ A;  3RLN A;  1YVC A;  1SJ8 A;  1K8G A;  5IYD G;  5LMN Q;  1K9M C;  3S14 H;  3Q8D A;  4GXT A;  5M3M G;  2VQE L;  1YJW A;  2UXD Q;  2GKR I;  5LMN W;  3GTQ H;  2ROW A;  4R1J A;  3H0G H;  3L0O A;  3STB C;  3RN5 A;  4MNO A;  3ULJ A;  1VQL A;  2JA6 G;  1L1O C;  2YTV A;  4HEA 1;  2K9H A;  2MNA A;  5HQ8 A;  3UDX A;  2E5L Q;  2ZTE A;  3S1N H;  1AN1 I;  2FNF X;  5GAD C;  1SRU A;  1TWA H;  4JI3 Q;  2JEA I;  1N32 Q;  2L8E A;  4OAU C;  2YQP A;  5FJ8 G;  1N13 A;  3QTL D;  1FVI A;  4UPA A;  4KI0 A;  1PH9 A;  4I1T A;  4KHZ A;  1RFH A;  1GVP A;  1Q8K A;  2FXQ A;  1WFQ A;  4A3C H;  5C0X J;  1JMC A;  1TWG H;  3E9I A;  4QIW E;  3U4Z A;  4YZC A;  4YWK A;  4OWX B;  4DAY B;  1XNR L;  2QQE A;  2ES2 A;  2NU3 I;  4PZ7 A;  1VQE A;  3VDY A;  1IBK L;  1KAW A;  4LF9 L;  5JHW C;  5IT9 c;  3ZJY C;  4DUY Q;  1X6O A;  1MJC A;  4TVA B;  1EQQ A;  1J6Q A;  4UP7 A;  3KJO A;  3CC4 A;  4IOA A;  3CF5 A;  1LR7 A;  1PTQ A;  2OTJ A;  2AKW B;  2FUG 1;  1X55 A;  1LUZ A;  3CCV A;  3BJI A;  3TEH B;  1Y14 B;  4RMF A;  4DV6 L;  1VQH A;  5GAH C;  4XIG S;  3G48 A;  1HNX L;  4B3M Q;  1IY5 A;  1JB7 A;  1HNW Q;  3F2C A;  1YZ6 A;  1IYJ B;  1HR0 Q;  3U50 C;  2IX1 A;  2NVQ H;  3GTO H;  5LNK 1;  1V1I A;  4JI2 L;  4DV0 Q;  4DUY L;  3STB D;  2MO1 A;  2AWN A;  4NXM Q;  4A3M H;  1JJG A;  1CE3 A;  3LJ0 A;  1VQ7 A;  3KLW A;  1B7Y B;  1Q1B A;  2ZJP A;  4ALP A;  4LF6 Q;  4BA2 I;  4A93 G;  3HOZ H;  3EN2 A;  1NY4 A;  4OAV B;  4DR4 Q;  4J15 A;  1TBR R;  3PIO A;  3E59 A;  3OXF A;  2CQO A;  4IPG A;  1KRS A;  2F52 A;  2ID0 A;  2Q2I A;  4DK3 C;  3G6E A;  2VQE Q;  1U5K A;  1KBE A;  2K4K A;  5DAE A;  5DLQ E;  3J81 i;  2R7Z G;  4WJ4 A;  4GS3 A;  4P74 A;  1EIY B;  2UZ3 A;  2GVI A;  5IYB G;  4B3T Q;  2UXB L;  2K52 A;  5GQO A;  2YV5 A;  4GNX A;  1VQO A;  3FP9 A;  3K0X A;  1XMO L;  1B70 B;  1JJC B;  4X65 L;  4HJ7 A;  1SGY I;  4HJ9 A;  4DV7 L;  1NUB A;  4FKD A;  2B63 H;  3UDG A;  4LNQ A;  1J5E Q;  1N34 L;  1V43 A;  5IP7 H;  1Z9F A;  2NVY H;  2GN5 A;  1HH2 P;  1PYB A;  4MTN A;  2B0U C;  4HGU A;  2PMZ E;  1Q86 C;  2K5H A;  4PMW A;  4AQY L;  4KHP L;  3D0F A;  3F2B A;  4IJL A;  1HNZ Q;  