2E8GA

The structure of protein from p. horikoshii at 1.7 angstrom resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
b'MWDTSKDYRLLVAEKSVELFIRTIEGAKFRGQWDKKRSIQLAKEMIPDIQALRYSYIDPEELVDTPQMKDLKEKAKGIIEALGGEDWHHKFLSQASREDREKVEEQVARIKFFLNTILNLDRRLKLGKINDPVIAVDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVTNDLTVKEGNRVAVALLPPRNFFGIVSEGMFLGAGEGVLKNVKGEIGGLPKGIPLEALNETRNAVEAFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0536
publication title Structure of protein PH0536 from Pyrococcus horikoshii at 1.7 A resolution reveals a novel assembly of an oligonucleotide/oligosaccharide-binding fold and an alpha-helical bundle
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 81
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF18489 Alpha_Helical Alpha helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.150 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2e8gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e8gA02
3T1HL 5J3BA 3CCMA 1X3FA 4GN3B 2ZM6Q 3KFUA 2R7ZG 3VDYA 1G51A 4HJ5A 2JK8A 1CSQA 4C3IH 3HOZG 1AH9A 1PVOA 1KL9A 3AFQA 3H0GH 5DLQE 1LM0A 4BBSG 1VS0A 5JEAJ 1Y1WG 2JA8H 1I5FA 1N32L 4JI3L 5IWAQ 1UE6A 3HOYG 3PUXA 1OXVA 3RZDH 5M5XH 4IJHA 4B3SL 2BH8A 1JMCA 3PF5A 4DUZL 2HIVA 3K80C 3CCVA 1VQAA 2GN5A 2UXDQ 4A3KH 4DR1Q 3KDFA 2DUDA 1A0IA 3PCOB 4JI7Q 3GTPH 4LUZA 2XGTA 4GLXA 1IBKQ 1JT8A 1GKHA 3CD6A 3EBEA 3GTOH 4JG2A 3UDIA 4GOPC 3ULPA 1K3RA 4JI1Q 1YI2A 4ALPA 4IPDA 2ZTDA 1IL2A 1KRTA 3JAMc 3HOXG 1NE3A 1W2BA 2E2JH 2N3SA 3M85A 5IT9c 1VQDA 5GAGC 2UUAL 2VQEL 2RF4A 2JA9A 3AQQA 4OONA 5JEAG 5IYCG 4HIDA 2AWNA 4A3IG 2VUMG 1N32Q 3M3YH 3BU2A 1TXYA 3H3VI 2CKZB 4YCWA 1PH3A 3J80c 3HOVG 3E9HA 1PH1A 3PIPA 2WFWA 3CC7A 2R6GA 1CKOA 3ULJA 3A5UA 4DV1Q 4AQYQ 2Z0SA 4OXPA 1DGSA 2WP8J 2NVXH 3TREA 4AIMA 1XPRA 4HIMA 4DUZQ 1K0RA 4MZ9A 3FKIH 3S2DH 3PUYA 4JI6L 4L5SA 4A3JG 5ELNA 4L5QA 3OTOL 1N34L 1YEZA 4JI8Q 4DNIA 4DR2L 3PUVA 3MXNB 5IYBH 1N9WA 4J15A 1P16A 4LF4L 2N49A 2QEXA 4DV7Q 4KHPQ 5C3EG 2Z6KC 5ELOA 3CMEA 1SR3A 4JI5L 4DK6C 1QZHA 4IPGA 4DV5L 4ME3A 1VQ9A 3JC66 3PO3H 1SN8A 1NMFA 4BA1I 4C3HH 1N36L 3RN2A 1U0LA 1OTCA 2ES2A 4A3DG 5H1SE 4OX9Q 1U5KA 4LFAL 2OQKA 2GVBA 3CPFA 5FJ8G 4DV3L 2VQEQ 4GNXA 1UE7A 1HR0Q 2CWPA 4LWCA 4PMWA 2ZJQA 4YCVA 5M3MG 1EYGA 4BY7H 1OXUA 2EQSA 1Q8KA 4PG3A 3TS0A 4QQBX 4L5RC 1B8AA 3HKZE 4IJLA 3JAMi 5BR8L 3GTQH 2KCMA 2E8GA 3E0EA 3PUWA 1E22A 3KF6B 1C0AA 2Q2TA 5IYDH 1K83H 4JC0A 1VQMA 3OTOQ 1N34Q 4BA2I 1XJVA 1M90C 1X6OA 1C7YA 2YTXA 4JI2Q 1W3SA 4DR5Q 4JI0Q 3STBD 5LMUL 1PH7A 5JJIA 2YYZA 1WFQA 2UU9L 2GVAA 4JI5Q 4WJ4A 3CCQA 4LFCL 1CUKA 4JI4Q 3D0FA 4A3LH 4OWWB 1SFOH 3W1BA 3CCSA 2ZJPA 5GROA 4JBKA 1R9TH 1Q82C 4OO1G 1NJIC 1SRUA 4LFAQ 4DAYB 3GTJH 4A3MH 3NENA 4A93G 4JV5Q 5FLMG 2A1AA 3DM3A 3GO5A 5C0XI 4HIOA 1J5EQ 4LNQA 3NBHB 5JJKA 4NXNL 1K73C 2R92G 2EXDA 4R4QA 1VCIA 1Q1EA 5BR8Q 2B63H 4UY8C 5M3FG 4NXML 2BA1A 1KRSA 3CXCA 1A62A 2VQFL 3FHWA 2K75A 3I2ZA 4A3CH 4EX5A 2D62A 1WCMH 1YHBA 2PI2E 1IBLL 3KF8B 3S16H 4LF6Q 1GO3E 4LFBQ 2K50A 5LMUQ 1CKNB 4X62L 3BJUA 4APVA 1X3EA 2JA7H 2UU9Q 1QUQA 1E24A 4X64L 2L15A 2B29A 4P72A 4PZ6A 1XNQL 2XTIA 2ALYB 1Y14B 1IXRA 1UE1A 2I0QA 3K7AH 2JA6H 2OTJA 5C0XJ 3KYHC 4QY7A 1K8GA 4R4CA 1KD1C 4LF5Q 4LF9Q 4DR6L 4YHHQ 2F52A 1L1OC 3I56A 4DR3L 1M1KC 2R7ZH 3F1ZA 2UUBL 3S17H 4UP8A 4NXNQ 3HOZH 5M5WH 1BKBA 3CCLA 1TWGH 2N8NA 1C9OA 5AJ3L 2E5LL 3GTGH 4NXMQ 1JE5A 4BBSH 2JJQA 1YNXA 1Y1WH 1PA6A 4OWTB 1I6HH 4AH6A 3HKZG 2Q2UA 1UE5A 4QJFA 3CF5A 4XIGS 4DV6L 4A3FG 3HOYH 1YVCA 5LMNQ 4B3RL 2UXCL 5JJLA 3J81j 3CPWA 3U4VA 1PH5A 1HNZL 3CW2C 1S72A 3I4NG 1YJ9A 2CWAA 1XNQQ 4GS3A 1NMGA 4JCVE 3T1HQ 5C0XG 1TWAH 2RHSB 4TQUS 4GOPA 1PH6A 2FXQA 3KDFB 3AFPA 4GLVB 2BH2A 5IP9G 4BXXG 1HZCA 2Q2HA 3M9BA 2R93G 3OYYA 3HOXH 3S1MH 5EAYA 1S40A 3F2CA 3CCRA 4OO1I 3B6YA 1QVGA 4A3IH 4JI3Q 3CC4A 2I5LX 5IYCH 2CCZA 2JQOA 2OTLA 2VUMH 2IHEA 4PZ8A 2UXBL 1GD7A 1TWCH 3HOVH 1LYLA 4DV6Q 1Q7YC 4B3SQ 2IHFA 3SGIA 4B3RQ 3G6EA 1HNZQ 1UWVA 2EIFA 1HZ9A 4GKJL 3U50C 1VQGA 1YHQA 4UPAA 2JA5G 4A3JH 3CQZH 4YY3L 2NN6G 3GTMH 2A19A 2Z6KA 1WJJA 3EIVA 4YWKA 3CCEA 2MO1A 1QZGA 2LSSA 4DR4L 1QVCA 2WB1E 5C3EH 2LXJA 4LF7L 2H5XA 2OCEA 3K7UC 4LW1A 3TRZA 1SROA 1KQSA 1EFWA 4Y52H 3PSIA 4PZ7A 1VQPA 2ATWA 1JJGA 1VQOA 1OXXK 1HJPA 1KHIA 4BBRG 1N33L 3BZKA 2QGQA 4A3DH 4UP9A 4C2MH 1VQ4A 2UUAQ 1Q86C 5FJ8H 5C44G 3LGJA 2PQAA 3E9IA 5M3MH 2JE6I 1VQLA 5IYBG 2QA4A 3ZJYC 4YWMA 4B3ML 1Q1BA 1SE8A 2D0OA 4IPHA 4QGUA 1X56A 4GNXB 1FVIA 1XMQL 2I5HA 2E2HH 4X6AH 5GAHC 2YV5A 2CFMA 4X66L 4DKAC 4A76A 2ASBA 5C4XG 2PQAB 1SLJA 3F2DA 4JI6Q 2PNHA 4JBWA 3HOUG 1ASZA 2MO0A 2KCTA 2KBNA 4P71A 1L0WA 4DR2Q 1VQCA 3J80i 3L0OA 2D0PA 4YY3Q 2ZJRA 4LF8L 1L2FA 4LF4Q 1Y1VG 3RN5A 1A63A 2VL6A 3IRBA 3PO2G 4DR4Q 4GN4B 3RNUA 4JBJA 1YHAA 4DV5Q 4LF7Q 3HOWG 4JOIC 3CMAA 4P75A 1Q46A 4C3JH 1N36Q 3ERSX 3L2PA 4YCUA 5E7NA 1YJWA 4A3GG 3STBC 4DV3Q 3M4OH 1KIXA 3EN2A 3H3VH 3I4MG 4A93H 4BY1G 3NEMA 5FLMH 2YU9H 1PYBA 3MEFA 2UUCL 1SMXA 1BBWA 2YTYA 2R92H 4DR7L 4B3MQ 4EQ5A 1CSPA 1VQEA 2DGYA 3CP0A 5IP7G 5M3FH 1VQ5A 1GVPA 1H95A 3KLWA 3RLFA 2R93H 4JBMA 2KHIA 2VS1A 3PO2H 4IFDI 5IE8A 4R4OA 4RG1A 3K0XA 3I55A 3FP9A 4XTCS 4A3EG 1VQKA 1RIPA 4NB3A 2ZM6L 1E7ZA 1X3GA 2Y0SE 4LFCQ 3PF4A 3J7ZC 1WI5A 4NPSA 3RLOA 4HJ7A 3J81c 4R1JA 1LUZA 2VNUD 2IX0A 2NN6I 2WB1G 1MKHA 3ICEA 1QUQB 1G6PA 1L1OA 1TWFH 1E3PA 5IWAL 1B7YB 1MJCA 1XNRL 3UE0A 1VQ6A 2UUCQ 3I4OA 4WJ3M 3Q8DA 4R4TA 2Q2IA 1XMOL 4A3BG 4HJ9A 1EOVA 4IFDJ 3RR5A 1AE2A 2UXDL 4POFA 2VQFQ 3W5OA 1VQNA 4DR1L 1ASYA 4X65L 1IBLQ 3M7NA 3G71A 1X55A 2WAQE 3CCJA 1IBKL 1GM5A 3UE1A 1FJGL 2OQ0A 4X62Q 4POGA 1OXSC 3AEVA 4JI1L 5GADC 4HJAA 3GTKH 1UEBA 1PH4A 4X64Q 1PHJA 3I4NH 1YJNA 1I94L 2JEAI 5C4JH 4JV5L 4LUOA 1BBUA 3D31A 3H0GG 1BVSA 3I7FA 2MQHA 1RL2A 2JA8G 1WOCA 2LXKA 1D8LA 2K4KA 4DR6Q 1PYSB 2MNAA 2R7FA 1S3OA 2C35B 2K5VA 4RMFA 4DR3Q 2ZTCA 2UUBQ 5IP9H 1XNRQ 4BXXH 5K36G 1IZ6A 1Z9FA 1JJCB 4B3TL 3M4PA 4IPCA 4LUVA 4KI0A 3J81i 4DV1L 4GOPB 4AQYL 1JB7A 5AJ3Q 1XMOQ 1JJ2A 2E5LQ 2VZAA 3S1RH 4AYBE 1FL0A 3TEHB 5GAEC 4A3KG 1KAWA 4GLAC 4IFDG 1I3QH 4DUYL 3CC2A 2MFIA 1T9HA 4IOAA 4JI8L 1LTLA 4X65Q 4YWLA 1HZAA 2RCNA 3GD7A 4TVAB 1EIYB 2UXCQ 4DV7L 3KOJA 3UDGA 1FJGQ 4KHPL 1AE3A 2KHJA 5HGQA 2JEBI 2PMZE 4KLKA 2IX1A 4OWXB 1HNWL 2K5HA 4GN5A 1KXLA 1YITA 2JA5H 1EQQA 1I94Q 3TS2A 4GKKL 1IBML 1E1TA 1G291 4OX9L 2HHHL 1HR0L 1E1OA 2Y0SG 1X65A 3CCUA 4P73A 4DV2L 4KHZA 2IY5B 2NVTH 2CQOA 2AKWB 3BZCA 4QIWE 1YIJA 1HR0W 1IYJB 4A4IA 3TQYA 4BBRH 3GTLH 3KJPA 1PH9A 3HFZB 3FKIG 1XPOA 1N8RC 4K0KL 2OWOA 3A0JA 4JYAL 4DUYQ 1NBWA 3PV0A 3PUZA 5GQOA 5C44H 2F4VL 2UXBQ 3AYHB 4UP7A 4JI2L 4DR5L 4JI0L 4DV0L 1B70B 1HNXL 3M4QA 1OXTA 4GKJQ 3S1QH 3PIOA 5C4XH 4DPGA 3H15A 1EWIA 3WWVA 4JI4L 2A8VA 3PO3G 2R7DA 1HNWQ 3HOUH 2WAQG 4O0AA 3DLLA 1EQRA 2ZTEA 4GKKQ 3HKSA 1IBMQ 1HH2P 3ER0A 3T1YL 2RHQB 1PFSA 1V43A 1K8AC 2HHHQ 4HJ8A 2V1CC 1Y1VH 4GNXC 4BY7G 3UDFA 3K81C 3S14H 2AWOA 1J5EL 1MJEA 4JOIA 3KF6A 1VQHA 4DV2Q 2ID0A 3HOWH 2VW9A 4DK3C 3S1NH 1XTDA 4B3TQ 1CKMA 1N33Q 3S15H 2F3IA 2I5MX 4A3GH 4MTNA 5IYDG 1VQBA 1VQ8A 1XPUA 5M5YH 4K0KQ 4JYAQ 1D7QA 1I50H 2AHOB 3W1GA 1Q81C 3I4MH 4BY1H 2F4VQ 2IT1A 3U4ZA 1KC8C 1EIFA 4LF6L 2NVQH 4DV4L 1YBYA 3ULLA 4LF8Q 2KENA 1XMQQ 1PH2A 4DV0Q 4AYBG 4LFBL 1FGUA 2E2IH 1HNXQ 1VQIA 1NY4A 4X66Q 3CAMA 4DAMA 5IP7H 3F8TA 4A3LG 4Y7NH 4IO9A 4P74A 2NZOA 2HIXA 4O2DA 4QL5A 4IOCA 4A3FH 1A8VA 4A3MG 3T1YQ 3S24A 2K14A 4LF5L 4LF9L 4YHHL 4A3EH 3F2BA 4FDBA 4R4IA 2VY3A 5HY6A 1VQ7A 4H02A 1WYDA 2BA0A 1VQJA 1EUJA 2NVYH 2N78A 3NELA 2B63G 4L5TA 1V1QA 3PGZA 1O7IA 1Q12A 1VQFA 4HIKA 1QVFA 3RLNA 3J7A5 3UDXA 2K52A 3S2HH 2HT1A 4A75A 1CKNA 4A3CG 1WCMG 3A5ZB 1X9NA 3U58A 3GDEA 5FLXc 3OW2A 3G48A 1MIUA 2PI2A 1V9PA 4MNOA 3RZOH 4DV4Q 4DR7Q 5LMNL 1YZ6A 1L1OB 2JA7G 4A3BH 1X54A 2HQLA 3G4SA 1J6QA 2AMCB 2NZHA 1PH8A 1K9MC 1HZBA 2YTVA 4JI7L 2K5NA 5LMNW 2JA6G 2B3GA 1PV4A 3L7ZC 1TWHH 3K8AA 3KJOA 3A74A 1NTGA 5IY0A 1P8LA 1Z47A
chains in the Genus database with same CATH superfamily
1D5ZC 3NQIA 4GN3B 4CKBA 4HJ5A 1O78A 2JK8A 3HOZG 3OWEB 1A3UA 2Z4IA 3VYRA 5CV4A 3AFQA 1VS0A 2EOTA 3TP6A 5IWAQ 2BDOA 4XQNA 2BE5D 5CC4A 5FOBB 2EZVA 3PUXA 5K36H 1U4PA 4IJHA 4J8QA 1EEFD 1JMCA 2HIVA 3CCVA 3DA3A 4IFDH 3PCOB 5LHY1 3GTPH 3OIQA 1PTOB 1AFPA 2OEOA 4CDFC 4NV2A 3K5OA 4GOPC 3ULPA 4I65A 1K3RA 2L4NA 1YI2A 2E75C 3C1FA 4IPDA 1IL2A 5L37A 2RF4A 1JB3A 1LTTD 3M3YH 1I50B 1WTPA 2CKZB 1JOQA 2WFWA 2FMCA 4RCNA 4DV1Q 4AQYQ 5CORA 1DCZA 2NWGA 3S2DH 1TT2A 2H4OA 4A3JG 4DNIA 5IYBH 1P16A 3MFGA 3B55A 1QB5D 2X6LA 5KIXA 1SR3A 1QZHA 3ERQA 3R93A 4FP5D 4JPBW 4OL7A 1U0LA 1OTCA 2ES2A 4OX9Q 2GVBA 4DV3L 5A2QL 1GUGA 1UE7A 3MVVA 1SE3A 1OXUA 1SNOA 1EIGA 3TS0A 2AQ2B 1B8AA 3GTQH 3E0EA 2B2YA 4K8IA 5ELBA 3KF6B 3I8ZA 3AB9A 4XT3B 3OTOQ 2XTRA 1XJVA 2ZW3A 2YTXA 3J7YW 2F0FA 1CT1D 3MXGA 5JJIA 2QDBA 1F2LA 3FMCA 2RADA 3CCQA 4JI4Q 4FF2A 4Z9CB 3A55A 4A3LH 1K0SA 4FO2A 4OWWB 1YNJD 3CCSA 2CQAA 5IGBA 4OO1G 1SRUA 4CKEA 4LFAQ 4DAYB 3PIO3 4A93G 3LWEA 5KYLA 5FLMG 2A1AA 4LNQA 4NXNL 2R92G 2EXDA 1VCIA 2R93B 2LS01 3MEHA 2K19A 2BA1A 2K75A 4LJZC 3H09A 5COYA 1YHBA 1IBLL 3S16H 5DAUA 1ENCA 1SBBB 3BJUA 3QWNA 1QUQA 2O4XA 5KEEA 4X64L 4O42A 4PMCA 3R3OA 2I0QA 4PL4A 1SNDA 4U68A 2OTJA 5C0XJ 4QY7A 2RDHA 2Y0SB 1STGA 3M3YB 3F1ZA 3W2DA 3P7JA 2A5HA 2FUG1 1V1PB 5M5WH 1JQYD 1OO9B 4V190 2E5LL 3GTGH 3OPOA 1PA6A 3S2DB 4OWTB 3NWTA 5C44B 3CF5A 2A6ED 1XXGA 1PH5A 1S5CD 1DM0B 2EYLA 1EY8A 1BXTA 3I4NG 4FF1A 1NMGA 4CBVA 1PTOD 4JCVE 4YZ9A 1PH6A 2FXQA 3AFPA 3NTKA 4GLVB 3S14B 1H9JA 5IP9G 3HOWB 5FO8B 3BG3A 3M9BA 3OYYA 1QNUA 2HCCA 3F4MA 2RA4A 1YO7A 1GUTA 4HMIA 3CC4A 5IYCH 3I4MB 5T1GA 1WTRA 1GD7A 4HCSA 1EU4A 2NVQB 3HOVH 1LYLA 2Z4HA 3K6OA 1II3A 1DONA 2EY5A 2Q8RE 4AYBB 3D4DA 3OIPA 1HNZQ 4GKJL 5I9OA 3U50C 3D4RA 1K28A 1BQQT 1FR3A 3KLRA 2NN6G 1GJXA 3EJIA 1S5FD 2XIWA 1SYGA 2N88A 1MHWC 