2E8GA

The structure of protein from p. horikoshii at 1.7 angstrom resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
MWDTSKDYRLLVAEKSVELFIRTIEGAKFRGQWDKKRSIQLAKEMIPDIQALRYSYIDPEELVDTPQMKDLKEKAKGIIEALGGEDWHHKFLSQASREDREKVEEQVARIKFFLNTILNLDRRLKLGKINDPVIAVDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVTNDLTVKEGNRVAVALLPPRNFFGIVSEGMFLGAGEGVLKNVKGEIGGLPKGIPLEALNETRNAVEAFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Hypothetical protein PH0536
publication title Structure of protein PH0536 from Pyrococcus horikoshii at 1.7 A resolution reveals a novel assembly of an oligonucleotide/oligosaccharide-binding fold and an alpha-helical bundle
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 81
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF18489 Alpha_Helical Alpha helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.150 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2e8gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e8gA02
1N33Q 1X54A 3UDGA 4DR1Q 5IYBH 1XMOQ 1L1OC 3K7UC 4LWCA 1VQKA 3G4SA 4NXNQ 1PVOA 5M5WH 4GOPB 4AYBG 3KDFB 2UXCQ 4GKJL 3I4OA 5IYCG 5JJIA 4JI6L 1N36L 4EX5A 3NEMA 2JA6H 4IFDG 3S17H 3BZCA 1CKNA 3TS0A 2VQEQ 1VQDA 3GTJH 4POGA 2IX0A 2CKZB 1N9WA 2EQSA 4TVAB 2MFIA 2R7DA 4PG3A 1KD1C 3WWVA 4KHPL 4GNXC 2HQLA 1QVGA 3TQYA 1A8VA 4LF9Q 3HOXH 4DV4L 2ID0A 4YWLA 4LFAQ 1R9TH 2K14A 3J81i 3D0FA 1GKHA 3KYHC 4LUVA 2L15A 2K5HA 2BH8A 3EN2A 3JAMc 3S1MH 3KOJA 1MIUA 4AYBE 4DV6L 2UUAL 2K75A 1EYGA 4XIGS 3G48A 1XPOA 4PZ8A 4HJ7A 2YV5A 1WFQA 2RF4A 1Q1EA 5IYDG 1C7YA 2JE6I 4OWTB 4O2DA 3TEHB 4GOPA 3HOVG 3KDFA 2IY5B 4IOCA 3FKIG 5H1SE 1AE2A 4HIMA 1VQNA 1X3EA 1P16A 2C35B 4JI1Q 1TWGH 3AYHB 3PUVA 4DUYL 4LF6Q 2D0PA 1IL2A 4AIMA 2D62A 1BBWA 3CCUA 1WCMG 4GLXA 1D8LA 1QVFA 1KQSA 5EAYA 2HT1A 4IFDJ 5C0XJ 1YIJA 1GM5A 1VQOA 3T1YL 4OX9Q 1I6HH 