4YCV A;  5IYD H;  1NMF A;  3GTK H;  2D62 A;  4DV1 L;  4A76 A;  2Y0S E;  3CP0 A;  2ZJQ A;  1QZG A;  1QUQ A;  3LGJ A;  4X62 L;  1VQM A;  2HHH Q;  5IP9 G;  2IY5 B;  1JT8 A;  5CCL A;  3AFP A;  2ZM6 L;  2QGQ A;  4MZ9 A;  1PTR A;  3VE5 A;  1FAQ A;  1LR8 A;  1KBF A;  3QWP A;  4UP9 A;  2WAQ G;  4QQB X;  2JXD A;  5JEA J;  1IL2 A;  5C0X G;  3OTO L;  2UUA Q;  1VQN A;  4DV2 L;  3FKI H;  5BR8 L;  4AS3 A;  1HNZ L;  3ULL A;  5JEA G;  1IBM Q;  2B29 A;  3M3Y H;  4OO1 G;  2IT1 A;  4BBR G;  2WB1 G;  4QJF A;  1GD7 A;  3WWV A;  5FLM H;  3OW2 A;  1WI5 A;  1CSP A;  1N8R C;  3PO2 H;  3SEK C;  4DR2 Q;  3VDU A;  4ME3 A;  1CSO I;  1PYS B;  1CUK A;  1E22 A;  3OL0 A;  4DR6 L;  3M4Q A;  1A62 A;  1FL0 A;  1RIP A;  1E7Z A;  4X66 Q;  5FUX A;  3H15 A;  4HJA A;  1S3O A;  2K75 A;  2Q2T A;  4H02 A;  2BH2 A;  1BUS A;  4DV3 Q;  5EX0 A;  1PH6 A;  1IXR A;  1XNR Q;  4R4Q A;  3RN2 A;  1OXV A;  1YHA A;  2Y0S G;  3J7Z C;  1Y1V H;  5BR8 Q;  3JAM c;  3VA9 A;  2KEN A;  1IBM L;  3PCO B;  1X3G A;  1HZA A;  3DM3 A;  4JC0 A;  4R4O A;  5LMU Q;  1N34 Q;  5HGQ A;  4LF7 L;  3GTP H;  4UXI A;  3HOZ G;  1OMT A;  4A93 H;  4IFD J;  4JV5 L;  1YI2 A;  3HOY H;  1X56 A;  1XMO Q;  2QA4 A;  1D7Q A;  1CGI I;  1SMX A;  4JCV E;  4P72 A;  1IBK Q;  1XX6 A;  3I4O A;  2V6E A;  2HQL A;  3K7U C;  4A3K G;  1PA6 A;  2ASB A;  3CXC A;  4IPC A;  4A3M G;  1XPO A;  1YEZ A;  3PUX A;  2VS1 A;  3S1Q H;  4UXH A;  5FLM G;  1P16 A;  2PQA A;  1YTP A;  3KF6 A;  4LFC Q;  4FDB A;  1L0W A;  2QQD A;  3MXN B;  3NEM A;  1K83 H;  4L5T A;  4DV0 L;  4IO9 A;  1PH1 A;  1YIT A;  1I6H H;  2ELI A;  2SGD I;  3PSI A;  1NMG A;  4JI3 L;  5LMU L;  1Q82 C;  4LF7 Q;  4OX9 L;  4GLA C;  5FLX c;  1ASY A;  2JB3 A;  3GDE A;  4DR4 L;  1G29 1;  1Q46 A;  1CSQ A;  1IBL Q;  3BU2 A;  4Q9V A;  2R6G A;  3T1H Q;  1OXS C;  4L5S A;  3J7A 5;  2JA8 G;  3AQQ A;  2KBN A;  2NN6 G;  3KJP A;  3S17 H;  3UDF A;  1KMA A;  4Z7H A;  3BJU A;  3GO5 A;  4JBJ A;  4AH6 A;  3I56 A;  3H3V H;  4AYB E;  4A3G G;  2EQS A;  2DGY A;  5C44 G;  1UVG A;  2E2J H;  4JBM A;  3HKZ E;  1EOV A;  3CC2 A;  2OVO A;  3FBV A;  1PFS A;  2RF4 A;  2XMX A;  2XTR A;  1VDD A;  