1R4PB 4YWKA 5I2YA 2MO1A 5JPMC 2LSSA 4DR4L 2H5XA 1ML0D 3HG9A 1F2MA 1SROA 1EFWA 4PZ7A 4FF3A 2RSOA 1HJPA 4LMQD 1SNMA 1N33L 1ICFB 4O1OA 4X3KA 4A3DH 4C2MH 1VQ4A 5BN4A 3HEJA 1Q86C 3Q22A 4ID6A 3E6ZX 3LGJA 4IUVA 5EKLA 4TRDA 1I4XA 4R9WA 2F4IA 2SNSA 3ND9A 1IL8A 3CU7A 4YWMA 4DK0A 4IPHA 4E6IA 3S16B 1XMQL 3K58A 2I5HA 5C4XG 5E4XA 2EJMA 2ASBA 1SJ8A 3FVQA 1SLJA 3F2DA 2XRSD 1ASZA 3MAQA 1VQCA 3J80i 2ZJRA 4HEA1 2A69C 2NB0A 3RN5A 4PL3A 2VL6A 4PNYA 3KLSA 3IRBA 3JAML 4JBJA 3P75A 4JOIC 5IT9L 3L2PA 2PZUA 2TSSA 3H0GB 4DV3Q 3IFTA 3A7LA 1M4VA 1M8AA 2B2WC 1PYBA 2KA7A 4KY5A 1BBWA 2K05A 4EQ5A 4YIJA 1LV9A 3KLWA 4A3KB 3RLFA 2KHIA 4RG1A 3I55A 4KMUC 3KLSX 1VQKA 3IKJA 3NTIA 1EYDA 3J7ZC 1WI5A 1U9RA 3RLOA 4N8FA 1JOOA 3G7LA 2IX0A 2FHTA 4WORA 4JK1C 4X3UA 1B9NA 1L1OA 5JVG3 1E3PA 4PV1C 1B7YB 1HHVA 3CRKC 1SYCA 3HOVB 4DWLA 2A6HC 1G2TA 1XMOL 2Q2IA 4A3BG 4HJ9A 2RVLA 3RR5A 1AE2A 1HA6A 2UXDL 3L0IA 4KN7C 4DNTB 3QIAA 3KK7A 4KK7A 4KKSA 1IBLQ 1A3VA 1LLRD 3CCJA 1IW7C 3OOCA 5EGTA 2OQ0A 4I1TA 4JI1L 4HJAA 3MTSA 4X64Q 2CH4W 1I94L 3H94A 1BBUA 3I7FA 2JA8G 1RL2A 4C2MB 4NW2A 1V1OA 5C0XH 4DXGA 2MNAA 4J1MA 4KV6A 4RMFA 2L1LB 1XNRQ 1IZ6A 1HCZA 1JJCB 4B3TL 2E5LQ 5HGIA 3S1RH 1EIHA 1LTGD 4H44C 3CC2A 2F0MA 3O13A 1LTLA 4JI8L 4X65Q 5E1FA 3OWFA 1HZAA 2KUMA 4DV7L 3I90A 1FJGQ 2F66B 1HQMC 1KXLA 2A68D 1CTMA 2JA5H 4GKKL 4DU9A 4ME5A 1IBML 1E1TA 3V2TA 5JVH3 1HR0L 2F0OA 2NVTH 1U4RA 2CH4A 2EPBA 2EDGA 3MXNA 4IUUA 1NNXA 4BBRH 4KTAA 1N8RC 2OWOA 3A0JA 3VR4A 4DUYQ 2LY7A 4DR5L 1B70B 1HNXL 3EVQA 4QMGA 2PCFB 3S1QH 4GKJQ 4U673 5DNFA 2A8VA 1EY9A 3PO3G 1PZKD 4MHEA 3HOUH 3DLLA 1EQRA 1ZKOA 2ZTEA 3HKSA 4ZKCB 3NQTA 4U6RA 4HR7B 4BY7G 4HJ8A 4O1NA 1Y1VH 3UDFA 1SMYC 2AWOA 1MJEA 3PO2H 1I6HH 2R7ZB 5G3LD 3NPPA 3D4WA 1N33Q 2B2YC 2AUKA 5G3LF 4A3GH 1VQ8A 1XPUA 3ND8A 2ETDA 1A15A 2IT1A 3HKZB 1EIFA 4DV4L 1YBYA 1TVXA 2HDMA 1XMQQ 2E2IH 5IP7H 3KBGA 1Y69U 2OXPA 3VR3A 4I7AA 4ZYSA 1EZ6A 2L9HA 3RUZA 4C3JG 4IOCA 2NZ1D 4HEDA 3FVVA 4A3MG 3S24A 2RIOA 2QILA 4A3EH 2VY3A 5KNCA 1AW7A 1B53A 1WYDA 1AZQA 2NVYH 3S1MB 3NP8A 2FMMA 4KKTA 3S2HH 3S1RB 1B1ZA 3H91A 4A75A 2WV6D 2VUMB 3U58A 3GDEA 5FO7B 3AU7A 1V9PA 1SEBD 1MD2D 2K7VA 1GXDC 2Z9HA 1IHZA 4OGQC 4RGOS 3EROA 2NZHA 3UI2A 2F0IA 2K5NA 2JA6G 1WTQA 2JA5B 3K8AA 5M5YH 4DF7A 3J80E 3T1HL 3CCMA 1X3FA 3FDTA 3T51B 3KFUA 3VDYA 3RMHA 1G51A 2C5CA 1PVOA 1KL9A 2JYOA 3MC0B 4BBSG 4BBRB 1Y1WG 2JBWA 1UE6A 2KEEA 5M5XH 2BH8A 2ZRRA 3T56B 1VQAA 3S1QB 2UXDQ 4RH6A 2DUDA 1A0IA 2QDLA 4LUZA 4GLXA 3CKIB 5EJWA 4JI1Q 4ALPA 2ZTDA 1I6HB 1LTBD 2QF7A 4ODGA 3HOXG 3TP7A 2E2JH 1B3AA 1KNEA 4XXEA 1VQDA 3VR5A 3NBIA 5GAGC 1MI2A 4A3IG 2UUAL 4OONA 5JEAG 4A3GB 1N32Q 1E2VA 3H3VI 5IGFA 4QF4A 4KD3A 3PIPA 4B3TQ 3A5UA 2NVXH 1Q3LA 1DGSA 2WP8J 1JE4A 2IWHA 3TREA 5M3FB 2ICEC 2E2IB 4DUZQ 4HCEA 4MZ9A 3FKIH 4JI6L 4L5QA 3OTOL 3H3VC 2YFAA 4JI8Q 2QEXA 3E0JA 4DV7Q 5C3EG 5EQ0A 3CMEA 4IPGA 4DV5L 1SN8A 4BA1I 4RKLA 1N36L 2NVYB 1CHPD 2EY1A 4X3SA 1U5KA 4LFAL 2OQKA 4GNXA 5FJ8G 1HR0Q 3S2HB 2WB1B 4YCVA 5M3MG 1Q8KA 3SK4A 3MA2B 2E8GA 3ZYYX 4H7BA 3U9SA 1E22A 2F03A 4JVZA 4EQPA 1C0AA 4WRDA 2DY7A 1K83H 4JC0A 1TR5A 1C7YA 4FXKC 4DR5Q 2OF1A 2YYZA 4K5WA 3HZXA 2B39A 4WJ4A 3GTKB 4LFCL 1W6JA 4IZ8A 1O7YA 3R2TA 1HXYD 4K5VA 5C6AA 5C4JB 1R9TH 4JBKA 1Q82C 4L6TB 1Y8PB 4CDDC 1DOMA 1ZEQX 4JV5Q 1C4QA 1LT3D 3DM3A 4DN4M 1K73C 1LT5D 4R4QA 5M5XB 1Q1EA 2Z6BA 2B63H 2EYMA 3K59A 3DUZA 4UY8C 1KRSA 2RDGA 3FHWA 4I7ZC 3I2ZA 2HD3A 5EKIA 1WCMH 4DAVA 1F9PA 1GO3E 3KUPA 1T5XD 1SXTA 1AZPA 4X62L 2JA7H 2UU9Q 1E24A 2K5WA 4PZ6A 2EYOA 2A6HD 5TSSA 3NSWA 2E2JB 1UE1A 3TN2A 5IOCA 2HUGA 4DR6L 1K3BC 2F52A 1L1OC 3I56A 4DR3L 4H0LC 2UUBL 3S17H 3HOZH 2NVXB 1TWGH 3IAS1 5IGCA 3FKIB 1IKLA 2Q2UA 1UE5A 1ZYRD 4XIGS 1EFID 1RF2D 1YVCA 5JJLA 1U4MA 2EJGC 4HAEA 5HURA 3J81j 3U4VA 5EBDA 1HNZL 3VYTA 1YJ9A 3I4LA 2CWAA 2SNMA 4GS3A 4PQXA 3T1HQ 1TWAH 4TQUS 4DFAA 3WOFA 3KDFB 2F0LA 2G9HD 1G91A 1QWYA 5D3DA 1H9SB 2R93G 1A3TA 2CW0C 1DOLA 1PDQA 3D3RA 4OO1I 2I5LX 2OTLA 2JQOA 4DA2A 1K83B 2ENBA 5C4HA 3SGIA 4B3RQ 1S5BD 3G6EA 2Q8TA 1EWHA 4OEMB 4UPAA 1FNWA 2PZWA 4A3JH 3CQZH 1R9TB 2A19A 1BCPF 1WJJA 2LMCB 3CCEA 1QZGA 2QGMA 2DY8A 1G6ZA 4Y52H 3PSIA 3QG1A 3L9AX 4K2KA 2B63B 1XYIA 3QOJA 4UP9A 2UUAQ 5C44G 2J4XA 2PQAA 3E9IA 4KHVA 2JE6I 5IYBG 2X6GA 5K5PA 3RZOB 3ZJYC 1Q1BA 3U9OA 5CYUA 1X56A 2QEJC 3J81E 1RDPD 5GAHC 4A76A 2BDNA 1EY4A 4JI6Q 2MO0A 2KCTA 2KBNA 1L0WA 2WKCA 3L0OA 2J0TD 4YY3Q 4MTKA 1EEID 1A63A 2F3VA 5E4WC 2K32A 3F2UA 4GN4B 4LF7Q 4DV5Q 3HOWG 4P75A 1NCVA 4F88A 3JSBA 1N36Q 3ERSX 4L8JA 3HOZB 2PZTA 3L3OC 1TWGB 4YCUA 1UUPA 1YJWA 4OO1H 1JWMD 3STBC 2KCCA 3M4OH 1HRJA 1KIXA 3EN2A 3I4MG 3J80L 4A93H 3E5SA 4GXTA 2XNAC 1SYFA 4BY1G 5FLMH 5CR3A 3MEFA 3GQBA 5F2DA 3R2IA 2YTYA 4CKCA 2E76C 2HQEA 2M00A 3ITPA 3N6RA 2R92H 1VQEA 2B2UA 3CP0A 4HMJA 2L11A 1GVPA 1H95A 1TS3A 5KNBA 1TS5A 4JBMA 3GTPB 5CV7A 2EJFC 4R4OA 2CVRA 3K0XA 3FP9A 2EVBA 1RIPA 1HFGA 4NB3A 1ILPA 2Y0SE 4LFCQ 1O80A 4HJ7A 1D2BA 1RTOA 2K5DA 2NN6I 3ICEA 1MKHA 3M7GA 1TWFH 1WTHA 1XNRL 3UE0A 1L0YB 3A8KE 2UUCQ 1TU2B 3M4YA 5ELDA 1SNCA 2AQ1B 4B9WA 4RCOA 2MJ8A 1STNA 4X65L 4A3JB 3CQZB 1F2ZA 3G71A 1JWUD 1FJGL 2N55A 4X62Q 4POGA 1OXSC 3AEVA 5GADC 1PH4A 1LACA 1PHJA 3I4NH 1KDBA 2A74C 3H0GG 5BN3A 2MQHA 4DR6Q 4DR3Q 3EA6A 1Q8IA 2ZTCA 2UUBQ 5IP9H 5CV9A 2RBMA 3K5MA 3GTQB 3T53B 3DEOA 3M4PA 4IPCA 5E3FA 4KI0A 4GOPB 1F9RA 1HA5A 1SYEA 4AYBE 3TEHB 4A3KG 1KAWA 1FD7D 4G57A 1I3QH 4GLAC 4DUYL 3X3MA 1T9HA 4LAAA 2SEBD 3K5NA 3AJFA 5D65A 1WVLA 1EIYB 3KOJA 4KD4A 1O7LA 2Q8IB 5HGQA 2IX1A 4KLKA 4OWXB 2RQXA 4GN5A 1F9SA 4DAPA 4K6LA 1HFNA 1EQQA 3TS2A 5IIFA 1G291 2NN6H 5J39A 3M4OB 3J7AV 4A93B 4S3SA 1EY7A 1S5DD 1EWCA 2F0DA 3WOEA 2VB2X 2IY5B 5KNDA 3BZCA 1HR0W 1EYAA 2R92B 4A4IA 2EE1A 3TQYA 3GTLH 5CBEE 3Q0AA 1QCBD 1FGBD 1SE4A 5GQOA 3AYHB 4UP7A 5EPKA 4JI0L 3FNBA 3VA5A 3SDZA 1OXTA 1G8ZD 3FEWX 3H15A 1D6EC 1ENFA 5C4XH 1EWIA 2XSCA 3W3AA 4C3HG 3D6CA 1SNPA 4O0AA 5D3IB 1DJRD 5FLXE 5DM73 4GNXC 1ET6A 1TWFB 3KF6A 4EGVA 4G76A 1XTDA 1SJHD 3T16A 5M5WB 1NSNS 3WDNA 3S15H 1NUCA 2IX3A 3GTGB 4OAVB 4NV5A 2BOSA 5CV8A 5D14A 3SDJA 5IYDG 1BUVT 2F0JA 2IL8A 3BDOA 4JYAQ 2AHOB 3DHQA 1Q81C 2F4VQ 1Z6HA 3S9WA 4LF6L 3SK8A 1LO5D 3LX0A 4TKOB 4DV0Q 2R3ZA 1FGUA 4N9TA 4DAYA 4P74A 4K6DA 1I4PA 1PMRA 3D8GA 4LF5L 1S5ED 2K01A 4YHHL 1HQRD 4LF9L 3SR1A 2DJGC 3E3XA 5JJZA 3DXJC 2KKMA 1BBXC 2N78A 2PPBC 4L5TA 3KP9A 1VQFA 3IAYA 3UDXA 2PW7A 2HT1A 4A3CG 4QB4A 3A5ZB 3OW2A 1MIUA 4MNOA 5T1IA 3EQLC 5LMNL 1STEA 4A3BH 2QKIC 1J6QA 1PFMA 4RGTA 2L5TA 4R8NA 1PV4A 2YFBA 3KJOA 1U4LA 4A3FH 1P8LA 2CAZB 1V1PA 1B9MA 2R7ZG 1EZ8A 2PW5A 1T5EA 1CSQA 4C3IH 1AH9A 1RTNA 3C1EA 1TS4A 2EY2A 4G4KA 1LABA 4MN3A 4A3DB 5DLQE 3GTLB 1AEXA 1LM0A 1TIID 5JEAJ 2K28A 3HP3A 2JA8H 3BYTB 1N32L 4JI3L 4EQOA 3J7AF 3HOYG 1CA5A 2ZT9C 3PF5A 4DUZL 2EY6A 3DWPA 2GN5A 3IFDA 4IURA 1XX8A 2CW0D 2JB1A 4ZAIA 3TSSA 1QNKA 2XGTA 2QW7A 1JT8A 3EBEA 3GTOH 3UDIA 4NMZA 4K5XA 3TDQA 3J81L 2MJFB 1KRTA 4XYQA 3JAMc 3N52A 1W2BA 1KABA 2Z1CA 2N3SA 1B2TA 3V96A 5IT9c 3M85A 3S15B 4Z7HA 1Z7TA 1L0XB 5HGTA 2PNRC 2AWNA 4RAUC 2VUMG 3MHBA 3BU2A 1TXYA 1BCPC 1PH1A 2R6GA 4M1UB 4OXPA 1B50A 5J22A 1XPRA 1ZXTA 1K0RA 1JQOA 2F0EA 1FNUA 1YEZA 2RDFA 4OELB 1B44D 4OIKA 4G7ZC 4J15A 3GV3A 2EYPA 5ELOA 4DK6C 3QOLA 3JC66 4FXGC 3PO3H 1NMFA 1SAPA 3FBVA 1ET9A 3H6MA 4XT1B 3DMUA 2VQEQ 4JV5L 4PMWA 4LWCA 4BY7H 4CDCC 1EYGA 2L12A 4PG3A 4OHJA 3HKZE 2RKSA 3JAMi 1ENAA 1KLGD 2KCMA 3OMCA 4ZLTF 4YZDA 3Q6SA 2KCNA 5EKKA 2IP6A 4DGZA 1N34Q 3TP8A 1X6OA 1W3SA 4A3FB 4JI0Q 3STBD 1PH7A 2WKDA 2UU9L 4CHTB 2MGSA 4JI5Q 2XWBB 2EYFA 2F0WA 2L1BA 1SFOH 4C3IB 3NBHA 2ZJPA 5GROA 1B4OA 1GOZA 4CGYB 1NJIC 1STYA 4NP5A 2HDLA 4A3MH 5IODA 3NENA 3GO5A 4HIOA 1GHKA 1SYDA 2JN4A 2F0HA 1NR2A 5BR8Q 4MIUA 5M3FG 1Y8NB 3CXCA 2K03A 1A62A 2B2UC 3RD4A 3QJYA 4EX5A 2PQEA 1FYCA 3LWUA 1VDZA 2PI2E 3BVGA 3C46A 2CHBD 1G2SA 3KF8B 4LF6Q 1MSHA 2B2VA 3LJ0A 2K50A 5LMUQ 1CKNB 2QZGA 1LTAD 2A2CA 1JOKA 2XTIA 2ALYB 1Y14B 2JA6H 3K7AH 4DK1A 1K8GA 4R4CA 1KD1C 4LF5Q 4LF9Q 2P5ZX 4YHHQ 2NVTB 4UP8A 3TP5A 4CJ0B 2N8NA 1C9OA 1VMPA 3KBXA 4NXMQ 1JE5A 2M2LA 4FVMA 4BBSH 4UDUC 2JJQA 1C48A 1Y1WH 4AH6A 3T4AC 1QOHA 3GV6A 4QJFA 2FJ2A 4KJNA 5LMNQ 4B3RL 2UXCL 3V05A 3CPWA 2R61A 1S72A 3HOUB 2BCOA 1MGSA 1XNQQ 3PO3B 3P20A 3CHBD 2A6EC 4PMBA 1Y1VB 4BY7B 3PO2B 4BXXG 1HZCA 2Q2HA 1Q90A 2F0SA 3HOXH 4FXDA 4KY6A 3QB3A 3F2CA 2DNEA 1PTOC 1QVGA 3VYUA 5FLXL 4A3IH 4JI3Q 2MUYA 5JEAH 2UXBL 3I9V1 4DV6Q 1Q7YC 2IHFA 1S4ZA 1BCPB 4DNRB 2WIIB 2DNCA 2FFKB 4YY3L 1PYWD 5ISRA 4B08A 2F0GA 2Z6KA 4A3EB 1X32A 2WB1E 1QVCA 1UEAB 2LXJA 5C3EH 1GUOA 3K7UC 3G6JB 4LW1A 5LL6S 1KQSA 4LF7L 2BL7A 2RSNA 1KHIA 3LJ1A 3Q23A 2QGQA 3URYA 4K2LA 1PZJD 2B8FA 5FJ8H 4ZKBB 1VQLA 5M3MH 2KECA 5JOBA 2A69D 1SE8A 4QGUA 1F2YA 2CFMA 2YV5A 4X66L 4DKAC 2PQAB 4QUFA 2PNHA 4JBWA 4RWSC 4P71A 2MP1A 3PIP3 1ICWA 1UNSA 5M5YB 3EFXD 5JAVA 3K7AB 1L2FA 1PRTF 1SJED 4FYDA 4C56C 1EOTA 2KHSA 3RNUA 1YHAA 1Q46A 2NUCA 1RODA 5I2XA 5E7NA 3K5LA 3MXPA 4ZK9B 3H3VH 3P1HA 2VB3X 1Y1WB 3NEMA 2UUCL 1QILA 4LK1C 4B3MQ 4AS2A 1CSPA 1F9QA 3VR2A 2XTQA 4ULLA 2JAEA 4IFDI 1CFMA 4RGNA 4F8MA 2ZM6L 2H1EA 3NWSA 3PF4A 2I46A 4NPSA 2SDFA 4R1JA 1F77A 4KY7A 1JCKB 4KJOA 1QUQB 4OAUC 1H9KA 4GZYC 4RHSA 3BDCA 3BS1A 4RFBA 1HUNA 1IW7D 1VQ6A 2RLDA 4WJ3M 1SYBA 4R4TA 3BVMA 4POFA 3W5OA 1W6KA 4DR1L 3M7NA 2WAQE 3UITA 1IBKL 1GM5A 4ILWA 2RCFA 5C3EB 1UEBA 2O2LD 2WAQB 3MXUA 4LUOA 3D31A 5C5LA 1HTLD 1D8LA 2LXKA 1PYSB 1YNNC 1S3OA 4Q9VA 2C35B 2K5VA 2R7FA 3I72A 5M3MB 5K36G 1D1IA 1Z9FA 4LUVA 2R93H 1LTSD 4G75A 4X6AH 1FL0A 4IFDG 3OHXC 4F87A 3PMFA 3A54A 2IJ0A 2RCNA 4TVAB 4N8X1 2UXCQ 3UDGA 4KHPL 1AE3A 2EYHA 1BCPD 2PMZE 2K5HA 2JB2A 2BL8A 1YITA 1Y8OB 5ELFA 2XWJB 1E1OA 2Y0SG 1X65A 2PMZB 4P73A 3LNNA 2F0PA 3NUCA 4HN7A 4C1NI 3I91A 1SE2A 1KTKA 1STAA 2A68C 4OIJA 1VMCA 1IYJB 1WTWA 3KJPA 1DXMA 1PH9A 1XPOA 4JYAL 4UHVA 1NBWA 5C44H 2F4VL 1WCMB 2UXBQ 