3I2ZA 1LUZA 4GN3B 3F1ZA 5ELOA 4DR4Q 3M7NA 1IBLQ 4IOAA 4K0KL 1NY4A 2NVTH 4R4OA 5GAHC 1VQ8A 4WJ4A 5IWAQ 5FLMG 1IBKQ 3PCOB 4YHHL 3K8AA 1JJ2A 2JA7G 3RZDH 2LXJA 2UXDL 4NPSA 4A3MG 4MNOA 4X62L 3CCMA 1NTGA 2Z0SA 3CP0A 2JEAI 4H02A 1VQMA 4IPHA 3S1RH 1AH9A 1HNZL 5IYDH 1YJ9A 3HOVH 2D0OA 2UU9L 1FL0A 4JI4L 4DR7Q 1K3RA 3FKIH 3RLNA 1NJIC 2K4KA 3PSIA 4Y7NH 5AJ3L 4LF8L 4LUZA 3HOUG 4DV2L 1N32Q 2Z6KA 3HKZG 4DV7Q 4L5QA 4A76A 4A3JH 4L5SA 2ATWA 1K83H 4R4TA 5E7NA 4LF5L 1WCMH 1FJGQ 4GS3A 2E5LL 4LFCL 4LUOA 2E2IH 3ULJA 1YITA 4B3SQ 2OQKA 4IJLA 1I50H 4DR3Q 2VUMG 2OQ0A 4QL5A 2GVAA 4DV5Q 2KHJA 4LF7L 4A3KH 4IJHA 1C0AA 2JK8A 3CC4A 4A75A 5M3MG 3OTOL 1PH7A 5FLMH 3CC2A 2KCMA 2ASBA 1MJCA 4GKKL 3W1GA 4P71A 1GO3E 5C4JH 1P8LA 4JI7L 4JV5L 4JYAL 2B29A 3DLLA 3HKZE 4DUZL 3CCLA 1Y1VH 1PYBA 2N3SA 1PH6A 2JJQA 4DV1L 3W5OA 4KLKA 1YHQA 1E3PA 4DR2L 3HOUH 4DV3L 4JBKA 4R4CA 2F52A 4DPGA 2PQAB 5C4XG 3AQQA 1KL9A 4X64Q 2GN5A 1NMFA 1VQCA 1BBUA 1U5KA 1WOCA 1HZBA 2DUDA 4JG2A 5IP7G 3D31A 3PF5A 3HOZH 3KF8B 3AFQA 3H15A 2YTXA 2JQOA 4JI2Q 2QA4A 4HIOA 1VQLA 1SR3A 3I7FA 4NXMQ 4LF4L 3S15H 1XMQQ 2NVYH 3OYYA 3J81j 5LMUQ 5M3MH 1SRUA 2XGTA 4DR5L 4X66L 3PO2G 4LFBL 1MJEA 1T9HA 3ER0A 2VL6A 1A62A 1DGSA 4AH6A 1HNXL 3FP9A 3E9IA 4OO1I 3CXCA 4GKJQ 1VQBA 1YVCA 3CD6A 4JI6Q 3CCJA 1N36Q 3E9HA 3UE1A 1OXTA 1K8AC 4A3GG 3I4MG 3F2BA 1HR0L 5M3FG 1HZAA 3PUXA 3F2DA 4HJ5A 1YZ6A 1JJGA 3S14H 4YCUA 5C0XG 1PH5A 4C2MH 2YTVA 5C4XH 3JAMi 2UUCL 1H95A 1X9NA 1C9OA 1EIYB 5IP7H 3A74A 1QUQA 4JI5L 1HNWL 4RG1A 4O0AA 1YNXA 4UPAA 1G6PA 1NBWA 1S40A 1W3SA 2N78A 1X3FA 4C3HH 4HIKA 2VY3A 1FGUA 4P72A 1Y14B 4R4QA 3ULLA 3PO2H 2YTYA 4BY1H 2ALYB 2KENA 1UE5A 1I94L 1N33L 1VQGA 1EUJA 2A8VA 2BA0A 1L0WA 1S3OA 4PZ7A 2MO1A 4BBSG 1CSQA 3KLWA 1JT8A 5FLXc 1VQ9A 5IE8A 4A3GH 1VQPA 5IY0A 3I4MH 2EIFA 2XTIA 2FXQA 3BJUA 5M3FH 2K5NA 3H3VI 1LTLA 5J3BA 3M4QA 2WAQG 2OTLA 4A3JG 