4YZ9 A;  3ERS X;  4BY7 H;  2QQC A;  1NJI C;  1K73 C;  2LUY A;  3T1Y L;  2JB1 A;  4JI6 L;  1CKN B;  2ORW A;  1BVS A;  1WCM G;  3HOU H;  2LXJ A;  2PI2 E;  3KP9 A;  4DNI A;  2UU9 L;  4BY7 G;  1XMQ L;  4JYA Q;  4AQY Q;  3E9H A;  3IRB A;  4DAM A;  4A3E G;  2AMC B;  4A3L G;  3TQY A;  4A3D H;  2JE6 I;  3GTG H;  1HJP A;  2WP8 J;  3G71 A;  2JA7 G;  2R93 G;  1V1H A;  1Q1E A;  2JZM A;  3KOJ A;  4UP8 A;  1N33 L;  1VQG A;  4YHH L;  3CME A;  1PPF I;  1XNQ L;  3NEL A;  5GAE C;  1PH7 A;  2CWA A;  1PH2 A;  4C3H H;  5AJ3 L;  4DR5 L;  1I94 Q;  3H3V I;  4BXX H;  3F2D A;  4R4T A;  4K0K Q;  4OO1 I;  1M8B A;  2A20 A;  3D00 A;  1AE3 A;  2DB6 A;  1TOT A;  1I50 H;  1FGU A;  2EIF A;  3FHW A;  4GLV B;  2UUB L;  1XPR A;  2KMP A;  4GKJ L;  1TUS A;  2R93 H;  2IX0 A;  3B4V C;  1CKM A;  4YY3 L;  1NE3 A;  2A8V A;  3TRE A;  3CCU A;  1KQS A;  2VW9 A;  3UEJ A;  2ZM6 Q;  3T1H L;  1SGP I;  3DA3 A;  1Q12 A;  4NV2 A;  3K7A H;  1FYB A;  2SGF I;  1UVF A;  1SGN I;  2NU4 I;  1EFW A;  3I4M H;  2V1C A;  4DR2 L;  3E2I A;  2A19 A;  2N8N A;  1EIF A;  2E2H H;  4A3K H;  1J5E L;  1TXY A;  4GNX B;  5IYC H;  3I4N G;  3S16 H;  2I5H A;  2CJS C;  3RZO H;  1NTG A;  5HY6 A;  2R7Z H;  2LXK A;  2XRC A;  3EIV A;  3UFF A;  4POG A;  4HIK A;  2I5M X;  4DUZ Q;  4L5R C;  1PJU A;  2NU1 I;  2IHF A;  1C9O A;  2ALY B;  2Z6K A;  4R4I A;  3JAM i;  4A3C G;  1R79 A;  2CCZ A;  5E7N A;  4DV4 L;  1R9T H;  2JA5 G;  4YWL A;  1TBO A;  2GKV A;  3TJQ A;  1TGS I;  4GN5 A;  4C3J H;  2ODD A;  2JK8 A;  2NVX H;  2PNH A;  2Q2U A;  1Y1C A;  4PL4 A;  5EAY A;  1OVO A;  4DV5 Q;  1UWV A;  4DR5 Q;  1A8V A;  1JE5 A;  1CHO I;  4PL5 A;  3AYH B;  4JBW A;  4GNX C;  3CPF A;  5IE8 A;  2PQA B;  3PUW A;  5FUW A;  1T9H A;  3SGB I;  2VQF L;  1C0A A;  4LUZ A;  4HIM A;  3CXL A;  2JW6 A;  4A3G H;  2YYZ A;  4LF9 Q;  1PH4 A;  1G51 A;  2SGQ I;  5FUV A;  1VS0 A;  1X65 A;  5IP9 H;  2V1C C;  2OD1 A;  3K80 C;  2MO0 A;  4P75 A;  4JI5 Q;  4JI7 Q;  4YCU A;  2N78 A;  3GOX A;  4X66 L;  3K81 C;  3TS0 A;  4IJH A;  4OXP A;  1SGE I;  3KYH C;  1XBT A;  4LF4 L;  2NU2 I;  1HR0 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...