4JI2L 1A6XA 4DV0L 1J8IA 2G9DA 1SMYD 2JA7B 3PIOA 2I07B 4DPGA 1HNWQ 1EY5A 2FEFA 1JR0D 1K8OA 1PFBA 2RHQB 1V43A 2HHHQ 3S14H 3OW7A 1J5EL 1IKMA 4DV2Q 1VQHA 4RKBA 1WD1A 3HOWH 2VW9A 4DK3C 3S1NH 3S17B 3MZ5A 3TZDA 2D9UA 2F3IA 2EXZA 4ZRZA 2I5MX 3T13A 4RGMA 4MTNA 1WTVA 1VQBA 4K0KQ 4H13C 3K0YA 1LTID 3I4MH 4BY1H 2GSCA 2NVQH 5A35A 4LFBL 2KENA 4AYBG 2J7ZA 3FPUB 1NY4A 4X66Q 3CAMA 3I3CA 3F8TA 1RHPA 4Y7NH 4A3LG 2F3WA 2GA4B 2NZOA 2L0CA 2HIXA 1LT6D 4QL5A 5IGGA 2B2TA 5DM63 3T1YQ 1TWAB 2K6AA 3SE0A 4HTHA 3F2BA 4FDBA 4R4IA 1QE6A 2PO4A 1TQOA 4H02A 1GHJA 2BA0A 1VQJA 1EUJA 3A56A 4C1NK 1STHA 3PGZA 1Q12A 4BWGB 4HIKA 3J7A5 3HS0C 3RLNA 2F1MA 2K52A 5CBAE 4O1PA 1X9NA 2V4DA 1RKNA 2WACA 1KDCA 2B2VC 2K33A 1L1OB 1X54A 2HQLA 2K5QA 2O5JC 1ESRA 4M8AA 1K9MC 3BYYB 4P2CB 5LMNW 2B3GA 1LT4D 4IN3A 3L7ZC 1TWHH 4IUQA 3A74A 1NTGA 2L55A 5IY0A 1Z47A 1HPCA 5J3BA 2ZM6Q 3VA7A 5LL6X 1B3QA 3H0GH 1X3PA 1JORA 1I5FA 3SHLA 5KYIA 1FNVA 1OXVA 3RZDH 4HSPA 4B3SL 1I6VC 3PQIA 1E2ZA 3K80C 4YZCA 2F0KA 4A3KH 4DR1Q 3KDFA 4JI7Q 1WTXA 3DM1A 2ICIA 4WJWA 1H9SA 1IBKQ 1GKHA 3CD6A 1XTCD 5M9OA 1TKWB 4JG2A 2ZXOA 4HFVA 1EY6A 1PTOF 2VXWA 4IUPA 3S1NB 3GP7A 2XMXA 1NE3A 1DZ1A 2JB3A 2VQEL 3AQQA 2JA9A 5IYCG 4HIDA 3DWQA 1GUSA 3IL8A 4YCWA 1PH3A 5NUCA 4BY1B 3J80c 2HCIA 3HOVG 3E9HA 3CC7A 1CKOA 3ULJA 3K57A 4TSSA 2Z0SA 4AIMA 5EPLA 4UAIA 4HIMA 1STBA 3PUYA 4Y7NB 4L5SA 1E0BA 5ELNA 2AQ3B 1N34L 1D5MC 4DR2L 3PUVA 1CM9A 3MXNB 1N9WA 4ZCKA 2F0QA 3I73A 4LF4L 2N49A 2XRQD 4KHPQ 2Z6KC 4JI5L 4B9XA 4ME3A 1VQ9A 4C3HH 1EQVA 2JXMB 3RN2A 5C3XA 4A3DG 4KN4C 5H1SE 3CPFA 1WTOA 4K14A 2ZJQA 1JJGA 2CWPA 1PRTC 2EQSA 5FK9C 5C5MA 4QQBX 5I6WA 4L5RC 1I4GA 4IJLA 5BR8L 1VF5C 4XQJA 4K8JA 3PUWA 2Q2TA 5IYDH 1SSOA 3HGBA 1VQMA 4BA2I 2WINB 1M90C 1TWHB 4JI2Q 5LMUL 1TY0A 4L63B 1WFQA 2GVAA 1CUKA 3D0FA 3I4NB 3W1BA 3GTJH 5C0XI 5JJKA 1J5EQ 3NBHB 4Q0FA 5CGKA 3RZDB 5BN5A 2ZXPA 4ABNA 3QR8A 4AS3A 4NXML 1GUNA 4QCLA 2VQFL 1I3QB 4A3CH 4IUNA 2D62A 2DN8A 4NKLA 2QCPX 1I4HA 3BVZA 4LFBQ 2F6MB 4APVA 1X3EA 2D2CC 3D6WA 5C3WA 4EQNA 5I6YA 2L15A 2B29A 2X69A 4P72A 1XNQL 1J9OA 3NE5B 1IYUA 1IXRA 2A2DA 1JICA 1ESFA 3KYHC 2XVSA 4G7OC 1M1KC 2R7ZH 4NXNQ 1BKBA 3FRPB 3TBIB 3CCLA 4KKUA 5AJ3L 3LJ2A 2FINB 1YNXA 3DWAA 3HKZG 3I70A 4J6HA 4F7XA 4DV6L 3MWYW 4A3FG 1WD0A 3HOYH 3FPPA 1AN8A 1YNND 2V6EA 5CMDA 1PXUA 5C4XB 1A2TA 2NBFA 3SEBA 3CW2C 1O7ZA 2OT2A 4JW0A 4C3IG 4RA8A 4C3HB 2BE5C 2F0NA 2JSOA 1ZYRC 5DEHA 1CQVA 5C0XG 2RHSB 4GOPA 2Z8LA 5I9PA 5KGUA 2BH2A 1E2WA 2PYKA 3QO2A 1D1KA 1A2UA 3S1MH 5EAYA 1S40A 3CCRA 1KNAA 1KAAA 3B6YA 3NXWA 5JPNC 4PL5A 2CCZA 2VUMH 2IHEA 4PZ8A 1ILQA 1TWCH 3TZUA 1XWEA 3NHHA 4B3SQ 1UAPA 1UWVA 2EIFA 1HUMA 1HZ9A 1VQGA 1YHQA 2KQ3A 2JA5G 1IYVA 1H9RA 3GTMH 3CRLC 1KDAA 1RJTA 2E74C 3EIVA 3GTJB 1GUWA 1MSGA 3TRZA 1PLFA 2OCEA 1K8MA 4V0BA 1VQPA 2ATWA 1VQOA 1OXXK 2SOBA 4BBRG 2K04A 3BZKA 4IUTA 2M9VA 1TY2A 2QA4A 4B3ML 2D0OA 4GNXB 4LF8L 1FVIA 2E2HH 4A3BB 2G5DA 1PRTB 5IGDA 3HOUG 4DR2Q 2D0PA 4CJ2C 1QJOA 1CA6A 4LF4Q 3Q24A 1Y1VG 1TS2A 3PO2G 4DR4Q 3CMAA 1CK1A 4C3JH 1TDPA 1PZID 3A8JE 4A3GG 2JA8B 3A7AB 4ZUIA 1DD2A 2YU9H 2ZXRA 1SMXA 1NAPA 3HOYB 4CDEC 1YNJC 4DR7L 1H9MA 2DGYA 5IP7G 2EYJA 5M3FH 1VQ5A 4CJ1B 1BOSA 3A8IE 1I4QA 1KLUD 2VS1A 4WFN3 5IE8A 5CV6A 1VF7A 5A2QE 2B2TC 3DA4A 1BF4A 4XTCS 4FF4A 4A3EG 3P23A 3GTOB 2P22B 1V8QA 2KVMA 1E7ZA 1X3GA 4XYOA 3J81c 1LUZA 1RD9D 2NYZD 2VNUD 5CV5A 2WB1G 5FKAC 1G6PA 5IWAL 2MHVA 1MJCA 4NDXA 4Z7GA 1C8CA 1TWCB 1MBYA 3OSOA 3I4OA 2KEDA 5J1ZA 3Q8DA 1EOVA 1SNQA 5FO9B 4IFDJ 2VQFQ 1VQNA 1ASYA 5AFWA 1X55A 3GTMB 1RCVD 3UE1A 2KJXA 1BR9A 1R4QB 4FNFA 1CQFA 1NR4A 3DO9A 3GTKH 1YJNA 2JEAI 3HRZC 5C4JH 1PFNA 3BZDB 1BVSA 1WOCA 2K4KA 4BXXH 3J81i 4DV1L 4AQYL 3SXHA 1JB7A 5AJ3Q 1XMOQ 5ELCA 5ELEA 2VZAA 1JJ2A 2E2HB 5GAEC 2MFIA 2LKVA 2KOLA 4IOAA 4YWLA 1BDOA 3VYSA 3GD7A 4DXFA 5EBCA 2KHJA 2JEBI 1SDFA 1HNWL 1SFOB 4C3JB 3NK9A 1I94Q 3C2PA 4OX9L 2FU2A 2HHHL 4A3MB 3CCUA 1JC7A 4IALA 4N9PA 1QG7A 3DEPA 4DV2L 2TMPA 4IQZA 4KHZA 2YU9B 2E2DC 2QSBA 2CQOA 2AKWB 4QIWE 1YIJA 2A73B 3SVMA 1LTRD 3HFZB 3FKIG 4K0KL 3NTHA 4RHRA 2C9OA 4BS9A 4ZQ3A 2IW3A 3PV0A 3PUZA 2DJFC 3IAM1 4QIWB 5C4ZA 1AP0A 2F0VA 3M4QA 2D5DA 1PRTD 5IGEA 3VR6A 3WWVA 4JI4L 2NTTA 1ONLA 2R7DA 4ZUJA 1EU3A 2WAQG 4X3TA 2JA6B 2HGKA 1PTOH 4GKKQ 3VA9A 1HH2P 3ER0A 1IBMQ 3T1YL 2IPKD 1PFSA 2O5IC 5LNK1 1BO0A 1DYQA 1K8AC 2V1CC 3K81C 4JOIA 2ID0A 5KRUA 1CKMA 4XDXA 1D5XC 3X3NA 4BBSB 1D7QA 2B2WA 1I50H 1HTPA 3W1GA 4R8IA 3U4ZA 2F0TA 3TMEA 1KC8C 4EVOA 2JP1A 3ULLA 4LF8Q 1PH2A 3C3LA 1BNZA 2NTSA 1HNXQ 1VQIA 4DAMA 1CZWA 4Q5VA 1EY0A 4IO9A 3BDLA 3OMGA 4O2DA 1DOKA 5I4DA 2XN9C 1A8VA 2AUJD 2K14A 3AMUA 4HSVA 2B8GA 5HY6A 1VQ7A 5EPJA 2LFNA 1EL0A 3HOXB 3NELA 2B63G 3SK6A 1V1QA 3MFYA 1O7IA 3KF8A 1QVFA 2K1BA 1EQTA 3ONAB 4XQQA 1CKNA 4A3IB 2MPMA 1CHQD 1EYCA 1WCMG 5FLXc 3G48A 3SK5A 4G7HC 2PI2A 3RZOH 3JAME 4DV4Q 4DR7Q 1YZ6A 1CI3M 1JWSD 2JA7G 3R8BA 1X3QA 3G4SA 5IT9E 2AMCB 1PH8A 1HZBA 2F0UA 2YTVA 4JI7L 4QUCA 1I4RA 1CZGA
chains in the Genus database with same CATH topology
3T1HL 5J3BA 3CCMA 1X3FA 4GN3B 2ZM6Q 3KFUA 2R7ZG 3VDYA 1G51A 4HJ5A 2JK8A 1CSQA 4C3IH 3HOZG 1AH9A 1PVOA 1KL9A 3AFQA 3H0GH 5DLQE 1LM0A 4BBSG 1VS0A 5JEAJ 1Y1WG 2JA8H 1I5FA 1N32L 4JI3L 5IWAQ 1UE6A 3HOYG 3PUXA 1OXVA 3RZDH 5M5XH 4IJHA 4B3SL 2BH8A 2ZRRA 1JMCA 3PF5A 4DUZL 2HIVA 3K80C 3CCVA 4YZCA 1VQAA 2GN5A 2UXDQ 3DA3A 4A3KH 4DR1Q 3KDFA 2DUDA 1A0IA 3PCOB 2JB1A 4JI7Q 3GTPH 4LUZA 2XGTA 4GLXA 1IBKQ 1JT8A 1GKHA 3CD6A 3EBEA 3GTOH 4NV2A 4JG2A 3UDIA 4GOPC 3ULPA 1K3RA 4HFVA 4JI1Q 4ALPA 1YI2A 4IPDA 2ZTDA 2MJFB 1IL2A 1KRTA 3JAMc 3HOXG 2XMXA 1NE3A 1W2BA 2E2JH 2N3SA 3M85A 5IT9c 1VQDA 4Z7HA 5GAGC 2JB3A 2UUAL 2VQEL 2RF4A 2JA9A 3AQQA 4OONA 5JEAG 5IYCG 4HIDA 2AWNA 4A3IG 2VUMG 1N32Q 3M3YH 3BU2A 1TXYA 3H3VI 2CKZB 4YCWA 1PH3A 3J80c 3HOVG 3E9HA 1PH1A 3PIPA 2WFWA 3CC7A 2R6GA 1CKOA 3ULJA 3A5UA 4DV1Q 4AQYQ 2Z0SA 4OXPA 1DGSA 2WP8J 2NVXH 3TREA 4AIMA 1XPRA 4HIMA 4DUZQ 1K0RA 4MZ9A 3FKIH 3S2DH 3PUYA 4JI6L 4L5SA 4A3JG 5ELNA 4L5QA 3OTOL 1N34L 1YEZA 2YFAA 4JI8Q 4DNIA 4DR2L 3PUVA 3MXNB 5IYBH 1N9WA 4J15A 1P16A 4LF4L 2N49A 2QEXA 4DV7Q 4KHPQ 5C3EG 2Z6KC 5ELOA 3CMEA 1SR3A 4JI5L 4DK6C 1QZHA 4IPGA 4DV5L 4ME3A 1VQ9A 3JC66 3PO3H 1SN8A 1NMFA 4BA1I 4C3HH 1N36L 3RN2A 1U0LA 1OTCA 2ES2A 4A3DG 3FBVA 5H1SE 4OX9Q 1U5KA 4LFAL 2OQKA 2GVBA 3CPFA 5FJ8G 4DV3L 2VQEQ 4GNXA 1UE7A 1HR0Q 2CWPA 4LWCA 4PMWA 2ZJQA 4YCVA 5M3MG 1EYGA 4BY7H 1OXUA 2EQSA 1Q8KA 4PG3A 3TS0A 4QQBX 4L5RC 1B8AA 3HKZE 4IJLA 3JAMi 5BR8L 3GTQH 2KCMA 2E8GA 3E0EA 3PUWA 1E22A 4YZDA 3KF6B 1C0AA 2Q2TA 5IYDH 2IP6A 1K83H 4JC0A 1VQMA 3OTOQ 1N34Q 4BA2I 2XTRA 1XJVA 1X6OA 1M90C 1C7YA 2YTXA 4JI2Q 1W3SA 4DR5Q 4JI0Q 3STBD 5LMUL 1PH7A 5JJIA 2YYZA 1WFQA 2UU9L 2GVAA 4JI5Q 4WJ4A 3CCQA 4LFCL 1CUKA 4JI4Q 3D0FA 4A3LH 4OWWB 1SFOH 3W1BA 3CCSA 2ZJPA 5GROA 4JBKA 1R9TH 1Q82C 4OO1G 1NJIC 1SRUA 4LFAQ 4DAYB 3GTJH 4A3MH 3NENA 4A93G 4JV5Q 5FLMG 2A1AA 3DM3A 3GO5A 5C0XI 4HIOA 1J5EQ 4LNQA 3NBHB 5JJKA 4NXNL 1K73C 2R92G 2EXDA 4R4QA 1VCIA 1Q1EA 5BR8Q 2B63H 4UY8C 5M3FG 2K19A 4AS3A 1KRSA 2BA1A 4NXML 3CXCA 1A62A 2VQFL 3FHWA 2K75A 3I2ZA 4A3CH 4EX5A 2D62A 1WCMH 1YHBA 2PI2E 1IBLL 3KF8B 3S16H 4LF6Q 3LJ0A 1GO3E 4LFBQ 2K50A 5LMUQ 2F6MB 1CKNB 4X62L 3BJUA 4APVA 1X3EA 2JA7H 2UU9Q 1QUQA 1E24A 2A2CA 4X64L 2L15A 2B29A 4P72A 4PZ6A 1XNQL 2XTIA 2ALYB 1Y14B 4PL4A 1IXRA 1UE1A 2A2DA 3K7AH 2I0QA 2JA6H 2OTJA 5C0XJ 3KYHC 4QY7A 1K8GA 4R4CA 1KD1C 4LF5Q 4LF9Q 4DR6L 4YHHQ 2F52A 1L1OC 3I56A 4DR3L 1M1KC 2R7ZH 3F1ZA 2UUBL 3S17H 4UP8A 2FUG1 4NXNQ 3HOZH 5M5WH 1BKBA 3CCLA 1TWGH 2N8NA 3IAS1 1C9OA 5AJ3L 2E5LL 4NXMQ 3GTGH 1JE5A 4BBSH 2JJQA 3LJ2A 1YNXA 1Y1WH 1PA6A 4OWTB 1I6HH 4AH6A 3HKZG 2Q2UA 1UE5A 4QJFA 3CF5A 4XIGS 4DV6L 4A3FG 3HOYH 1YVCA 5LMNQ 4B3RL 2UXCL 5JJLA 2V6EA 3J81j 3CPWA 3U4VA 1PH5A 1HNZL 3CW2C 1S72A 3I4NG 1YJ9A 2CWAA 1XNQQ 4GS3A 1NMGA 4JCVE 4YZ9A 3T1HQ 5C0XG 1TWAH 2RHSB 4TQUS 4GOPA 1PH6A 2FXQA 3KDFB 3AFPA 4GLVB 2BH2A 5IP9G 4BXXG 1HZCA 2Q2HA 3M9BA 2R93G 3OYYA 3HOXH 3S1MH 5EAYA 1S40A 3F2CA 3F4MA 3CCRA 1YO7A 4OO1I 3B6YA 1QVGA 4A3IH 4JI3Q 3CC4A 2I5LX 5IYCH 4PL5A 2JQOA 2CCZA 2OTLA 2IHEA 4PZ8A 2VUMH 2UXBL 1GD7A 1TWCH 3HOVH 1LYLA 3I9V1 4DV6Q 1Q7YC 4B3SQ 2IHFA 3SGIA 4B3RQ 3G6EA 1HNZQ 1UWVA 2EIFA 1HZ9A 4GKJL 3U50C 1VQGA 1YHQA 4UPAA 2JA5G 4A3JH 3CQZH 4YY3L 2NN6G 3GTMH 2A19A 2Z6KA 1WJJA 3EIVA 4YWKA 3CCEA 2MO1A 1QZGA 2LSSA 4DR4L 1QVCA 2WB1E 5C3EH 2LXJA 4LF7L 2H5XA 2OCEA 3K7UC 4LW1A 3TRZA 1SROA 1KQSA 1EFWA 4Y52H 3PSIA 4PZ7A 1VQPA 2ATWA 1JJGA 1VQOA 1OXXK 1HJPA 1KHIA 4BBRG 3LJ1A 4O1OA 3BZKA 1N33L 2QGQA 4A3DH 4UP9A 4C2MH 1VQ4A 2UUAQ 1Q86C 5FJ8H 5C44G 3LGJA 2PQAA 3E9IA 5M3MH 2JE6I 1VQLA 5IYBG 2QA4A 3ZJYC 4YWMA 4B3ML 1Q1BA 1SE8A 2D0OA 4IPHA 4QGUA 1X56A 4GNXB 1FVIA 1XMQL 2I5HA 2E2HH 4X6AH 5GAHC 2YV5A 2CFMA 4X66L 4DKAC 1SJ8A 4A76A 2ASBA 5C4XG 2PQAB 1SLJA 3F2DA 4JI6Q 2PNHA 4JBWA 3HOUG 1ASZA 2MO0A 2KCTA 2KBNA 4P71A 1L0WA 4DR2Q 1VQCA 3J80i 3L0OA 2D0PA 4YY3Q 2ZJRA 4LF8L 4HEA1 1L2FA 4LF4Q 1Y1VG 3RN5A 4PL3A 2VL6A 1A63A 3IRBA 3PO2G 4DR4Q 4GN4B 3RNUA 4JBJA 1YHAA 4DV5Q 4LF7Q 3HOWG 4JOIC 3CMAA 4P75A 1Q46A 4C3JH 3JSBA 1N36Q 3ERSX 3L2PA 4YCUA 5E7NA 1YJWA 4A3GG 3STBC 4DV3Q 3M4OH 1KIXA 3EN2A 3H3VH 3I4MG 4A93H 4GXTA 4BY1G 3NEMA 5FLMH 2YU9H 1PYBA 3MEFA 2UUCL 1SMXA 1BBWA 2YTYA 2R92H 4DR7L 4B3MQ 4EQ5A 4AS2A 1CSPA 1VQEA 2DGYA 3CP0A 5IP7G 5M3FH 1VQ5A 1GVPA 1H95A 3KLWA 2XTQA 3RLFA 2R93H 2JAEA 4JBMA 2KHIA 2VS1A 3PO2H 4IFDI 5IE8A 4R4OA 4RG1A 3K0XA 3I55A 3DA4A 3FP9A 4XTCS 4A3EG 3P23A 2P22B 1VQKA 1RIPA 4NB3A 2ZM6L 1E7ZA 1X3GA 2Y0SE 4LFCQ 3PF4A 3J7ZC 1WI5A 4NPSA 3RLOA 4HJ7A 3J81c 4R1JA 1LUZA 2VNUD 2IX0A 2NN6I 2WB1G 1MKHA 3ICEA 1QUQB 1G6PA 1L1OA 1TWFH 4OAUC 1E3PA 5IWAL 1B7YB 1MJCA 4Z7GA 1XNRL 3UE0A 1VQ6A 2UUCQ 3I4OA 4DWLA 4WJ3M 3Q8DA 4R4TA 2Q2IA 1XMOL 4A3BG 4HJ9A 1EOVA 4IFDJ 3RR5A 1AE2A 2UXDL 3L0IA 4POFA 2VQFQ 3W5OA 1VQNA 