3CCVA 3RNUA 4DAYB 1EIFA 3E0EA 4JOIC 4AQYL 4JI8L 3TS2A 3Q8DA 1B8AA 1X56A 4P73A 3F2CA 3J7A5 2KBNA 1IZ6A 2ZJPA 4JBMA 1WI5A 4LF9L 2UXDQ 1TWHH 5GADC 4A3KG 1KHIA 1HR0W 2QGQA 3M9BA 4J15A 4DK6C 1K73C 1EOVA 4PMWA 1G51A 1XPUA 3CCEA 4JBJA 2MQHA 2VQFQ 1CKMA 2I5LX 1YEZA 2PI2E 4B3MQ 3GTOH 1YHAA 1UE7A 1HNZQ 1L1OB 4C3IH 2JA8G 4YCWA 5BR8L 2UU9Q 4JI3Q 3G6EA 1OTCA 1PH3A 3ICEA 1B7YB 1XNRL 1YBYA 4DV2Q 2ES2A 1A63A 2JA9A 4MTNA 3CAMA 4OONA 1Y1VG 1J5EL 1TWAH 1KIXA 4BBSH 1EQRA 4JI1L 1ASZA 4OXPA 2ZM6L 1N34L 3UDXA 2R7ZG 2E5LQ 1X3GA 2ZJQA 1I5FA 4LFCQ 3RLOA 3ZJYC 3MEFA 1HZCA 3CMAA 1MKHA 3UDIA 2K5VA 4DV0L 1UWVA 3CQZH 4GNXB 4ALPA 2A19A 4OX9L 3HOZG 1SN8A 2IHFA 1LYLA 3NENA 2E8GA 4DR4L 2H5XA 2IT1A 2RCNA 3OTOQ 4HJ8A 1K9MC 1XNQQ 2UUBQ 4OWXB 3F8TA 4GKKQ 4YCVA 3SGIA 1KRTA 3CCRA 3CC7A 1V43A 3AEVA 1WYDA 2Y0SG 2K52A 3BU2A 3EIVA 4JI7Q 4JV5Q 5C44H 1Q86C 1KC8C 3CF5A 1L1OA 1M90C 2F4VL 4DR6L 3A5UA 2V1CC 4B3TQ 2JA8H 4C3JH 1XJVA 3S2DH 4JCVE 1JMCA 1HH2P 4GOPC 2LXKA 3J80c 4A93G 4DNIA 4DV3Q 2BA1A 4KHZA 4TQUS 2N49A 3GTLH 2VW9A 3CPWA 4L5TA 4DV7L 1SMXA 2Q2UA 1VQJA 2R6GA 3L0OA 4PZ6A 4YY3Q 1VCIA 2R7ZH 4YWKA 1OXUA 5GQOA 2KHIA 4GNXA 5LMNL 4A4IA 4LF4Q 4QIWE 5FJ8G 3B6YA 1Q81C 2LSSA 2NVQH 1LM0A 4X65Q 5JJLA 5GAEC 3T1HL 2F3IA 3HOYG 2Y0SE 3LGJA 1I3QH 3HFZB 4LFBQ 2UXBQ 2HHHL 4JI0Q 3PUYA 2NZOA 2IHEA 1HNXQ 2VZAA 2I5HA 4A3EG 2AHOB 2DGYA 3IRBA 3OW2A 1IBML 4A3BG 1IXRA 2ZTDA 2CFMA 4LW1A 4BY1G 3RLFA 2YU9H 5GAGC 4A3FG 2NVXH 3I4NG 3S16H 4B3RL 3GTPH 1W2BA 4A3IG 1S72A 3GTKH 1PHJA 4BXXH 2MNAA 1N8RC 2CCZA 4Y52H 1E1TA 4BBRG 4XTCS 1JB7A 4A93H 1O7IA 4FDBA 4BY7H 3U4ZA 2Z6KC 1JE5A 5IT9c 3EBEA 3PIOA 4A3LG 1PH4A 1UEBA 2A1AA 2Q2IA 4A3CG 3HOWG 2AWOA 2PQAA 1PH2A 1J6QA 1BVSA 2R93G 4KHPQ 2K50A 4GLAC 2IX1A 2CWPA 1PA6A 1WJJA 5FJ8H 4DV4Q 4L5RC 4NXML 2RHQB 3H0GH 3ERSX 3HKSA 3RR5A 2WB1G 2MO0A 4GN5A 4UP7A 5C3EG 3H3VH 2EXDA 2PNHA 3U58A 5ELNA 