4DR1L 1ASYA 4X65L 1IBLQ 3M7NA 3G71A 1X55A 2WAQE 3UITA 3CCJA 1IBKL 1GM5A 3UE1A 1FJGL 2OQ0A 4X62Q 4POGA 4I1TA 1OXSC 3AEVA 4JI1L 5GADC 4HJAA 3DO9A 1UEBA 1PH4A 3GTKH 4X64Q 1PHJA 3I4NH 1YJNA 1I94L 2JEAI 5C4JH 4JV5L 4LUOA 1BBUA 3D31A 3H0GG 1BVSA 3I7FA 2MQHA 1RL2A 2JA8G 1WOCA 2LXKA 1D8LA 2K4KA 4DR6Q 1PYSB 2MNAA 1S3OA 4Q9VA 2C35B 2K5VA 2R7FA 4RMFA 4DR3Q 2ZTCA 2L1LB 2UUBQ 5IP9H 1XNRQ 4BXXH 5K36G 1IZ6A 1Z9FA 1JJCB 4B3TL 3M4PA 4IPCA 4LUVA 4KI0A 3J81i 4DV1L 4GOPB 4AQYL 1JB7A 5AJ3Q 1XMOQ 1JJ2A 5HGIA 2VZAA 2E5LQ 4G75A 3S1RH 4AYBE 1FL0A 3TEHB 5GAEC 4A3KG 1KAWA 4GLAC 4IFDG 1I3QH 4DUYL 3CC2A 2MFIA 1T9HA 4IOAA 4JI8L 1LTLA 4X65Q 4YWLA 1HZAA 2RCNA 3GD7A 3AJFA 4TVAB 1EIYB 2UXCQ 4DV7L 3KOJA 3UDGA 1FJGQ 4KHPL 1AE3A 2KHJA 5HGQA 2JEBI 2PMZE 4KLKA 2F66B 4OWXB 2IX1A 1HNWL 2K5HA 4GN5A 1KXLA 2JB2A 1YITA 2JA5H 1EQQA 1I94Q 3TS2A 4GKKL 1IBML 1E1TA 1G291 4OX9L 2HHHL 1HR0L 1E1OA 2Y0SG 1X65A 3CCUA 4P73A 4DV2L 4KHZA 2IY5B 2NVTH 2CQOA 2AKWB 3BZCA 4QIWE 1YIJA 1HR0W 1IYJB 4A4IA 3TQYA 4BBRH 3GTLH 3KJPA 1PH9A 3HFZB 3FKIG 1XPOA 1N8RC 4K0KL 2OWOA 3A0JA 4JYAL 4DUYQ 1NBWA 3PV0A 3PUZA 5GQOA 5C44H 2F4VL 2UXBQ 3AYHB 4UP7A 3IAM1 4JI2L 4DR5L 4JI0L 4DV0L 1B70B 1HNXL 3M4QA 1OXTA 4GKJQ 3S1QH 3PIOA 5C4XH 4DPGA 3H15A 1EWIA 3WWVA 4JI4L 2A8VA 3PO3G 2R7DA 1HNWQ 3HOUH 2WAQG 4O0AA 3DLLA 1EQRA 2ZTEA 4GKKQ 3HKSA 3VA9A 1HH2P 3ER0A 1IBMQ 3T1YL 4U6RA 2RHQB 1PFSA 1V43A 5LNK1 1K8AC 2HHHQ 4HJ8A 2V1CC 1Y1VH 4GNXC 4BY7G 3UDFA 3K81C 3S14H 2AWOA 1J5EL 1MJEA 4JOIA 3KF6A 1VQHA 4DV2Q 2ID0A 3HOWH 2VW9A 4G76A 4DK3C 1XTDA 3S1NH 4B3TQ 1CKMA 1N33Q 3S15H 2F3IA 2I5MX 4OAVB 4NV5A 4A3GH 3SDJA 4MTNA 5IYDG 1VQBA 1VQ8A 1XPUA 5M5YH 4K0KQ 4JYAQ 1D7QA 1I50H 2AHOB 3W1GA 1Q81C 3I4MH 4BY1H 2F4VQ 2IT1A 3U4ZA 1KC8C 1EIFA 4LF6L 2NVQH 4DV4L 1YBYA 3ULLA 4LF8Q 2KENA 1XMQQ 1PH2A 4DV0Q 4AYBG 4LFBL 1FGUA 2E2IH 1HNXQ 1VQIA 1NY4A 4X66Q 3CAMA 4DAMA 5IP7H 3F8TA 4A3LG 4Y7NH 4IO9A 4P74A 2NZOA 2HIXA 4O2DA 4QL5A 4IOCA 4A3FH 1A8VA 4A3MG 3T1YQ 3S24A 2RIOA 2K14A 4LF5L 4LF9L 4YHHL 4A3EH 3F2BA 4FDBA 4R4IA 2VY3A 5HY6A 1VQ7A 4H02A 1WYDA 2BA0A 1VQJA 1EUJA 2KKMA 2NVYH 2N78A 3NELA 2B63G 4L5TA 1V1QA 3PGZA 1O7IA 3KP9A 1Q12A 1VQFA 4HIKA 3RLNA 1QVFA 3J7A5 3UDXA 2K52A 3S2HH 2HT1A 4A75A 1CKNA 4A3CG 1WCMG 4O1PA 3A5ZB 1X9NA 3U58A 3GDEA 5FLXc 3OW2A 3G48A 1MIUA 2PI2A 1V9PA 4MNOA 3RZOH 4DV4Q 4DR7Q 5LMNL 1YZ6A 1L1OB 2JA7G 4A3BH 1X54A 2HQLA 3G4SA 1J6QA 2AMCB 2NZHA 1PH8A 1K9MC 1HZBA 2YTVA 4JI7L 2K5NA 5LMNW 2JA6G 2B3GA 1PV4A 3L7ZC 2YFBA 1TWHH 3K8AA 3A74A 1NTGA 5IY0A 1P8LA 3KJOA 2CAZB 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H L;  5J3B A;  3CCM A;  1X3F A;  4GN3 B;  2ZM6 Q;  3KFU A;  2R7Z G;  3VDY A;  1G51 A;  4HJ5 A;  2JK8 A;  1CSQ A;  4C3I H;  3HOZ G;  1AH9 A;  1PVO A;  1KL9 A;  3AFQ A;  3H0G H;  5DLQ E;  1LM0 A;  4BBS G;  1VS0 A;  5JEA J;  1Y1W G;  2JA8 H;  1I5F A;  1N32 L;  4JI3 L;  5IWA Q;  1UE6 A;  3HOY G;  3PUX A;  1OXV A;  3RZD H;  5M5X H;  4IJH A;  4B3S L;  2BH8 A;  1JMC A;  3PF5 A;  4DUZ L;  2HIV A;  3K80 C;  3CCV A;  1VQA A;  2GN5 A;  2UXD Q;  4A3K H;  4DR1 Q;  3KDF A;  2DUD A;  1A0I A;  3PCO B;  4JI7 Q;  3GTP H;  4LUZ A;  2XGT A;  4GLX A;  1IBK Q;  1JT8 A;  1GKH A;  3CD6 A;  3EBE A;  3GTO H;  4JG2 A;  3UDI A;  4GOP C;  3ULP A;  1K3R A;  4JI1 Q;  1YI2 A;  4ALP A;  4IPD A;  2ZTD A;  1IL2 A;  1KRT A;  3JAM c;  3HOX G;  1NE3 A;  1W2B A;  2E2J H;  2N3S A;  3M85 A;  5IT9 c;  1VQD A;  5GAG C;  2UUA L;  2VQE L;  2RF4 A;  2JA9 A;  3AQQ A;  4OON A;  5JEA G;  5IYC G;  4HID A;  2AWN A;  4A3I G;  2VUM G;  1N32 Q;  3M3Y H;  3BU2 A;  1TXY A;  3H3V I;  2CKZ B;  4YCW A;  1PH3 A;  3J80 c;  3HOV G;  3E9H A;  1PH1 A;  3PIP A;  2WFW A;  3CC7 A;  2R6G A;  1CKO A;  3ULJ A;  3A5U A;  4DV1 Q;  4AQY Q;  2Z0S A;  4OXP A;  1DGS A;  2WP8 J;  2NVX H;  3TRE A;  4AIM A;  1XPR A;  4HIM A;  4DUZ Q;  1K0R A;  4MZ9 A;  3FKI H;  3S2D H;  3PUY A;  4JI6 L;  4L5S A;  4A3J G;  5ELN A;  4L5Q A;  3OTO L;  1N34 L;  1YEZ A;  4JI8 Q;  4DNI A;  4DR2 L;  3PUV A;  3MXN B;  5IYB H;  1N9W A;  4J15 A;  1P16 A;  4LF4 L;  2N49 A;  2QEX A;  4DV7 Q;  4KHP Q;  5C3E G;  2Z6K C;  5ELO A;  3CME A;  1SR3 A;  4JI5 L;  4DK6 C;  1QZH A;  4IPG A;  4DV5 L;  4ME3 A;  1VQ9 A;  3JC6 6;  3PO3 H;  1SN8 A;  1NMF A;  4BA1 I;  4C3H H;  1N36 L;  3RN2 A;  1U0L A;  1OTC A;  2ES2 A;  4A3D G;  5H1S E;  4OX9 Q;  1U5K A;  4LFA L;  2OQK A;  2GVB A;  3CPF A;  5FJ8 G;  4DV3 L;  2VQE Q;  4GNX A;  1UE7 A;  1HR0 Q;  2CWP A;  4LWC A;  4PMW A;  2ZJQ A;  4YCV A;  5M3M G;  1EYG A;  4BY7 H;  1OXU A;  2EQS A;  1Q8K A;  4PG3 A;  3TS0 A;  4QQB X;  4L5R C;  1B8A A;  3HKZ E;  4IJL A;  3JAM i;  5BR8 L;  3GTQ H;  2KCM A;  2E8G A;  3E0E A;  3PUW A;  1E22 A;  3KF6 B;  1C0A A;  2Q2T A;  5IYD H;  1K83 H;  4JC0 A;  1VQM A;  3OTO Q;  1N34 Q;  4BA2 I;  1XJV A;  1M90 C;  1X6O A;  1C7Y A;  2YTX A;  4JI2 Q;  1W3S A;  4DR5 Q;  4JI0 Q;  3STB D;  5LMU L;  1PH7 A;  5JJI A;  2YYZ A;  1WFQ A;  2UU9 L;  2GVA A;  4JI5 Q;  4WJ4 A;  3CCQ A;  4LFC L;  1CUK A;  4JI4 Q;  3D0F A;  4A3L H;  4OWW B;  1SFO H;  3W1B A;  3CCS A;  2ZJP A;  5GRO A;  4JBK A;  1R9T H;  1Q82 C;  4OO1 G;  1NJI C;  1SRU A;  4LFA Q;  4DAY B;  3GTJ H;  4A3M H;  3NEN A;  4A93 G;  4JV5 Q;  5FLM G;  2A1A A;  3DM3 A;  3GO5 A;  5C0X I;  4HIO A;  1J5E Q;  4LNQ A;  3NBH B;  5JJK A;  4NXN L;  1K73 C;  2R92 G;  2EXD A;  4R4Q A;  1VCI A;  1Q1E A;  5BR8 Q;  2B63 H;  4UY8 C;  5M3F G;  4NXM L;  2BA1 A;  1KRS A;  3CXC A;  1A62 A;  2VQF L;  3FHW A;  2K75 A;  3I2Z A;  4A3C H;  4EX5 A;  2D62 A;  1WCM H;  1YHB A;  2PI2 E;  1IBL L;  3KF8 B;  3S16 H;  4LF6 Q;  1GO3 E;  4LFB Q;  2K50 A;  5LMU Q;  1CKN B;  4X62 L;  3BJU A;  4APV A;  1X3E A;  2JA7 H;  2UU9 Q;  1QUQ A;  1E24 A;  4X64 L;  2L15 A;  2B29 A;  4P72 A;  4PZ6 A;  1XNQ L;  2XTI A;  2ALY B;  1Y14 B;  1IXR A;  1UE1 A;  2I0Q A;  3K7A H;  2JA6 H;  2OTJ A;  5C0X J;  3KYH C;  4QY7 A;  1K8G A;  4R4C A;  1KD1 C;  4LF5 Q;  4LF9 Q;  4DR6 L;  4YHH Q;  2F52 A;  1L1O C;  3I56 A;  4DR3 L;  1M1K C;  2R7Z H;  3F1Z A;  2UUB L;  3S17 H;  4UP8 A;  4NXN Q;  3HOZ H;  5M5W H;  1BKB A;  3CCL A;  1TWG H;  2N8N A;  1C9O A;  5AJ3 L;  2E5L L;  3GTG H;  4NXM Q;  1JE5 A;  4BBS H;  2JJQ A;  1YNX A;  1Y1W H;  1PA6 A;  4OWT B;  1I6H H;  4AH6 A;  3HKZ G;  2Q2U A;  1UE5 A;  4QJF A;  3CF5 A;  4XIG S;  4DV6 L;  4A3F G;  3HOY H;  1YVC A;  5LMN Q;  4B3R L;  2UXC L;  5JJL A;  3J81 j;  3CPW A;  3U4V A;  1PH5 A;  1HNZ L;  3CW2 C;  1S72 A;  3I4N G;  1YJ9 A;  2CWA A;  1XNQ Q;  4GS3 A;  1NMG A;  4JCV E;  3T1H Q;  5C0X G;  1TWA H;  2RHS B;  4TQU S;  4GOP A;  1PH6 A;  2FXQ A;  3KDF B;  3AFP A;  4GLV B;  2BH2 A;  5IP9 G;  4BXX G;  1HZC A;  2Q2H A;  3M9B A;  2R93 G;  3OYY A;  3HOX H;  3S1M H;  5EAY A;  1S40 A;  3F2C A;  3CCR A;  4OO1 I;  3B6Y A;  1QVG A;  4A3I H;  4JI3 Q;  3CC4 A;  2I5L X;  5IYC H;  2CCZ A;  2JQO A;  2OTL A;  2VUM H;  2IHE A;  4PZ8 A;  2UXB L;  1GD7 A;  1TWC H;  3HOV H;  1LYL A;  4DV6 Q;  1Q7Y C;  4B3S Q;  2IHF A;  3SGI A;  4B3R Q;  3G6E A;  1HNZ Q;  1UWV A;  2EIF A;  1HZ9 A;  4GKJ L;  3U50 C;  1VQG A;  1YHQ A;  4UPA A;  2JA5 G;  4A3J H;  3CQZ H;  4YY3 L;  2NN6 G;  3GTM H;  2A19 A;  2Z6K A;  1WJJ A;  3EIV A;  4YWK A;  3CCE A;  2MO1 A;  1QZG A;  2LSS A;  4DR4 L;  1QVC A;  2WB1 E;  5C3E H;  2LXJ A;  4LF7 L;  2H5X A;  2OCE A;  3K7U C;  4LW1 A;  3TRZ A;  1SRO A;  1KQS A;  1EFW A;  4Y52 H;  3PSI A;  4PZ7 A;  1VQP A;  2ATW A;  1JJG A;  1VQO A;  1OXX K;  1HJP A;  1KHI A;  4BBR G;  1N33 L;  3BZK A;  2QGQ A;  4A3D H;  4UP9 A;  4C2M H;  1VQ4 A;  2UUA Q;  1Q86 C;  5FJ8 H;  5C44 G;  3LGJ A;  2PQA A;  3E9I A;  5M3M H;  2JE6 I;  1VQL A;  5IYB G;  2QA4 A;  3ZJY C;  4YWM A;  4B3M L;  1Q1B A;  1SE8 A;  2D0O A;  4IPH A;  4QGU A;  1X56 A;  4GNX B;  1FVI A;  1XMQ L;  2I5H A;  2E2H H;  4X6A H;  5GAH C;  2YV5 A;  2CFM A;  4X66 L;  4DKA C;  4A76 A;  2ASB A;  5C4X G;  2PQA B;  1SLJ A;  3F2D A;  4JI6 Q;  2PNH A;  4JBW A;  3HOU G;  1ASZ A;  2MO0 A;  2KCT A;  2KBN A;  4P71 A;  1L0W A;  4DR2 Q;  1VQC A;  3J80 i;  3L0O A;  2D0P A;  4YY3 Q;  2ZJR A;  4LF8 L;  1L2F A;  4LF4 Q;  1Y1V G;  3RN5 A;  1A63 A;  2VL6 A;  3IRB A;  3PO2 G;  4DR4 Q;  4GN4 B;  3RNU A;  4JBJ A;  1YHA A;  4DV5 Q;  4LF7 Q;  3HOW G;  4JOI C;  3CMA A;  4P75 A;  1Q46 A;  4C3J H;  1N36 Q;  3ERS X;  3L2P A;  4YCU A;  5E7N A;  1YJW A;  4A3G G;  3STB C;  4DV3 Q;  3M4O H;  1KIX A;  3EN2 A;  3H3V H;  3I4M G;  4A93 H;  4BY1 G;  3NEM A;  5FLM H;  2YU9 H;  1PYB A;  3MEF A;  2UUC L;  1SMX A;  1BBW A;  2YTY A;  2R92 H;  4DR7 L;  4B3M Q;  4EQ5 A;  1CSP A;  1VQE A;  2DGY A;  3CP0 A;  5IP7 G;  5M3F H;  1VQ5 A;  1GVP A;  1H95 A;  3KLW A;  3RLF A;  2R93 H;  4JBM A;  2KHI A;  2VS1 A;  3PO2 H;  4IFD I;  5IE8 A;  4R4O A;  4RG1 A;  3K0X A;  3I55 A;  3FP9 A;  4XTC S;  4A3E G;  1VQK A;  1RIP A;  4NB3 A;  2ZM6 L;  1E7Z A;  1X3G A;  2Y0S E;  4LFC Q;  3PF4 A;  3J7Z C;  1WI5 A;  4NPS A;  3RLO A;  4HJ7 A;  3J81 c;  4R1J A;  1LUZ A;  2VNU D;  2IX0 A;  2NN6 I;  2WB1 G;  1MKH A;  3ICE A;  1QUQ B;  1G6P A;  1L1O A;  1TWF H;  1E3P A;  5IWA L;  1B7Y B;  1MJC A;  1XNR L;  3UE0 A;  1VQ6 A;  2UUC Q;  3I4O A;  4WJ3 M;  3Q8D A;  4R4T A;  2Q2I A;  1XMO L;  4A3B G;  4HJ9 A;  1EOV A;  4IFD J;  3RR5 A;  1AE2 A;  2UXD L;  4POF A;  2VQF Q;  3W5O A;  1VQN A;  4DR1 L;  1ASY A;  4X65 L;  1IBL Q;  3M7N A;  3G71 A;  1X55 A;  2WAQ E;  3CCJ A;  1IBK L;  1GM5 A;  3UE1 A;  1FJG L;  2OQ0 A;  4X62 Q;  4POG A;  1OXS C;  3AEV A;  4JI1 L;  5GAD C;  4HJA A;  3GTK H;  1UEB A;  1PH4 A;  4X64 Q;  1PHJ A;  3I4N H;  1YJN A;  1I94 L;  2JEA I;  5C4J H;  4JV5 L;  4LUO A;  1BBU A;  3D31 A;  3H0G G;  1BVS A;  3I7F A;  2MQH A;  1RL2 A;  2JA8 G;  1WOC A;  2LXK A;  1D8L A;  2K4K A;  4DR6 Q;  1PYS B;  2MNA A;  2R7F A;  1S3O A;  2C35 B;  2K5V A;  4RMF A;  4DR3 Q;  2ZTC A;  2UUB Q;  5IP9 H;  1XNR Q;  4BXX H;  5K36 G;  1IZ6 A;  1Z9F A;  1JJC B;  4B3T L;  3M4P A;  4IPC A;  4LUV A;  4KI0 A;  3J81 i;  4DV1 L;  4GOP B;  4AQY L;  1JB7 A;  5AJ3 Q;  1XMO Q;  1JJ2 A;  2E5L Q;  2VZA A;  3S1R H;  4AYB E;  1FL0 A;  3TEH B;  5GAE C;  4A3K G;  1KAW A;  4GLA C;  4IFD G;  1I3Q H;  4DUY L;  3CC2 A;  2MFI A;  1T9H A;  4IOA A;  4JI8 L;  1LTL A;  4X65 Q;  4YWL A;  1HZA A;  2RCN A;  3GD7 A;  4TVA B;  1EIY B;  2UXC Q;  4DV7 L;  3KOJ A;  3UDG A;  1FJG Q;  4KHP L;  1AE3 A;  2KHJ A;  5HGQ A;  2JEB I;  2PMZ E;  4KLK A;  2IX1 A;  4OWX B;  1HNW L;  2K5H A;  4GN5 A;  1KXL A;  1YIT A;  2JA5 H;  1EQQ A;  1I94 Q;  3TS2 A;  4GKK L;  1IBM L;  1E1T A;  1G29 1;  4OX9 L;  2HHH L;  1HR0 L;  1E1O A;  2Y0S G;  1X65 A;  3CCU A;  4P73 A;  4DV2 L;  4KHZ A;  2IY5 B;  2NVT H;  2CQO A;  2AKW B;  3BZC A;  4QIW E;  1YIJ A;  1HR0 W;  1IYJ B;  4A4I A;  3TQY A;  4BBR H;  3GTL H;  3KJP A;  1PH9 A;  3HFZ B;  3FKI G;  1XPO A;  1N8R C;  4K0K L;  2OWO A;  3A0J A;  4JYA L;  4DUY Q;  1NBW A;  3PV0 A;  3PUZ A;  5GQO A;  5C44 H;  2F4V L;  2UXB Q;  3AYH B;  4UP7 A;  4JI2 L;  4DR5 L;  4JI0 L;  4DV0 L;  1B70 B;  1HNX L;  3M4Q A;  1OXT A;  4GKJ Q;  3S1Q H;  3PIO A;  5C4X H;  4DPG A;  3H15 A;  1EWI A;  3WWV A;  4JI4 L;  2A8V A;  3PO3 G;  2R7D A;  1HNW Q;  3HOU H;  2WAQ G;  4O0A A;  3DLL A;  1EQR A;  2ZTE A;  4GKK Q;  3HKS A;  1IBM Q;  1HH2 P;  3ER0 A;  3T1Y L;  2RHQ B;  1PFS A;  1V43 A;  1K8A C;  2HHH Q;  4HJ8 A;  2V1C C;  1Y1V H;  4GNX C;  4BY7 G;  3UDF A;  3K81 C;  3S14 H;  2AWO A;  1J5E L;  1MJE A;  4JOI A;  3KF6 A;  1VQH A;  4DV2 Q;  2ID0 A;  3HOW H;  2VW9 A;  4DK3 C;  3S1N H;  1XTD A;  4B3T Q;  1CKM A;  1N33 Q;  3S15 H;  2F3I A;  2I5M X;  4A3G H;  4MTN A;  5IYD G;  1VQB A;  1VQ8 A;  1XPU A;  5M5Y H;  4K0K Q;  4JYA Q;  1D7Q A;  1I50 H;  2AHO B;  3W1G A;  1Q81 C;  3I4M H;  4BY1 H;  2F4V Q;  2IT1 A;  3U4Z A;  1KC8 C;  1EIF A;  4LF6 L;  2NVQ H;  4DV4 L;  1YBY A;  3ULL A;  4LF8 Q;  2KEN A;  1XMQ Q;  1PH2 A;  4DV0 Q;  4AYB G;  4LFB L;  1FGU A;  2E2I H;  1HNX Q;  1VQI A;  1NY4 A;  4X66 Q;  3CAM A;  4DAM A;  5IP7 H;  3F8T A;  4A3L G;  4Y7N H;  4IO9 A;  4P74 A;  2NZO A;  2HIX A;  4O2D A;  4QL5 A;  4IOC A;  4A3F H;  1A8V A;  4A3M G;  3T1Y Q;  3S24 A;  2K14 A;  4LF5 L;  4LF9 L;  4YHH L;  4A3E H;  3F2B A;  4FDB A;  4R4I A;  2VY3 A;  5HY6 A;  1VQ7 A;  4H02 A;  1WYD A;  2BA0 A;  1VQJ A;  1EUJ A;  2NVY H;  2N78 A;  3NEL A;  2B63 G;  4L5T A;  1V1Q A;  3PGZ A;  1O7I A;  1Q12 A;  1VQF A;  4HIK A;  1QVF A;  3RLN A;  3J7A 5;  3UDX A;  2K52 A;  3S2H H;  2HT1 A;  4A75 A;  1CKN A;  4A3C G;  1WCM G;  3A5Z B;  1X9N A;  3U58 A;  3GDE A;  5FLX c;  3OW2 A;  3G48 A;  1MIU A;  2PI2 A;  1V9P A;  4MNO A;  3RZO H;  4DV4 Q;  4DR7 Q;  5LMN L;  1YZ6 A;  1L1O B;  2JA7 G;  4A3B H;  1X54 A;  2HQL A;  3G4S A;  1J6Q A;  2AMC B;  2NZH A;  1PH8 A;  1K9M C;  1HZB A;  2YTV A;  4JI7 L;  2K5N A;  5LMN W;  2JA6 G;  2B3G A;  1PV4 A;  3L7Z C;  1TWH H;  3K8A A;  3KJO A;  3A74 A;  1NTG A;  5IY0 A;  1P8L A;  1Z47 A; 
#chains in the Genus database with same CATH topology
 1D5Z C;  3NQI A;  4GN3 B;  4CKB A;  4HJ5 A;  1O78 A;  2JK8 A;  3HOZ G;  3OWE B;  1A3U A;  2Z4I A;  3VYR A;  5CV4 A;  3AFQ A;  1VS0 A;  2EOT A;  3TP6 A;  5IWA Q;  2BDO A;  4XQN A;  2BE5 D;  5CC4 A;  5FOB B;  2EZV A;  3PUX A;  5K36 H;  1U4P A;  4IJH A;  4J8Q A;  1EEF D;  1JMC A;  2HIV A;  3CCV A;  3DA3 A;  4IFD H;  3PCO B;  5LHY 1;  3GTP H;  3OIQ A;  1PTO B;  1AFP A;  2OEO A;  4CDF C;  4NV2 A;  3K5O A;  4GOP C;  3ULP A;  4I65 A;  1K3R A;  2L4N A;  1YI2 A;  2E75 C;  3C1F A;  4IPD A;  1IL2 A;  5L37 A;  2RF4 A;  1JB3 A;  1LTT D;  3M3Y H;  1I50 B;  1WTP A;  2CKZ B;  1JOQ A;  2WFW A;  2FMC A;  4RCN A;  4DV1 Q;  4AQY Q;  5COR A;  1DCZ A;  2NWG A;  3S2D H;  1TT2 A;  2H4O A;  4A3J G;  4DNI A;  5IYB H;  1P16 A;  3MFG A;  3B55 A;  1QB5 D;  2X6L A;  5KIX A;  1SR3 A;  1QZH A;  3ERQ A;  3R93 A;  4FP5 D;  4JPB W;  4OL7 A;  1U0L A;  1OTC A;  2ES2 A;  4OX9 Q;  2GVB A;  4DV3 L;  5A2Q L;  1GUG A;  1UE7 A;  3MVV A;  1SE3 A;  1OXU A;  1SNO A;  1EIG A;  3TS0 A;  2AQ2 B;  1B8A A;  3GTQ H;  3E0E A;  2B2Y A;  4K8I A;  5ELB A;  3KF6 B;  3I8Z A;  3AB9 A;  4XT3 B;  3OTO Q;  2XTR A;  1XJV A;  2ZW3 A;  2YTX A;  3J7Y W;  2F0F A;  1CT1 D;  3MXG A;  5JJI A;  2QDB A;  1F2L A;  3FMC A;  2RAD A;  3CCQ A;  4JI4 Q;  4FF2 A;  4Z9C B;  3A55 A;  4A3L H;  1K0S A;  4FO2 A;  4OWW B;  1YNJ D;  3CCS A;  2CQA A;  5IGB A;  4OO1 G;  1SRU A;  4CKE A;  4LFA Q;  4DAY B;  3PIO 3;  4A93 G;  3LWE A;  5KYL A;  5FLM G;  2A1A A;  4LNQ A;  4NXN L;  2R92 G;  2EXD A;  1VCI A;  2R93 B;  2LS0 1;  3MEH A;  2K19 A;  2BA1 A;  2K75 A;  4LJZ C;  3H09 A;  5COY A;  1YHB A;  1IBL L;  3S16 H;  5DAU A;  1ENC A;  1SBB B;  3BJU A;  3QWN A;  1QUQ A;  2O4X A;  5KEE A;  4X64 L;  4O42 A;  4PMC A;  3R3O A;  2I0Q A;  4PL4 A;  1SND A;  4U68 A;  2OTJ A;  5C0X J;  4QY7 A;  2RDH A;  2Y0S B;  1STG A;  3M3Y B;  3F1Z A;  3W2D A;  3P7J A;  2A5H A;  2FUG 1;  1V1P B;  5M5W H;  1JQY D;  1OO9 B;  4V19 0;  2E5L L;  3GTG H;  3OPO A;  1PA6 A;  3S2D B;  4OWT B;  3NWT A;  5C44 B;  3CF5 A;  2A6E D;  1XXG A;  1PH5 A;  1S5C D;  1DM0 B;  2EYL A;  1EY8 A;  1BXT A;  3I4N G;  4FF1 A;  1NMG A;  4CBV A;  1PTO D;  4JCV E;  4YZ9 A;  1PH6 A;  2FXQ A;  3AFP A;  3NTK A;  4GLV B;  3S14 B;  1H9J A;  5IP9 G;  3HOW B;  5FO8 B;  3BG3 A;  3M9B A;  3OYY A;  1QNU A;  2HCC A;  3F4M A;  2RA4 A;  1YO7 A;  1GUT A;  4HMI A;  3CC4 A;  5IYC H;  3I4M B;  5T1G A;  1WTR A;  1GD7 A;  4HCS A;  1EU4 A;  2NVQ B;  3HOV H;  1LYL A;  2Z4H A;  3K6O A;  1II3 A;  1DON A;  2EY5 A;  2Q8R E;  4AYB B;  3D4D A;  3OIP A;  1HNZ Q;  4GKJ L;  5I9O A;  3U50 C;  3D4R A;  1K28 A;  1BQQ T;  1FR3 A;  3KLR A;  2NN6 G;  1GJX A;  3EJI A;  1S5F D;  2XIW A;  1SYG A;  2N88 A;  1MHW C;  1R4P B;  4YWK A;  5I2Y A;  2MO1 A;  5JPM C;  2LSS A;  4DR4 L;  2H5X A;  1ML0 D;  3HG9 A;  1F2M A;  1SRO A;  1EFW A;  4PZ7 A;  4FF3 A;  2RSO A;  1HJP A;  4LMQ D;  1SNM A;  1N33 L;  1ICF B;  4O1O A;  4X3K A;  4A3D H;  4C2M H;  1VQ4 A;  5BN4 A;  3HEJ A;  1Q86 C;  3Q22 A;  4ID6 A;  3E6Z X;  3LGJ A;  4IUV A;  5EKL A;  4TRD A;  1I4X A;  4R9W A;  2F4I A;  2SNS A;  3ND9 A;  1IL8 A;  3CU7 A;  4YWM A;  4DK0 A;  4IPH A;  4E6I A;  3S16 B;  1XMQ L;  3K58 A;  2I5H A;  5C4X G;  5E4X A;  2EJM A;  2ASB A;  1SJ8 A;  3FVQ A;  1SLJ A;  3F2D A;  2XRS D;  1ASZ A;  3MAQ A;  1VQC A;  3J80 i;  2ZJR A;  4HEA 1;  2A69 C;  2NB0 A;  3RN5 A;  4PL3 A;  2VL6 A;  4PNY A;  3KLS A;  3IRB A;  3JAM L;  4JBJ A;  3P75 A;  4JOI C;  5IT9 L;  3L2P A;  2PZU A;  2TSS A;  3H0G B;  4DV3 Q;  3IFT A;  3A7L A;  1M4V A;  1M8A A;  2B2W C;  1PYB A;  2KA7 A;  4KY5 A;  1BBW A;  2K05 A;  4EQ5 A;  4YIJ A;  1LV9 A;  3KLW A;  4A3K B;  3RLF A;  2KHI A;  4RG1 A;  3I55 A;  4KMU C;  3KLS X;  1VQK A;  3IKJ A;  3NTI A;  1EYD A;  3J7Z C;  1WI5 A;  1U9R A;  3RLO A;  4N8F A;  1JOO A;  3G7L A;  2IX0 A;  2FHT A;  4WOR A;  4JK1 C;  4X3U A;  1B9N A;  1L1O A;  5JVG 3;  1E3P A;  4PV1 C;  1B7Y B;  1HHV A;  3CRK C;  1SYC A;  3HOV B;  4DWL A;  2A6H C;  1G2T A;  1XMO L;  2Q2I A;  4A3B G;  4HJ9 A;  2RVL A;  3RR5 A;  1AE2 A;  1HA6 A;  2UXD L;  3L0I A;  4KN7 C;  4DNT B;  3QIA A;  3KK7 A;  4KK7 A;  4KKS A;  1IBL Q;  1A3V A;  1LLR D;  3CCJ A;  1IW7 C;  3OOC A;  5EGT A;  2OQ0 A;  4I1T A;  4JI1 L;  4HJA A;  3MTS A;  4X64 Q;  2CH4 W;  1I94 L;  3H94 A;  1BBU A;  3I7F A;  2JA8 G;  1RL2 A;  4C2M B;  4NW2 A;  1V1O A;  5C0X H;  4DXG A;  2MNA A;  4J1M A;  4KV6 A;  4RMF A;  2L1L B;  1XNR Q;  1IZ6 A;  1HCZ A;  1JJC B;  4B3T L;  2E5L Q;  5HGI A;  3S1R H;  1EIH A;  1LTG D;  4H44 C;  3CC2 A;  2F0M A;  3O13 A;  1LTL A;  4JI8 L;  4X65 Q;  5E1F A;  3OWF A;  1HZA A;  2KUM A;  4DV7 L;  3I90 A;  1FJG Q;  2F66 B;  1HQM C;  1KXL A;  2A68 D;  1CTM A;  2JA5 H;  4GKK L;  4DU9 A;  4ME5 A;  1IBM L;  1E1T A;  3V2T A;  5JVH 3;  1HR0 L;  2F0O A;  2NVT H;  1U4R A;  2CH4 A;  2EPB A;  2EDG A;  3MXN A;  4IUU A;  1NNX A;  4BBR H;  4KTA A;  1N8R C;  2OWO A;  3A0J A;  3VR4 A;  4DUY Q;  2LY7 A;  4DR5 L;  1B70 B;  1HNX L;  3EVQ A;  4QMG A;  2PCF B;  3S1Q H;  4GKJ Q;  4U67 3;  5DNF A;  2A8V A;  1EY9 A;  3PO3 G;  1PZK D;  4MHE A;  3HOU H;  3DLL A;  1EQR A;  1ZKO A;  2ZTE A;  3HKS A;  4ZKC B;  3NQT A;  4U6R A;  4HR7 B;  4BY7 G;  4HJ8 A;  4O1N A;  1Y1V H;  3UDF A;  1SMY C;  2AWO A;  1MJE A;  3PO2 H;  1I6H H;  2R7Z B;  5G3L D;  3NPP A;  3D4W A;  1N33 Q;  2B2Y C;  2AUK A;  5G3L F;  4A3G H;  1VQ8 A;  1XPU A;  3ND8 A;  2ETD A;  1A15 A;  2IT1 A;  3HKZ B;  1EIF A;  4DV4 L;  1YBY A;  1TVX A;  2HDM A;  1XMQ Q;  2E2I H;  5IP7 H;  3KBG A;  1Y69 U;  2OXP A;  3VR3 A;  4I7A A;  4ZYS A;  1EZ6 A;  2L9H A;  3RUZ A;  4C3J G;  4IOC A;  2NZ1 D;  4HED A;  3FVV A;  4A3M G;  3S24 A;  2RIO A;  2QIL A;  4A3E H;  2VY3 A;  5KNC A;  1AW7 A;  1B53 A;  1WYD A;  1AZQ A;  2NVY H;  3S1M B;  3NP8 A;  2FMM A;  4KKT A;  3S2H H;  3S1R B;  1B1Z A;  3H91 A;  4A75 A;  2WV6 D;  2VUM B;  3U58 A;  3GDE A;  5FO7 B;  3AU7 A;  1V9P A;  1SEB D;  1MD2 D;  2K7V A;  1GXD C;  2Z9H A;  1IHZ A;  4OGQ C;  4RGO S;  3ERO A;  2NZH A;  3UI2 A;  2F0I A;  2K5N A;  2JA6 G;  1WTQ A;  2JA5 B;  3K8A A;  5M5Y H;  4DF7 A;  3J80 E;  3T1H L;  3CCM A;  1X3F A;  3FDT A;  3T51 B;  3KFU A;  3VDY A;  3RMH A;  1G51 A;  2C5C A;  1PVO A;  1KL9 A;  2JYO A;  3MC0 B;  4BBS G;  4BBR B;  1Y1W G;  2JBW A;  1UE6 A;  2KEE A;  5M5X H;  2BH8 A;  2ZRR A;  3T56 B;  1VQA A;  3S1Q B;  2UXD Q;  4RH6 A;  2DUD A;  1A0I A;  2QDL A;  4LUZ A;  4GLX A;  3CKI B;  5EJW A;  4JI1 Q;  4ALP A;  2ZTD A;  1I6H B;  1LTB D;  2QF7 A;  4ODG A;  3HOX G;  3TP7 A;  2E2J H;  1B3A A;  