1I94Q 4DV6Q 2UUAQ 3RN5A 3CMEA 3ULPA 4QQBX 1RIPA 4A3EH 1K0RA 4A3BH 5LMNW 5HGQA 2PI2A 1K8GA 4NXNL 4DR1L 3VDYA 4A3FH 3CCQA 1XMOL 3I4NH 3PO3H 4A3IH 1PH1A 4OWWB 2UXCL 4BBRH 1OXXK 1V9PA 3W1BA 5IP9G 1QZHA 4DUYQ 1QVCA 2R7FA 1PV4A 2HIVA 1IYJB 4R1JA 4AQYQ 1GVPA 1PH9A 4JI8Q 3I56A 2VQEL 3HOYH 4A3LH 4A3CH 4IPDA 3HOWH 2WB1E 3A0JA 4UP8A 1SE8A 3I55A 2VNUD 3T1YQ 2R93H 4WJ3M 1VQFA 1SLJA 1QZGA 4K0KQ 1M1KC 3NBHB 2B63G 1U0LA 2CQOA 2WFWA 4YHHQ 1Y1WH 4LFAL 1SFOH 3K80C 2BH2A 4POFA 3RZOH 1A0IA 3GD7A 4X62Q 5C3EH 2NN6I 1NMGA 5DLQE 3STBD 1XTDA 4P75A 5BR8Q 2Q2TA 2KCTA 3K7AH 3S1NH 3J7ZC 1VQHA 5C44G 2HIXA 1XNRQ 1EFWA 3J81c 3CPFA 3GTQH 1J5EQ 5IYCH 2R92G 1CUKA 3UE0A 3PIPA 2VS1A 1E22A 3MXNB 2ZM6Q 1N34Q 4JI4Q 2Q2HA 5AJ3Q 2RHSB 3K81C 4KI0A 4LF8Q 1RL2A 4A3DG 1EQQA 3GTGH 1Q7YC 1E7ZA 2WAQE 1YHBA 2E2JH 5IP9H 4ME3A 5JEAG 3M85A 3U50C 2ZJRA 4DV0Q 4LF5Q 4LF6L 4X6AH 3DM3A 1X6OA 1VQ5A 1E1OA 1VQ7A 1GD7A 4OO1G 1UE6A 1UE1A 3KF6B 3K0XA 3KJOA 1PH8A 2E2HH 5JJKA 4LF7Q 4BA2I 3BZKA 2ZTEA 1Z47A 3FHWA 3GDEA 2AWNA 1ASYA 1PYSB 1OXVA 4GN4B 2GVBA 1IBLL 1VQIA 5M5XH 2B63H 1PFSA 1Q46A 3M4OH 4IFDI 5GROA 3J80i 5IWAL 5C0XI 1JJCB 3CCSA 1IBKL 2F4VQ 4DR6Q 2VQFL 4B3ML 3A5ZB 1KRSA 3S2HH 4QY7A 4JI3L 3PV0A 2OTJA 4JBWA 2QEXA 4JYAQ 3PUWA 4DUZQ 4QJFA 1NE3A 2R92H 4EQ5A 4BXXG 1Q82C 4DV1Q 4DR2Q 4DR7L 1Q1BA 4A3DH 2OCEA 4BY7G 1N32L 4RMFA 2JA5G 1TXYA 1EWIA 3TRZA 1Z9FA 5LMNQ 1VS0A 4GLVB 4NB3A 1G291 2B3GA 3JC66 1V1QA 1YI2A 3KF6A 3T1HQ 4UY8C 1FJGL 3UDFA 1BKBA 3M3YH 5JEAJ 1XNQL 4B3SL 4UP9A 1TWCH 2HHHQ 4DR3L 2UUBL 1KXLA 4DV5L 3H0GG 2JA7H 4MZ9A 1HJPA 3U4VA 4A3MH 1VQEA 1IBMQ 2NZHA 4IPGA 4BA1I 4DR5Q 4X66Q 3KFUA 1Q8KA 2ZTCA 4IO9A 4YWMA 3STBC 5IYBG 4B3RQ 1X65A 4R4IA 3PUZA 4JC0A 4B3TL 5HY6A 1L2FA 1SROA 3GTMH 1VQ6A 1E24A 3G71A 4IPCA 2N8NA 2JA6G 3PO3G 1KAWA 4HJ9A 1AE3A 3PGZA 1HR0Q 1CKNB 2AKWB 2NN6G 1VQAA 3NELA 2I0QA 1X55A 2I5MX 3GO5A 