1KNE A;  4XXE A;  1VQD A;  3VR5 A;  3NBI A;  5GAG C;  1MI2 A;  4A3I G;  2UUA L;  4OON A;  5JEA G;  4A3G B;  1N32 Q;  1E2V A;  3H3V I;  5IGF A;  4QF4 A;  4KD3 A;  3PIP A;  4B3T Q;  3A5U A;  2NVX H;  1Q3L A;  1DGS A;  2WP8 J;  1JE4 A;  2IWH A;  3TRE A;  5M3F B;  2ICE C;  2E2I B;  4DUZ Q;  4HCE A;  4MZ9 A;  3FKI H;  4JI6 L;  4L5Q A;  3OTO L;  3H3V C;  2YFA A;  4JI8 Q;  2QEX A;  3E0J A;  4DV7 Q;  5C3E G;  5EQ0 A;  3CME A;  4IPG A;  4DV5 L;  1SN8 A;  4BA1 I;  4RKL A;  1N36 L;  2NVY B;  1CHP D;  2EY1 A;  4X3S A;  1U5K A;  4LFA L;  2OQK A;  4GNX A;  5FJ8 G;  1HR0 Q;  3S2H B;  2WB1 B;  4YCV A;  5M3M G;  1Q8K A;  3SK4 A;  3MA2 B;  2E8G A;  3ZYY X;  4H7B A;  3U9S A;  1E22 A;  2F03 A;  4JVZ A;  4EQP A;  1C0A A;  4WRD A;  2DY7 A;  1K83 H;  4JC0 A;  1TR5 A;  1C7Y A;  4FXK C;  4DR5 Q;  2OF1 A;  2YYZ A;  4K5W A;  3HZX A;  2B39 A;  4WJ4 A;  3GTK B;  4LFC L;  1W6J A;  4IZ8 A;  1O7Y A;  3R2T A;  1HXY D;  4K5V A;  5C6A A;  5C4J B;  1R9T H;  4JBK A;  1Q82 C;  4L6T B;  1Y8P B;  4CDD C;  1DOM A;  1ZEQ X;  4JV5 Q;  1C4Q A;  1LT3 D;  3DM3 A;  4DN4 M;  1K73 C;  1LT5 D;  4R4Q A;  5M5X B;  1Q1E A;  2Z6B A;  2B63 H;  2EYM A;  3K59 A;  3DUZ A;  4UY8 C;  1KRS A;  2RDG A;  3FHW A;  4I7Z C;  3I2Z A;  2HD3 A;  5EKI A;  1WCM H;  4DAV A;  1F9P A;  1GO3 E;  3KUP A;  1T5X D;  1SXT A;  1AZP A;  4X62 L;  2JA7 H;  2UU9 Q;  1E24 A;  2K5W A;  4PZ6 A;  2EYO A;  2A6H D;  5TSS A;  3NSW A;  2E2J B;  1UE1 A;  3TN2 A;  5IOC A;  2HUG A;  4DR6 L;  1K3B C;  2F52 A;  1L1O C;  3I56 A;  4DR3 L;  4H0L C;  2UUB L;  3S17 H;  3HOZ H;  2NVX B;  1TWG H;  3IAS 1;  5IGC A;  3FKI B;  1IKL A;  2Q2U A;  1UE5 A;  1ZYR D;  4XIG S;  1EFI D;  1RF2 D;  1YVC A;  5JJL A;  1U4M A;  2EJG C;  4HAE A;  5HUR A;  3J81 j;  3U4V A;  5EBD A;  1HNZ L;  3VYT A;  1YJ9 A;  3I4L A;  2CWA A;  2SNM A;  4GS3 A;  4PQX A;  3T1H Q;  1TWA H;  4TQU S;  4DFA A;  3WOF A;  3KDF B;  2F0L A;  2G9H D;  1G91 A;  1QWY A;  5D3D A;  1H9S B;  2R93 G;  1A3T A;  2CW0 C;  1DOL A;  1PDQ A;  3D3R A;  4OO1 I;  2I5L X;  2OTL A;  2JQO A;  4DA2 A;  1K83 B;  2ENB A;  5C4H A;  3SGI A;  4B3R Q;  1S5B D;  3G6E A;  2Q8T A;  1EWH A;  4OEM B;  4UPA A;  1FNW A;  2PZW A;  4A3J H;  3CQZ H;  1R9T B;  2A19 A;  1BCP F;  1WJJ A;  2LMC B;  3CCE A;  1QZG A;  2QGM A;  2DY8 A;  1G6Z A;  4Y52 H;  3PSI A;  3QG1 A;  3L9A X;  4K2K A;  2B63 B;  1XYI A;  3QOJ A;  4UP9 A;  2UUA Q;  5C44 G;  2J4X A;  2PQA A;  3E9I A;  4KHV A;  2JE6 I;  5IYB G;  2X6G A;  5K5P A;  3RZO B;  3ZJY C;  1Q1B A;  3U9O A;  5CYU A;  1X56 A;  2QEJ C;  3J81 E;  1RDP D;  5GAH C;  4A76 A;  2BDN A;  1EY4 A;  4JI6 Q;  2MO0 A;  2KCT A;  2KBN A;  1L0W A;  2WKC A;  3L0O A;  2J0T D;  4YY3 Q;  4MTK A;  1EEI D;  1A63 A;  2F3V A;  5E4W C;  2K32 A;  3F2U A;  4GN4 B;  4LF7 Q;  4DV5 Q;  3HOW G;  4P75 A;  1NCV A;  4F88 A;  3JSB A;  1N36 Q;  3ERS X;  4L8J A;  3HOZ B;  2PZT A;  3L3O C;  1TWG B;  4YCU A;  1UUP A;  1YJW A;  4OO1 H;  1JWM D;  3STB C;  2KCC A;  3M4O H;  1HRJ A;  1KIX A;  3EN2 A;  3I4M G;  3J80 L;  4A93 H;  3E5S A;  4GXT A;  2XNA C;  1SYF A;  4BY1 G;  5FLM H;  5CR3 A;  3MEF A;  3GQB A;  5F2D A;  3R2I A;  2YTY A;  4CKC A;  2E76 C;  2HQE A;  2M00 A;  3ITP A;  3N6R A;  2R92 H;  1VQE A;  2B2U A;  3CP0 A;  4HMJ A;  2L11 A;  1GVP A;  1H95 A;  1TS3 A;  5KNB A;  1TS5 A;  4JBM A;  3GTP B;  5CV7 A;  2EJF C;  4R4O A;  2CVR A;  3K0X A;  3FP9 A;  2EVB A;  1RIP A;  1HFG A;  4NB3 A;  1ILP A;  2Y0S E;  4LFC Q;  1O80 A;  4HJ7 A;  1D2B A;  1RTO A;  2K5D A;  2NN6 I;  3ICE A;  1MKH A;  3M7G A;  1TWF H;  1WTH A;  1XNR L;  3UE0 A;  1L0Y B;  3A8K E;  2UUC Q;  1TU2 B;  3M4Y A;  5ELD A;  1SNC A;  2AQ1 B;  4B9W A;  4RCO A;  2MJ8 A;  1STN A;  4X65 L;  4A3J B;  3CQZ B;  1F2Z A;  3G71 A;  1JWU D;  1FJG L;  2N55 A;  4X62 Q;  4POG A;  1OXS C;  3AEV A;  5GAD C;  1PH4 A;  1LAC A;  1PHJ A;  3I4N H;  1KDB A;  2A74 C;  3H0G G;  5BN3 A;  2MQH A;  4DR6 Q;  4DR3 Q;  3EA6 A;  1Q8I A;  2ZTC A;  2UUB Q;  5IP9 H;  5CV9 A;  2RBM A;  3K5M A;  3GTQ B;  3T53 B;  3DEO A;  3M4P A;  4IPC A;  5E3F A;  4KI0 A;  4GOP B;  1F9R A;  1HA5 A;  1SYE A;  4AYB E;  3TEH B;  4A3K G;  1KAW A;  1FD7 D;  4G57 A;  1I3Q H;  4GLA C;  4DUY L;  3X3M A;  1T9H A;  4LAA A;  2SEB D;  3K5N A;  3AJF A;  5D65 A;  1WVL A;  1EIY B;  3KOJ A;  4KD4 A;  1O7L A;  2Q8I B;  5HGQ A;  2IX1 A;  4KLK A;  4OWX B;  2RQX A;  4GN5 A;  1F9S A;  4DAP A;  4K6L A;  1HFN A;  1EQQ A;  3TS2 A;  5IIF A;  1G29 1;  2NN6 H;  5J39 A;  3M4O B;  3J7A V;  4A93 B;  4S3S A;  1EY7 A;  1S5D D;  1EWC A;  2F0D A;  3WOE A;  2VB2 X;  2IY5 B;  5KND A;  3BZC A;  1HR0 W;  1EYA A;  2R92 B;  4A4I A;  2EE1 A;  3TQY A;  3GTL H;  5CBE E;  3Q0A A;  1QCB D;  1FGB D;  1SE4 A;  5GQO A;  3AYH B;  4UP7 A;  5EPK A;  4JI0 L;  3FNB A;  3VA5 A;  3SDZ A;  1OXT A;  1G8Z D;  3FEW X;  3H15 A;  1D6E C;  1ENF A;  5C4X H;  1EWI A;  2XSC A;  3W3A A;  4C3H G;  3D6C A;  1SNP A;  4O0A A;  5D3I B;  1DJR D;  5FLX E;  5DM7 3;  4GNX C;  1ET6 A;  1TWF B;  3KF6 A;  4EGV A;  4G76 A;  1XTD A;  1SJH D;  3T16 A;  5M5W B;  1NSN S;  3WDN A;  3S15 H;  1NUC A;  2IX3 A;  3GTG B;  4OAV B;  4NV5 A;  2BOS A;  5CV8 A;  5D14 A;  3SDJ A;  5IYD G;  1BUV T;  2F0J A;  2IL8 A;  3BDO A;  4JYA Q;  2AHO B;  3DHQ A;  1Q81 C;  2F4V Q;  1Z6H A;  3S9W A;  4LF6 L;  3SK8 A;  1LO5 D;  3LX0 A;  4TKO B;  4DV0 Q;  2R3Z A;  1FGU A;  4N9T A;  4DAY A;  4P74 A;  4K6D A;  1I4P A;  1PMR A;  3D8G A;  4LF5 L;  1S5E D;  2K01 A;  4YHH L;  1HQR D;  4LF9 L;  3SR1 A;  2DJG C;  3E3X A;  5JJZ A;  3DXJ C;  2KKM A;  1BBX C;  2N78 A;  2PPB C;  4L5T A;  3KP9 A;  1VQF A;  3IAY A;  3UDX A;  2PW7 A;  2HT1 A;  4A3C G;  4QB4 A;  3A5Z B;  3OW2 A;  1MIU A;  4MNO A;  5T1I A;  3EQL C;  5LMN L;  1STE A;  4A3B H;  2QKI C;  1J6Q A;  1PFM A;  4RGT A;  2L5T A;  4R8N A;  1PV4 A;  2YFB A;  3KJO A;  1U4L A;  4A3F H;  1P8L A;  2CAZ B;  1V1P A;  1B9M A;  2R7Z G;  1EZ8 A;  2PW5 A;  1T5E A;  1CSQ A;  4C3I H;  1AH9 A;  1RTN A;  3C1E A;  1TS4 A;  2EY2 A;  4G4K A;  1LAB A;  4MN3 A;  4A3D B;  5DLQ E;  3GTL B;  1AEX A;  1LM0 A;  1TII D;  5JEA J;  2K28 A;  3HP3 A;  2JA8 H;  3BYT B;  1N32 L;  4JI3 L;  4EQO A;  3J7A F;  3HOY G;  1CA5 A;  2ZT9 C;  3PF5 A;  4DUZ L;  2EY6 A;  3DWP A;  2GN5 A;  3IFD A;  4IUR A;  1XX8 A;  2CW0 D;  2JB1 A;  4ZAI A;  3TSS A;  1QNK A;  2XGT A;  2QW7 A;  1JT8 A;  3EBE A;  3GTO H;  3UDI A;  4NMZ A;  4K5X A;  3TDQ A;  3J81 L;  2MJF B;  1KRT A;  4XYQ A;  3JAM c;  3N52 A;  1W2B A;  1KAB A;  2Z1C A;  2N3S A;  1B2T A;  3V96 A;  5IT9 c;  3M85 A;  3S15 B;  4Z7H A;  1Z7T A;  1L0X B;  5HGT A;  2PNR C;  2AWN A;  4RAU C;  2VUM G;  3MHB A;  3BU2 A;  1TXY A;  1BCP C;  1PH1 A;  2R6G A;  4M1U B;  4OXP A;  1B50 A;  5J22 A;  1XPR A;  1ZXT A;  1K0R A;  1JQO A;  2F0E A;  1FNU A;  1YEZ A;  2RDF A;  4OEL B;  1B44 D;  4OIK A;  4G7Z C;  4J15 A;  3GV3 A;  2EYP A;  5ELO A;  4DK6 C;  3QOL A;  3JC6 6;  4FXG C;  3PO3 H;  1NMF A;  1SAP A;  3FBV A;  1ET9 A;  3H6M A;  4XT1 B;  3DMU A;  2VQE Q;  4JV5 L;  4PMW A;  4LWC A;  4BY7 H;  4CDC C;  1EYG A;  2L12 A;  4PG3 A;  4OHJ A;  3HKZ E;  2RKS A;  3JAM i;  1ENA A;  1KLG D;  2KCM A;  3OMC A;  4ZLT F;  4YZD A;  3Q6S A;  2KCN A;  5EKK A;  2IP6 A;  4DGZ A;  1N34 Q;  3TP8 A;  1X6O A;  1W3S A;  4A3F B;  4JI0 Q;  3STB D;  1PH7 A;  2WKD A;  2UU9 L;  4CHT B;  2MGS A;  4JI5 Q;  2XWB B;  2EYF A;  2F0W A;  2L1B A;  1SFO H;  4C3I B;  3NBH A;  2ZJP A;  5GRO A;  1B4O A;  1GOZ A;  4CGY B;  1NJI C;  1STY A;  4NP5 A;  2HDL A;  4A3M H;  5IOD A;  3NEN A;  3GO5 A;  4HIO A;  1GHK A;  1SYD A;  2JN4 A;  2F0H A;  1NR2 A;  5BR8 Q;  4MIU A;  5M3F G;  1Y8N B;  3CXC A;  2K03 A;  1A62 A;  2B2U C;  3RD4 A;  3QJY A;  4EX5 A;  2PQE A;  1FYC A;  3LWU A;  1VDZ A;  2PI2 E;  3BVG A;  3C46 A;  2CHB D;  1G2S A;  3KF8 B;  4LF6 Q;  1MSH A;  2B2V A;  3LJ0 A;  2K50 A;  5LMU Q;  1CKN B;  2QZG A;  1LTA D;  2A2C A;  1JOK A;  2XTI A;  2ALY B;  1Y14 B;  2JA6 H;  3K7A H;  4DK1 A;  1K8G A;  4R4C A;  1KD1 C;  4LF5 Q;  4LF9 Q;  2P5Z X;  4YHH Q;  2NVT B;  4UP8 A;  3TP5 A;  4CJ0 B;  2N8N A;  1C9O A;  1VMP A;  3KBX A;  4NXM Q;  1JE5 A;  2M2L A;  4FVM A;  4BBS H;  4UDU C;  2JJQ A;  1C48 A;  1Y1W H;  4AH6 A;  3T4A C;  1QOH A;  3GV6 A;  4QJF A;  2FJ2 A;  4KJN A;  5LMN Q;  4B3R L;  2UXC L;  3V05 A;  3CPW A;  2R61 A;  1S72 A;  3HOU B;  2BCO A;  1MGS A;  1XNQ Q;  3PO3 B;  3P20 A;  3CHB D;  2A6E C;  4PMB A;  1Y1V B;  4BY7 B;  3PO2 B;  4BXX G;  1HZC A;  2Q2H A;  1Q90 A;  2F0S A;  3HOX H;  4FXD A;  4KY6 A;  3QB3 A;  3F2C A;  2DNE A;  1PTO C;  1QVG A;  3VYU A;  5FLX L;  4A3I H;  4JI3 Q;  2MUY A;  5JEA H;  2UXB L;  3I9V 1;  4DV6 Q;  1Q7Y C;  2IHF A;  1S4Z A;  1BCP B;  4DNR B;  2WII B;  2DNC A;  2FFK B;  4YY3 L;  1PYW D;  5ISR A;  4B08 A;  2F0G A;  2Z6K A;  4A3E B;  1X32 A;  2WB1 E;  1QVC A;  1UEA B;  2LXJ A;  5C3E H;  1GUO A;  3K7U C;  3G6J B;  4LW1 A;  5LL6 S;  1KQS A;  4LF7 L;  2BL7 A;  2RSN A;  1KHI A;  3LJ1 A;  3Q23 A;  2QGQ A;  3URY A;  4K2L A;  1PZJ D;  2B8F A;  5FJ8 H;  4ZKB B;  1VQL A;  5M3M H;  2KEC A;  5JOB A;  2A69 D;  1SE8 A;  4QGU A;  1F2Y A;  2CFM A;  2YV5 A;  4X66 L;  4DKA C;  2PQA B;  4QUF A;  2PNH A;  4JBW A;  4RWS C;  4P71 A;  2MP1 A;  3PIP 3;  1ICW A;  1UNS A;  5M5Y B;  3EFX D;  5JAV A;  3K7A B;  1L2F A;  1PRT F;  1SJE D;  4FYD A;  4C56 C;  1EOT A;  2KHS A;  3RNU A;  1YHA A;  1Q46 A;  2NUC A;  1ROD A;  5I2X A;  5E7N A;  3K5L A;  3MXP A;  4ZK9 B;  3H3V H;  3P1H A;  2VB3 X;  1Y1W B;  3NEM A;  2UUC L;  1QIL A;  4LK1 C;  4B3M Q;  4AS2 A;  1CSP A;  1F9Q A;  3VR2 A;  2XTQ A;  4ULL A;  2JAE A;  4IFD I;  1CFM A;  4RGN A;  4F8M A;  2ZM6 L;  2H1E A;  3NWS A;  3PF4 A;  2I46 A;  4NPS A;  2SDF A;  4R1J A;  1F77 A;  4KY7 A;  1JCK B;  4KJO A;  1QUQ B;  4OAU C;  1H9K A;  4GZY C;  4RHS A;  3BDC A;  3BS1 A;  4RFB A;  1HUN A;  1IW7 D;  1VQ6 A;  2RLD A;  4WJ3 M;  1SYB A;  4R4T A;  3BVM A;  4POF A;  3W5O A;  1W6K A;  4DR1 L;  3M7N A;  2WAQ E;  3UIT A;  1IBK L;  1GM5 A;  4ILW A;  2RCF A;  5C3E B;  1UEB A;  2O2L D;  2WAQ B;  3MXU A;  4LUO A;  3D31 A;  5C5L A;  1HTL D;  1D8L A;  2LXK A;  1PYS B;  1YNN C;  1S3O A;  4Q9V A;  2C35 B;  2K5V A;  2R7F A;  3I72 A;  5M3M B;  5K36 G;  1D1I A;  1Z9F A;  4LUV A;  2R93 H;  1LTS D;  4G75 A;  4X6A H;  1FL0 A;  4IFD G;  3OHX C;  4F87 A;  3PMF A;  3A54 A;  2IJ0 A;  2RCN A;  4TVA B;  4N8X 1;  2UXC Q;  3UDG A;  4KHP L;  1AE3 A;  2EYH A;  1BCP D;  2PMZ E;  2K5H A;  2JB2 A;  2BL8 A;  1YIT A;  1Y8O B;  5ELF A;  2XWJ B;  1E1O A;  2Y0S G;  1X65 A;  2PMZ B;  4P73 A;  3LNN A;  2F0P A;  3NUC A;  4HN7 A;  4C1N I;  3I91 A;  1SE2 A;  1KTK A;  1STA A;  2A68 C;  4OIJ A;  1VMC A;  1IYJ B;  1WTW A;  3KJP A;  1DXM A;  1PH9 A;  1XPO A;  4JYA L;  4UHV A;  1NBW A;  5C44 H;  2F4V L;  1WCM B;  2UXB Q;  4JI2 L;  1A6X A;  4DV0 L;  1J8I A;  2G9D A;  1SMY D;  2JA7 B;  3PIO A;  2I07 B;  4DPG A;  1HNW Q;  1EY5 A;  2FEF A;  1JR0 D;  1K8O A;  1PFB A;  2RHQ B;  1V43 A;  2HHH Q;  3S14 H;  3OW7 A;  1J5E L;  1IKM A;  4DV2 Q;  1VQH A;  4RKB A;  1WD1 A;  3HOW H;  2VW9 A;  4DK3 C;  3S1N H;  3S17 B;  3MZ5 A;  3TZD A;  2D9U A;  2F3I A;  2EXZ A;  4ZRZ A;  2I5M X;  3T13 A;  4RGM A;  4MTN A;  1WTV A;  1VQB A;  4K0K Q;  4H13 C;  3K0Y A;  1LTI D;  3I4M H;  4BY1 H;  2GSC A;  2NVQ H;  5A35 A;  4LFB L;  2KEN A;  4AYB G;  2J7Z A;  3FPU B;  1NY4 A;  4X66 Q;  3CAM A;  3I3C A;  3F8T A;  1RHP A;  4Y7N H;  4A3L G;  2F3W A;  2GA4 B;  2NZO A;  2L0C A;  2HIX A;  1LT6 D;  4QL5 A;  5IGG A;  2B2T A;  5DM6 3;  3T1Y Q;  1TWA B;  2K6A A;  3SE0 A;  4HTH A;  3F2B A;  4FDB A;  4R4I A;  1QE6 A;  2PO4 A;  1TQO A;  4H02 A;  1GHJ A;  2BA0 A;  1VQJ A;  1EUJ A;  3A56 A;  4C1N K;  1STH A;  3PGZ A;  1Q12 A;  4BWG B;  4HIK A;  3J7A 5;  3HS0 C;  3RLN A;  2F1M A;  2K52 A;  5CBA E;  4O1P A;  1X9N A;  2V4D A;  1RKN A;  2WAC A;  1KDC A;  2B2V C;  2K33 A;  1L1O B;  1X54 A;  2HQL A;  2K5Q A;  2O5J C;  1ESR A;  4M8A A;  1K9M C;  3BYY B;  4P2C B;  5LMN W;  2B3G A;  1LT4 D;  4IN3 A;  3L7Z C;  1TWH H;  4IUQ A;  3A74 A;  1NTG A;  2L55 A;  5IY0 A;  1Z47 A;  1HPC A;  5J3B A;  2ZM6 Q;  3VA7 A;  5LL6 X;  1B3Q A;  3H0G H;  1X3P A;  1JOR A;  1I5F A;  3SHL A;  5KYI A;  1FNV A;  1OXV A;  3RZD H;  4HSP A;  4B3S L;  1I6V C;  3PQI A;  1E2Z A;  3K80 C;  4YZC A;  2F0K A;  4A3K H;  4DR1 Q;  3KDF A;  4JI7 Q;  1WTX A;  3DM1 A;  2ICI A;  4WJW A;  1H9S A;  1IBK Q;  1GKH A;  3CD6 A;  1XTC D;  5M9O A;  1TKW B;  4JG2 A;  2ZXO A;  4HFV A;  1EY6 A;  1PTO F;  2VXW A;  4IUP A;  3S1N B;  3GP7 A;  2XMX A;  1NE3 A;  1DZ1 A;  2JB3 A;  2VQE L;  3AQQ A;  2JA9 A;  5IYC G;  4HID A;  3DWQ A;  1GUS A;  3IL8 A;  4YCW A;  1PH3 A;  5NUC A;  4BY1 B;  3J80 c;  2HCI A;  3HOV G;  3E9H A;  3CC7 A;  1CKO A;  3ULJ A;  3K57 A;  4TSS A;  2Z0S A;  4AIM A;  5EPL A;  4UAI A;  4HIM A;  1STB A;  3PUY A;  4Y7N B;  4L5S A;  1E0B A;  5ELN A;  2AQ3 B;  1N34 L;  1D5M C;  4DR2 L;  3PUV A;  1CM9 A;  3MXN B;  1N9W A;  4ZCK A;  2F0Q A;  3I73 A;  4LF4 L;  2N49 A;  2XRQ D;  4KHP Q;  2Z6K C;  4JI5 L;  4B9X A;  4ME3 A;  1VQ9 A;  4C3H H;  1EQV A;  2JXM B;  3RN2 A;  5C3X A;  4A3D G;  4KN4 C;  5H1S E;  3CPF A;  1WTO A;  4K14 A;  2ZJQ A;  1JJG A;  2CWP A;  1PRT C;  2EQS A;  5FK9 C;  5C5M A;  4QQB X;  5I6W A;  4L5R C;  1I4G A;  4IJL A;  5BR8 L;  1VF5 C;  4XQJ A;  4K8J A;  3PUW A;  2Q2T A;  5IYD H;  1SSO A;  3HGB A;  1VQM A;  4BA2 I;  2WIN B;  1M90 C;  1TWH B;  4JI2 Q;  5LMU L;  1TY0 A;  4L63 B;  1WFQ A;  2GVA A;  1CUK A;  3D0F A;  3I4N B;  3W1B A;  3GTJ H;  5C0X I;  5JJK A;  1J5E Q;  3NBH B;  4Q0F A;  5CGK A;  3RZD B;  5BN5 A;  2ZXP A;  4ABN A;  3QR8 A;  4AS3 A;  4NXM L;  1GUN A;  4QCL A;  2VQF L;  1I3Q B;  4A3C H;  4IUN A;  2D62 A;  2DN8 A;  4NKL A;  2QCP X;  1I4H A;  3BVZ A;  4LFB Q;  2F6M B;  4APV A;  1X3E A;  2D2C C;  3D6W A;  5C3W A;  4EQN A;  5I6Y A;  2L15 A;  2B29 A;  2X69 A;  4P72 A;  1XNQ L;  1J9O A;  3NE5 B;  1IYU A;  1IXR A;  2A2D A;  1JIC A;  1ESF A;  3KYH C;  2XVS A;  4G7O C;  1M1K C;  2R7Z H;  4NXN Q;  1BKB A;  3FRP B;  3TBI B;  3CCL A;  4KKU A;  5AJ3 L;  3LJ2 A;  2FIN B;  1YNX A;  3DWA A;  3HKZ G;  3I70 A;  4J6H A;  4F7X A;  4DV6 L;  3MWY W;  4A3F G;  1WD0 A;  3HOY H;  3FPP A;  1AN8 A;  1YNN D;  2V6E A;  5CMD A;  1PXU A;  5C4X B;  1A2T A;  2NBF A;  3SEB A;  3CW2 C;  1O7Z A;  2OT2 A;  4JW0 A;  4C3I G;  4RA8 A;  4C3H B;  2BE5 C;  2F0N A;  2JSO A;  1ZYR C;  5DEH A;  1CQV A;  5C0X G;  2RHS B;  4GOP A;  2Z8L A;  5I9P A;  5KGU A;  2BH2 A;  1E2W A;  2PYK A;  3QO2 A;  1D1K A;  1A2U A;  3S1M H;  5EAY A;  1S40 A;  3CCR A;  1KNA A;  1KAA A;  3B6Y A;  3NXW A;  5JPN C;  4PL5 A;  2CCZ A;  2VUM H;  2IHE A;  4PZ8 A;  1ILQ A;  1TWC H;  3TZU A;  1XWE A;  3NHH A;  4B3S Q;  1UAP A;  1UWV A;  2EIF A;  1HUM A;  1HZ9 A;  1VQG A;  1YHQ A;  2KQ3 A;  2JA5 G;  1IYV A;  1H9R A;  3GTM H;  3CRL C;  1KDA A;  1RJT A;  2E74 C;  3EIV A;  3GTJ B;  1GUW A;  1MSG A;  3TRZ A;  1PLF A;  2OCE A;  1K8M A;  4V0B A;  1VQP A;  2ATW A;  1VQO A;  1OXX K;  2SOB A;  4BBR G;  2K04 A;  3BZK A;  4IUT A;  2M9V A;  1TY2 A;  2QA4 A;  4B3M L;  2D0O A;  4GNX B;  4LF8 L;  1FVI A;  2E2H H;  4A3B B;  2G5D A;  1PRT B;  5IGD A;  3HOU G;  4DR2 Q;  2D0P A;  4CJ2 C;  1QJO A;  1CA6 A;  4LF4 Q;  3Q24 A;  1Y1V G;  1TS2 A;  3PO2 G;  4DR4 Q;  3CMA A;  1CK1 A;  4C3J H;  1TDP A;  1PZI D;  3A8J E;  4A3G G;  2JA8 B;  3A7A B;  4ZUI A;  1DD2 A;  2YU9 H;  2ZXR A;  1SMX A;  1NAP A;  3HOY B;  4CDE C;  1YNJ C;  4DR7 L;  1H9M A;  2DGY A;  5IP7 G;  2EYJ A;  5M3F H;  1VQ5 A;  4CJ1 B;  1BOS A;  3A8I E;  1I4Q A;  1KLU D;  2VS1 A;  4WFN 3;  5IE8 A;  5CV6 A;  1VF7 A;  5A2Q E;  2B2T C;  3DA4 A;  1BF4 A;  4XTC S;  4FF4 A;  4A3E G;  3P23 A;  3GTO B;  2P22 B;  1V8Q A;  2KVM A;  1E7Z A;  1X3G A;  4XYO A;  3J81 c;  1LUZ A;  1RD9 D;  2NYZ D;  2VNU D;  5CV5 A;  2WB1 G;  5FKA C;  1G6P A;  5IWA L;  2MHV A;  1MJC A;  4NDX A;  4Z7G A;  1C8C A;  1TWC B;  1MBY A;  3OSO A;  3I4O A;  2KED A;  5J1Z A;  3Q8D A;  1EOV A;  1SNQ A;  5FO9 B;  4IFD J;  2VQF Q;  1VQN A;  1ASY A;  5AFW A;  1X55 A;  3GTM B;  1RCV D;  3UE1 A;  2KJX A;  1BR9 A;  1R4Q B;  4FNF A;  1CQF A;  1NR4 A;  3DO9 A;  3GTK H;  1YJN A;  2JEA I;  3HRZ C;  5C4J H;  1PFN A;  3BZD B;  1BVS A;  1WOC A;  2K4K A;  4BXX H;  3J81 i;  4DV1 L;  4AQY L;  3SXH A;  1JB7 A;  5AJ3 Q;  1XMO Q;  5ELC A;  5ELE A;  2VZA A;  1JJ2 A;  2E2H B;  5GAE C;  2MFI A;  2LKV A;  2KOL A;  4IOA A;  4YWL A;  1BDO A;  3VYS A;  3GD7 A;  4DXF A;  5EBC A;  2KHJ A;  2JEB I;  1SDF A;  1HNW L;  1SFO B;  4C3J B;  3NK9 A;  1I94 Q;  3C2P A;  4OX9 L;  2FU2 A;  2HHH L;  4A3M B;  3CCU A;  1JC7 A;  4IAL A;  4N9P A;  1QG7 A;  3DEP A;  4DV2 L;  2TMP A;  4IQZ A;  4KHZ A;  2YU9 B;  2E2D C;  2QSB A;  2CQO A;  2AKW B;  4QIW E;  1YIJ A;  2A73 B;  3SVM A;  1LTR D;  3HFZ B;  3FKI G;  4K0K L;  3NTH A;  4RHR A;  2C9O A;  4BS9 A;  4ZQ3 A;  2IW3 A;  3PV0 A;  3PUZ A;  2DJF C;  3IAM 1;  4QIW B;  5C4Z A;  1AP0 A;  2F0V A;  3M4Q A;  2D5D A;  1PRT D;  5IGE A;  3VR6 A;  3WWV A;  4JI4 L;  2NTT A;  1ONL A;  2R7D A;  4ZUJ A;  1EU3 A;  2WAQ G;  4X3T A;  2JA6 B;  2HGK A;  1PTO H;  4GKK Q;  3VA9 A;  1HH2 P;  3ER0 A;  1IBM Q;  3T1Y L;  2IPK D;  1PFS A;  2O5I C;  5LNK 1;  1BO0 A;  1DYQ A;  1K8A C;  2V1C C;  3K81 C;  4JOI A;  2ID0 A;  5KRU A;  1CKM A;  4XDX A;  1D5X C;  3X3N A;  4BBS B;  1D7Q A;  2B2W A;  1I50 H;  1HTP A;  3W1G A;  4R8I A;  3U4Z A;  2F0T A;  3TME A;  1KC8 C;  4EVO A;  2JP1 A;  3ULL A;  4LF8 Q;  1PH2 A;  3C3L A;  1BNZ A;  2NTS A;  1HNX Q;  1VQI A;  4DAM A;  1CZW A;  4Q5V A;  1EY0 A;  4IO9 A;  3BDL A;  3OMG A;  4O2D A;  1DOK A;  5I4D A;  2XN9 C;  1A8V A;  2AUJ D;  2K14 A;  3AMU A;  4HSV A;  2B8G A;  5HY6 A;  1VQ7 A;  5EPJ A;  2LFN A;  1EL0 A;  3HOX B;  3NEL A;  2B63 G;  3SK6 A;  1V1Q A;  3MFY A;  1O7I A;  3KF8 A;  1QVF A;  2K1B A;  1EQT A;  3ONA B;  4XQQ A;  1CKN A;  4A3I B;  2MPM A;  1CHQ D;  1EYC A;  1WCM G;  5FLX c;  3G48 A;  3SK5 A;  4G7H C;  2PI2 A;  3RZO H;  3JAM E;  4DV4 Q;  4DR7 Q;  1YZ6 A;  1CI3 M;  1JWS D;  2JA7 G;  3R8B A;  1X3Q A;  3G4S A;  5IT9 E;  2AMC B;  1PH8 A;  1HZB A;  2F0U A;  2YTV A;  4JI7 L;  4QUC A;  1I4R A;  1CZG A; 
#chains in the Genus database with same CATH homology