3L7ZC 4P74A 1VQ4A 1D7QA 4YY3L 3CW2C 2JA5H 1YJWA 1FVIA 4JOIA 1CSPA 1TWFH 3M4PA 5M5YH 1HZ9A 3AFPA 4HIDA 4HJAA 1OXSC 3RN2A 4DK3C 2UUCQ 1QUQB 2VUMH 4X64L 2OWOA 2CWAA 3HOXG 1XPRA 3S24A 3PF4A 5K36G 4LNQA 4X65L 4JI5Q 1HNWQ 1CKOA 2AMCB 4DKAC 2JEBI 4QGUA 2YYZA 4JI2L 2UXBL 3L2PA 1YJNA 4JI0L 2PMZE 3TREA 4APVA 4DAMA 1Y1WG 1XMQL 3KJPA 3S1QH 2WP8J 5LMUL 1Q12A 1B70B
chains in the Genus database with same CATH superfamily
1X54A 1XMOQ 4NXNQ 1LO5D 2PZTA 4KTAA 2RDGA 4AYBG 3KDFB 1SMYC 5IYCG 5A2QE 1LT3D 3NEMA 3BZCA 5IGGA 4LAAA 5EJWA 1VQDA 4POGA 1TVXA 2B8FA 1II3A 4K8JA 2EQSA 2R7DA 4PG3A 4KHPL 1HQRD 4LF9Q 4TRDA 2ID0A 1F2ZA 4XQQA 5LNK1 2A74C 2BH8A 4ULLA 3ND9A 1A3TA 1S5ED 2L12A 3G48A 3RD4A 1SNQA 3G6JB 4RGMA 4IURA 1WFQA 5IYDG 5IGDA 2EXZA 2JEAI 2D2CC 3TEHB 4UDUC 4GOPA 1ICFB 3S16B 2IY5B 1S5DD 3D4WA 3A55A 3K57A 3PUVA 5C0XH 4LF6Q 3AU7A 4AIMA 2EYPA 4HCEA 1KQSA 3R2TA 5C0XJ 4OX9Q 2LS01 3I2ZA 1CQFA 4R4OA 5CR3A 5GAHC 1VQ8A 4WJ4A 4CJ0B 1YO7A 3WDNA 1JJ2A 2JA7G 3J80E 4A3MG 1EU3A 2VXWA 2Z0SA 2PMZB 4HCSA 3CP0A 4XDXA 5HGIA 3L9AX 1VQMA 3HOVH 2M2LA 1JE4A 3VR6A 3P23A 5C5MA 3PO3B 3FPUB 1K3RA 5JPMC 1SNOA 1NJIC 4Y7NH 3HOUG 1DYQA 2B2UC 2Z6KA 2EJFC 3AB9A 4L5SA 4A76A 4A3JH 2ATWA 1ENAA 2NBFA 2B2VA 5E7NA 1FJGQ 2E5LL 1SE2A 5ELBA 3HOXB 1YITA 1R9TB 2OQKA 4IJLA 4DR3Q 4DV5Q 2JK8A 3CC4A 4A75A 2DJGC 5M3MG 2GSCA 2CH4A 2KCMA 4MIUA 2ASBA 2K33A 5CV4A 2F0TA 5C3XA 5C4JH 2F0UA 1A6XA 4KJOA 1HUMA 1NR2A 1PYBA 3UITA 2AUKA 1KABA 4JBKA 2F52A 1XYIA 2BDOA 4DPGA 2GN5A 1BBUA 3HOZH 2A6EC 2DUDA 2QCPX 3KF8B 2YTXA 1VQLA 4NXMQ 1GHJA 2M9VA 2ZXOA 2NVYH 3HG9A 4C3HG 2XIWA 1JICA 4X66L 5I4DA 4AH6A 1HNXL 1QILA 3E9IA 1EL0A 1PZJD 2XWBB 3CRLC 1BXTA 1K8AC 4A3GG 1D1KA 2XWJB 5M3FG 3I90A 3T53B 2F0JA 1EYAA 1HZAA 1WTXA 5C0XG 2PW7A 2YTVA 2IJ0A 1I50B 1C9OA 2K03A 4A3KB 1ZXTA 1LACA 4XQNA 4G7ZC 4O0AA 2Z8LA 2JA7B 2K5QA 1NBWA 2HDLA 1W3SA 4H13C 1PTOF 2K05A 2SNSA 2VY3A 4P72A 1I94L 1VQGA 2F4IA 4CDFC 3K5NA 3BZDB 4WORA 1D1IA 3HOUB 1JT8A 3MVVA 2F1MA 3QO2A 1VQPA 2O5IC 2B2YA 3N52A 2K5NA 3BVMA 1LTLA 5J3BA 2WAQG 4A3JG 3CCVA 3RNUA 1UEAB 3E0EA 4AQYL 1SXTA 2A6HC 1A15A 1B8AA 1X56A 4P73A 2ZJPA 4JBMA 1BDOA 3PQIA 5M3MB 1HR0W 3M9BA 4DK6C 1AP0A 4M1UB 1EOVA 4PMWA 1XPUA 1MSHA 1CKMA 2I5LX 3GTOH 5EBDA 1TIID 4C3JG 4JI3Q 3F2UA 3I8ZA 2ES2A 2JA9A 1U4MA 2KJXA 2LFNA 3CAMA 1J5EL 1ET9A 1ASZA 3G7LA 4C1NK 2E5LQ 1X3GA 2ZJQA 1I5FA 3V96A 1CHPD 1PTOC 1HZCA 4OELB 5F2DA 1O80A 4ALPA 5IOCA 3HOZG 1LYLA 1PZKD 1ZKOA 2B2TC 3J7AF 2RCNA 2H1EA 1E2ZA 4C3HB 1ET6A 1SYBA 1V43A 3BU2A 2F03A 1LT6D 1KC8C 1L1OA 2F4VL 3A5UA 1D5ZC 1F2LA 4A3GB 1GOZA 4KJNA 4A93G 5M3FB 2VW9A 3GQBA 1WD1A 5CMDA 4DV7L 3HRZC 4X3UA 1VCIA 2R7ZH 2G5DA 4IZ8A 1QE6A 3QG1A 4OO1H 2CAZB 4L63B 4GNXA 2D9UA 2WB1B 4DU9A 2FUG1 1TWHB 3ERQA 1QB5D 2NVQH 3B6YA 1Q81C 2LSSA 5JJLA 2F3IA 2BDNA 3LGJA 1F9SA 4ZAIA 4JI0Q 4L6TB 2NZOA 2RQXA 1HNXQ 2GA4B 2VZAA 4G75A 4YZDA 2I5HA 4A3EG 2AHOB 2DGYA 1VMCA 3QWNA 2CFMA 3FDTA 4ZQ3A 3RLFA 2DN8A 4CKBA 4B3RL 1C4QA 3J7YW 3GTKH 4Y52H 1E1TA 1K8MA 1JB7A 2IW3A 2XN9C 2EYHA 3U4ZA 1JE5A 3KUPA 1F77A 2WAQB 3EBEA 3PIOA 4A3JB 2PYKA 5ISRA 4AS2A 3HOWG 1TS4A 2AWOA 1PH2A 1BVSA 2IX1A 3MFGA 2K5DA 4L5RC 1TDPA 4H44C 2D5DA 3H0GH 3RR5A 3CHBD 5C3EG 4DN4M 1SYEA 5EKIA 2EYMA 1I94Q 1V1PB 1TS2A 1KTKA 4C3JB 3S2DB 3A7AB 2X6GA 1K8GA 2M00A 4DR1L 4KKSA 2SOBA 4TKOB 4A3FH 1CZGA 1PH1A 3R3OA 1EIHA 4OWWB 2PW5A 4BBRH 4DUYQ 1HPCA 4AQYQ 1GVPA 4FF1A 4A3LH 3HOYH 3OOCA 4ZKBB 4IPDA 2QF7A 3HOZB 3A0JA 1SE8A 1EYCA 1R4PB 1HA6A 1I3QB 1CTMA 1QZGA 2AQ2B 4K0KQ 1EY9A 2NVYB 2WFWA 4YHHQ 4IUQA 1Y1WH 5DLQE 2Z4IA 1XTDA 2YU9B 2KCTA 2B39A 3R93A 2NVXB 3FVVA 1VQHA 3J81c 3GTQH 1J5EQ 4A93B 3PIPA 1WD0A 3DXJC 4CJ2C 2KOLA 3TP5A 1E7ZA 5IP9H 1O7YA 5FK9C 2ZJRA 2ICEC 1X6OA 1VQ7A 1GD7A 4OO1G 1BO0A 1UE1A 1X32A 1LTTD 4C1NI 1Z47A 