 3T1H L;  5J3B A;  3CCM A;  1X3F A;  4GN3 B;  2ZM6 Q;  3KFU A;  2R7Z G;  3VDY A;  1G51 A;  4HJ5 A;  2JK8 A;  1CSQ A;  4C3I H;  3HOZ G;  1AH9 A;  1PVO A;  1KL9 A;  3AFQ A;  3H0G H;  5DLQ E;  1LM0 A;  4BBS G;  1VS0 A;  5JEA J;  1Y1W G;  2JA8 H;  1I5F A;  1N32 L;  4JI3 L;  5IWA Q;  1UE6 A;  3HOY G;  3PUX A;  1OXV A;  3RZD H;  5M5X H;  4IJH A;  4B3S L;  2BH8 A;  2ZRR A;  1JMC A;  3PF5 A;  4DUZ L;  2HIV A;  3K80 C;  3CCV A;  4YZC A;  1VQA A;  2GN5 A;  2UXD Q;  3DA3 A;  4A3K H;  4DR1 Q;  3KDF A;  2DUD A;  1A0I A;  3PCO B;  2JB1 A;  4JI7 Q;  3GTP H;  4LUZ A;  2XGT A;  4GLX A;  1IBK Q;  1JT8 A;  1GKH A;  3CD6 A;  3EBE A;  3GTO H;  4NV2 A;  4JG2 A;  3UDI A;  4GOP C;  3ULP A;  1K3R A;  4HFV A;  4JI1 Q;  4ALP A;  1YI2 A;  4IPD A;  2ZTD A;  2MJF B;  1IL2 A;  1KRT A;  3JAM c;  3HOX G;  2XMX A;  1NE3 A;  1W2B A;  2E2J H;  2N3S A;  3M85 A;  5IT9 c;  1VQD A;  4Z7H A;  5GAG C;  2JB3 A;  2UUA L;  2VQE L;  2RF4 A;  2JA9 A;  3AQQ A;  4OON A;  5JEA G;  5IYC G;  4HID A;  2AWN A;  4A3I G;  2VUM G;  1N32 Q;  3M3Y H;  3BU2 A;  1TXY A;  3H3V I;  2CKZ B;  4YCW A;  1PH3 A;  3J80 c;  3HOV G;  3E9H A;  1PH1 A;  3PIP A;  2WFW A;  3CC7 A;  2R6G A;  1CKO A;  3ULJ A;  3A5U A;  4DV1 Q;  4AQY Q;  2Z0S A;  4OXP A;  1DGS A;  2WP8 J;  2NVX H;  3TRE A;  4AIM A;  1XPR A;  4HIM A;  4DUZ Q;  1K0R A;  4MZ9 A;  3FKI H;  3S2D H;  3PUY A;  4JI6 L;  4L5S A;  4A3J G;  5ELN A;  4L5Q A;  3OTO L;  1N34 L;  1YEZ A;  2YFA A;  4JI8 Q;  4DNI A;  4DR2 L;  3PUV A;  3MXN B;  5IYB H;  1N9W A;  4J15 A;  1P16 A;  4LF4 L;  2N49 A;  2QEX A;  4DV7 Q;  4KHP Q;  5C3E G;  2Z6K C;  5ELO A;  3CME A;  1SR3 A;  4JI5 L;  4DK6 C;  1QZH A;  4IPG A;  4DV5 L;  4ME3 A;  1VQ9 A;  3JC6 6;  3PO3 H;  1SN8 A;  1NMF A;  4BA1 I;  4C3H H;  1N36 L;  3RN2 A;  1U0L A;  1OTC A;  2ES2 A;  4A3D G;  3FBV A;  5H1S E;  4OX9 Q;  1U5K A;  4LFA L;  2OQK A;  2GVB A;  3CPF A;  5FJ8 G;  4DV3 L;  2VQE Q;  4GNX A;  1UE7 A;  1HR0 Q;  2CWP A;  4LWC A;  4PMW A;  2ZJQ A;  4YCV A;  5M3M G;  1EYG A;  4BY7 H;  1OXU A;  2EQS A;  1Q8K A;  4PG3 A;  3TS0 A;  4QQB X;  4L5R C;  1B8A A;  3HKZ E;  4IJL A;  3JAM i;  5BR8 L;  3GTQ H;  2KCM A;  2E8G A;  3E0E A;  3PUW A;  1E22 A;  4YZD A;  3KF6 B;  1C0A A;  2Q2T A;  5IYD H;  2IP6 A;  1K83 H;  4JC0 A;  1VQM A;  3OTO Q;  1N34 Q;  4BA2 I;  2XTR A;  1XJV A;  1X6O A;  1M90 C;  1C7Y A;  2YTX A;  4JI2 Q;  1W3S A;  4DR5 Q;  4JI0 Q;  3STB D;  5LMU L;  1PH7 A;  5JJI A;  2YYZ A;  1WFQ A;  2UU9 L;  2GVA A;  4JI5 Q;  4WJ4 A;  3CCQ A;  4LFC L;  1CUK A;  4JI4 Q;  3D0F A;  4A3L H;  4OWW B;  1SFO H;  3W1B A;  3CCS A;  2ZJP A;  5GRO A;  4JBK A;  1R9T H;  1Q82 C;  4OO1 G;  1NJI C;  1SRU A;  4LFA Q;  4DAY B;  3GTJ H;  4A3M H;  3NEN A;  4A93 G;  4JV5 Q;  5FLM G;  2A1A A;  3DM3 A;  3GO5 A;  5C0X I;  4HIO A;  1J5E Q;  4LNQ A;  3NBH B;  5JJK A;  4NXN L;  1K73 C;  2R92 G;  2EXD A;  4R4Q A;  1VCI A;  1Q1E A;  5BR8 Q;  2B63 H;  4UY8 C;  5M3F G;  2K19 A;  4AS3 A;  1KRS A;  2BA1 A;  4NXM L;  3CXC A;  1A62 A;  2VQF L;  3FHW A;  2K75 A;  3I2Z A;  4A3C H;  4EX5 A;  2D62 A;  1WCM H;  1YHB A;  2PI2 E;  1IBL L;  3KF8 B;  3S16 H;  4LF6 Q;  3LJ0 A;  1GO3 E;  4LFB Q;  2K50 A;  5LMU Q;  2F6M B;  1CKN B;  4X62 L;  3BJU A;  4APV A;  1X3E A;  2JA7 H;  2UU9 Q;  1QUQ A;  1E24 A;  2A2C A;  4X64 L;  2L15 A;  2B29 A;  4P72 A;  4PZ6 A;  1XNQ L;  2XTI A;  2ALY B;  1Y14 B;  4PL4 A;  1IXR A;  1UE1 A;  2A2D A;  3K7A H;  2I0Q A;  2JA6 H;  2OTJ A;  5C0X J;  3KYH C;  4QY7 A;  1K8G A;  4R4C A;  1KD1 C;  4LF5 Q;  4LF9 Q;  4DR6 L;  4YHH Q;  2F52 A;  1L1O C;  3I56 A;  4DR3 L;  1M1K C;  2R7Z H;  3F1Z A;  2UUB L;  3S17 H;  4UP8 A;  2FUG 1;  4NXN Q;  3HOZ H;  5M5W H;  1BKB A;  3CCL A;  1TWG H;  2N8N A;  3IAS 1;  1C9O A;  5AJ3 L;  2E5L L;  4NXM Q;  3GTG H;  1JE5 A;  4BBS H;  2JJQ A;  3LJ2 A;  1YNX A;  1Y1W H;  1PA6 A;  4OWT B;  1I6H H;  4AH6 A;  3HKZ G;  2Q2U A;  1UE5 A;  4QJF A;  3CF5 A;  4XIG S;  4DV6 L;  4A3F G;  3HOY H;  1YVC A;  5LMN Q;  4B3R L;  2UXC L;  5JJL A;  2V6E A;  3J81 j;  3CPW A;  3U4V A;  1PH5 A;  1HNZ L;  3CW2 C;  1S72 A;  3I4N G;  1YJ9 A;  2CWA A;  1XNQ Q;  4GS3 A;  1NMG A;  4JCV E;  4YZ9 A;  3T1H Q;  5C0X G;  1TWA H;  2RHS B;  4TQU S;  4GOP A;  1PH6 A;  2FXQ A;  3KDF B;  3AFP A;  4GLV B;  2BH2 A;  5IP9 G;  4BXX G;  1HZC A;  2Q2H A;  3M9B A;  2R93 G;  3OYY A;  3HOX H;  3S1M H;  5EAY A;  1S40 A;  3F2C A;  3F4M A;  3CCR A;  1YO7 A;  4OO1 I;  3B6Y A;  1QVG A;  4A3I H;  4JI3 Q;  3CC4 A;  2I5L X;  5IYC H;  4PL5 A;  2JQO A;  2CCZ A;  2OTL A;  2IHE A;  4PZ8 A;  2VUM H;  2UXB L;  1GD7 A;  1TWC H;  3HOV H;  1LYL A;  3I9V 1;  4DV6 Q;  1Q7Y C;  4B3S Q;  2IHF A;  3SGI A;  4B3R Q;  3G6E A;  1HNZ Q;  1UWV A;  2EIF A;  1HZ9 A;  4GKJ L;  3U50 C;  1VQG A;  1YHQ A;  4UPA A;  2JA5 G;  4A3J H;  3CQZ H;  4YY3 L;  2NN6 G;  3GTM H;  2A19 A;  2Z6K A;  1WJJ A;  3EIV A;  4YWK A;  3CCE A;  2MO1 A;  1QZG A;  2LSS A;  4DR4 L;  1QVC A;  2WB1 E;  5C3E H;  2LXJ A;  4LF7 L;  2H5X A;  2OCE A;  3K7U C;  4LW1 A;  3TRZ A;  1SRO A;  1KQS A;  1EFW A;  4Y52 H;  3PSI A;  4PZ7 A;  1VQP A;  2ATW A;  1JJG A;  1VQO A;  1OXX K;  1HJP A;  1KHI A;  4BBR G;  3LJ1 A;  4O1O A;  3BZK A;  1N33 L;  2QGQ A;  4A3D H;  4UP9 A;  4C2M H;  1VQ4 A;  2UUA Q;  1Q86 C;  5FJ8 H;  5C44 G;  3LGJ A;  2PQA A;  3E9I A;  5M3M H;  2JE6 I;  1VQL A;  5IYB G;  2QA4 A;  3ZJY C;  4YWM A;  4B3M L;  1Q1B A;  1SE8 A;  2D0O A;  4IPH A;  4QGU A;  1X56 A;  4GNX B;  1FVI A;  1XMQ L;  2I5H A;  2E2H H;  4X6A H;  5GAH C;  2YV5 A;  2CFM A;  4X66 L;  4DKA C;  1SJ8 A;  4A76 A;  2ASB A;  5C4X G;  2PQA B;  1SLJ A;  3F2D A;  4JI6 Q;  2PNH A;  4JBW A;  3HOU G;  1ASZ A;  2MO0 A;  2KCT A;  2KBN A;  4P71 A;  1L0W A;  4DR2 Q;  1VQC A;  3J80 i;  3L0O A;  2D0P A;  4YY3 Q;  2ZJR A;  4LF8 L;  4HEA 1;  1L2F A;  4LF4 Q;  1Y1V G;  3RN5 A;  4PL3 A;  2VL6 A;  1A63 A;  3IRB A;  3PO2 G;  4DR4 Q;  4GN4 B;  3RNU A;  4JBJ A;  1YHA A;  4DV5 Q;  4LF7 Q;  3HOW G;  4JOI C;  3CMA A;  4P75 A;  1Q46 A;  4C3J H;  3JSB A;  1N36 Q;  3ERS X;  3L2P A;  4YCU A;  5E7N A;  1YJW A;  4A3G G;  3STB C;  4DV3 Q;  3M4O H;  1KIX A;  3EN2 A;  3H3V H;  3I4M G;  4A93 H;  4GXT A;  4BY1 G;  3NEM A;  5FLM H;  2YU9 H;  1PYB A;  3MEF A;  2UUC L;  1SMX A;  1BBW A;  2YTY A;  2R92 H;  4DR7 L;  4B3M Q;  4EQ5 A;  4AS2 A;  1CSP A;  1VQE A;  2DGY A;  3CP0 A;  5IP7 G;  5M3F H;  1VQ5 A;  1GVP A;  1H95 A;  3KLW A;  2XTQ A;  3RLF A;  2R93 H;  2JAE A;  4JBM A;  2KHI A;  2VS1 A;  3PO2 H;  4IFD I;  5IE8 A;  4R4O A;  4RG1 A;  3K0X A;  3I55 A;  3DA4 A;  3FP9 A;  4XTC S;  4A3E G;  3P23 A;  2P22 B;  1VQK A;  1RIP A;  4NB3 A;  2ZM6 L;  1E7Z A;  1X3G A;  2Y0S E;  4LFC Q;  3PF4 A;  3J7Z C;  1WI5 A;  4NPS A;  3RLO A;  4HJ7 A;  3J81 c;  4R1J A;  1LUZ A;  2VNU D;  2IX0 A;  2NN6 I;  2WB1 G;  1MKH A;  3ICE A;  1QUQ B;  1G6P A;  1L1O A;  1TWF H;  4OAU C;  1E3P A;  5IWA L;  1B7Y B;  1MJC A;  4Z7G A;  1XNR L;  3UE0 A;  1VQ6 A;  2UUC Q;  3I4O A;  4DWL A;  4WJ3 M;  3Q8D A;  4R4T A;  2Q2I A;  1XMO L;  4A3B G;  4HJ9 A;  1EOV A;  4IFD J;  3RR5 A;  1AE2 A;  2UXD L;  3L0I A;  4POF A;  2VQF Q;  3W5O A;  1VQN A;  4DR1 L;  1ASY A;  4X65 L;  1IBL Q;  3M7N A;  3G71 A;  1X55 A;  2WAQ E;  3UIT A;  3CCJ A;  1IBK L;  1GM5 A;  3UE1 A;  1FJG L;  2OQ0 A;  4X62 Q;  4POG A;  4I1T A;  1OXS C;  3AEV A;  4JI1 L;  5GAD C;  4HJA A;  3DO9 A;  1UEB A;  1PH4 A;  3GTK H;  4X64 Q;  1PHJ A;  3I4N H;  1YJN A;  1I94 L;  2JEA I;  5C4J H;  4JV5 L;  4LUO A;  1BBU A;  3D31 A;  3H0G G;  1BVS A;  3I7F A;  2MQH A;  1RL2 A;  2JA8 G;  1WOC A;  2LXK A;  1D8L A;  2K4K A;  4DR6 Q;  1PYS B;  2MNA A;  1S3O A;  4Q9V A;  2C35 B;  2K5V A;  2R7F A;  4RMF A;  4DR3 Q;  2ZTC A;  2L1L B;  2UUB Q;  5IP9 H;  1XNR Q;  4BXX H;  5K36 G;  1IZ6 A;  1Z9F A;  1JJC B;  4B3T L;  3M4P A;  4IPC A;  4LUV A;  4KI0 A;  3J81 i;  4DV1 L;  4GOP B;  4AQY L;  1JB7 A;  5AJ3 Q;  1XMO Q;  1JJ2 A;  5HGI A;  2VZA A;  2E5L Q;  4G75 A;  3S1R H;  4AYB E;  1FL0 A;  3TEH B;  5GAE C;  4A3K G;  1KAW A;  4GLA C;  4IFD G;  1I3Q H;  4DUY L;  3CC2 A;  2MFI A;  1T9H A;  4IOA A;  4JI8 L;  1LTL A;  4X65 Q;  4YWL A;  1HZA A;  2RCN A;  3GD7 A;  3AJF A;  4TVA B;  1EIY B;  2UXC Q;  4DV7 L;  3KOJ A;  3UDG A;  1FJG Q;  4KHP L;  1AE3 A;  2KHJ A;  5HGQ A;  2JEB I;  2PMZ E;  4KLK A;  2F66 B;  4OWX B;  2IX1 A;  1HNW L;  2K5H A;  4GN5 A;  1KXL A;  2JB2 A;  1YIT A;  2JA5 H;  1EQQ A;  1I94 Q;  3TS2 A;  4GKK L;  1IBM L;  1E1T A;  1G29 1;  4OX9 L;  2HHH L;  1HR0 L;  1E1O A;  2Y0S G;  1X65 A;  3CCU A;  4P73 A;  4DV2 L;  4KHZ A;  2IY5 B;  2NVT H;  2CQO A;  2AKW B;  3BZC A;  4QIW E;  1YIJ A;  1HR0 W;  1IYJ B;  4A4I A;  3TQY A;  4BBR H;  3GTL H;  3KJP A;  1PH9 A;  3HFZ B;  3FKI G;  1XPO A;  1N8R C;  4K0K L;  2OWO A;  3A0J A;  4JYA L;  4DUY Q;  1NBW A;  3PV0 A;  3PUZ A;  5GQO A;  5C44 H;  2F4V L;  2UXB Q;  3AYH B;  4UP7 A;  3IAM 1;  4JI2 L;  4DR5 L;  4JI0 L;  4DV0 L;  1B70 B;  1HNX L;  3M4Q A;  1OXT A;  4GKJ Q;  3S1Q H;  3PIO A;  5C4X H;  4DPG A;  3H15 A;  1EWI A;  3WWV A;  4JI4 L;  2A8V A;  3PO3 G;  2R7D A;  1HNW Q;  3HOU H;  2WAQ G;  4O0A A;  3DLL A;  1EQR A;  2ZTE A;  4GKK Q;  3HKS A;  3VA9 A;  1HH2 P;  3ER0 A;  1IBM Q;  3T1Y L;  4U6R A;  2RHQ B;  1PFS A;  1V43 A;  5LNK 1;  1K8A C;  2HHH Q;  4HJ8 A;  2V1C C;  1Y1V H;  4GNX C;  4BY7 G;  3UDF A;  3K81 C;  3S14 H;  2AWO A;  1J5E L;  1MJE A;  4JOI A;  3KF6 A;  1VQH A;  4DV2 Q;  2ID0 A;  3HOW H;  2VW9 A;  4G76 A;  4DK3 C;  1XTD A;  3S1N H;  4B3T Q;  1CKM A;  1N33 Q;  3S15 H;  2F3I A;  2I5M X;  4OAV B;  4NV5 A;  4A3G H;  3SDJ A;  4MTN A;  5IYD G;  1VQB A;  1VQ8 A;  1XPU A;  5M5Y H;  4K0K Q;  4JYA Q;  1D7Q A;  1I50 H;  2AHO B;  3W1G A;  1Q81 C;  3I4M H;  4BY1 H;  2F4V Q;  2IT1 A;  3U4Z A;  1KC8 C;  1EIF A;  4LF6 L;  2NVQ H;  4DV4 L;  1YBY A;  3ULL A;  4LF8 Q;  2KEN A;  1XMQ Q;  1PH2 A;  4DV0 Q;  4AYB G;  4LFB L;  1FGU A;  2E2I H;  1HNX Q;  1VQI A;  1NY4 A;  4X66 Q;  3CAM A;  4DAM A;  5IP7 H;  3F8T A;  4A3L G;  4Y7N H;  4IO9 A;  4P74 A;  2NZO A;  2HIX A;  4O2D A;  4QL5 A;  4IOC A;  4A3F H;  1A8V A;  4A3M G;  3T1Y Q;  3S24 A;  2RIO A;  2K14 A;  4LF5 L;  4LF9 L;  4YHH L;  4A3E H;  3F2B A;  4FDB A;  4R4I A;  2VY3 A;  5HY6 A;  1VQ7 A;  4H02 A;  1WYD A;  2BA0 A;  1VQJ A;  1EUJ A;  2KKM A;  2NVY H;  2N78 A;  3NEL A;  2B63 G;  4L5T A;  1V1Q A;  3PGZ A;  1O7I A;  3KP9 A;  1Q12 A;  1VQF A;  4HIK A;  3RLN A;  1QVF A;  3J7A 5;  3UDX A;  2K52 A;  3S2H H;  2HT1 A;  4A75 A;  1CKN A;  4A3C G;  1WCM G;  4O1P A;  3A5Z B;  1X9N A;  3U58 A;  3GDE A;  5FLX c;  3OW2 A;  3G48 A;  1MIU A;  2PI2 A;  1V9P A;  4MNO A;  3RZO H;  4DV4 Q;  4DR7 Q;  5LMN L;  1YZ6 A;  1L1O B;  2JA7 G;  4A3B H;  1X54 A;  2HQL A;  3G4S A;  1J6Q A;  2AMC B;  2NZH A;  1PH8 A;  1K9M C;  1HZB A;  2YTV A;  4JI7 L;  2K5N A;  5LMN W;  2JA6 G;  2B3G A;  1PV4 A;  3L7Z C;  2YFB A;  1TWH H;  3K8A A;  3A74 A;  1NTG A;  5IY0 A;  1P8L A;  3KJO A;  2CAZ B;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...