3MTSA 1OXVA 2B63H 4GXTA 1VQIA 1YNJC 5C0XI 1STHA 4A3EB 1IBKL 2F4VQ 1B53A 4L8JA 4B3ML 3FPPA 5EGTA 3QR8A 4QY7A 3MAQA 1WTOA 4JYAQ 1SMYD 3PUWA 4HN7A 4NW2A 4DUZQ 2KUMA 1E0BA 1NE3A 3DMUA 1PZID 1N32L 2JA5G 3HOWB 3IL8A 1EZ8A 1Z9FA 1VS0A 1S5BD 5C5LA 1U4PA 5BN4A 3I3CA 5IGFA 3KF6A 1MI2A 2K04A 3L3OC 1XNQL 1JC7A 1WTWA 5C3EB 3H0GG 4MZ9A 1VQEA 4IPGA 3VA7A 1TY2A 4DR5Q 5IYBG 4B3RQ 1X65A 4JC0A 1TY0A 2N8NA 3DEPA 2E2JB 4OL7A 3LJ1A 3SDZA 3E6ZX 1PLFA 2AKWB 2I5MX 1D7QA 2JB3A 1VQ4A 3CW2C 1B4OA 1FVIA 4JOIA 2UUCQ 3HOYG 3J81L 3IFTA 1B44D 5COYA 1OXSC 2VUMH 1ILPA 2MGSA 2F0GA 3U9OA 4JI5Q 1HNWQ 4DKAC 4RKBA 2FMCA 3L2PA 1ML0D 5FLXE 4KN4C 1Y1WG 1XMQL 1SAPA 1MBYA 5E4WC 1VF5C 3KJPA 1Q12A 4DR1Q 1GHKA 1RKNA 2CH4W 5FO8B 5JJIA 1N36L 3L0IA 1NUCA 4RHSA 5LL6S 2NN6H 2IX0A 4PNYA 1N9WA 2KEEA 4F7XA 3DA3A 1B3AA 2B8GA 3NQIA 3WWVA 1QVGA 3TQYA 1A8VA 5AFWA 3HOXH 3OPOA 4YWLA 2Q8RE 1R9TH 1GKHA 4WFN3 1JOKA 2L15A 3JAMc 1H9RA 3P1HA 1WTRA 5IIFA 5JVH3 2ENBA 1EYGA 1U4LA 4XIGS 4PZ8A 2XVSA 3GTMB 2RF4A 1AZQA 2JE6I 5I2XA 5H1SE 1AE2A 4HIMA 2EE1A 1P16A 5J1ZA 3UI2A 2JA5B 5M5YB 1IL2A 1FYCA 4GLXA 1WCMG 1Z7TA 1A2TA 2HT1A 2FU2A 1YIJA 1VQOA 3T1YL 3A8JE 3V2TA 1ONLA 4N8FA 3F1ZA 4DR4Q 1NY4A 3S1QB 1IBKQ 3RZDH 4QCLA 4MNOA 4X62L 2EY5A 4N8X1 2G9HD 4F8MA 4O42A 2DY7A 1AH9A 5IYDH 3WOFA 2UU9L 3DUZA 2O4XA 5AJ3L 4LF8L 1N32Q 2F0LA 3HKZG 2Q8TA 4L5QA 5CBAE 4R4TA 1TU2B 2XSCA 4KMUC 4LF5L 3HP3A 4GS3A 4LFCL 4LUOA 1G2SA 3A8IE 3NPPA 2NUCA 1B1ZA 1I50H 2VUMG 4QL5A 2GVAA 4LF7L 1IYUA 4A3KH 4IUTA 5KNDA 4HSVA 3OTOL 3E5SA 2KQ3A 2OT2A 4FF4A 3VYTA 1MJCA 2KCCA 3W1GA 1PFBA 3RMHA 1T5EA 1ZEQX 4JI7L 2B29A 1EY7A 2N88A 2RA4A 3CU7A 2JJQA 3W5OA 1YHQA 3JAML 1E3PA 3HOUH 1V8QA 1S5FD 1RDPD 1KL9A 4ZUJA 1NMFA 4QMGA 3AJFA 2A6HD 1WOCA 4HMJA 5IP7G 4HIOA 3R8BA 1EU4A 1K3BC 1IKLA 4G7OC 1XMQQ 5M3MH 4PV1C 1STGA 3OMGA 3V05A 1MJEA 1EY8A 1DGSA 3S1RB 3FP9A 4OO1I 2L11A 2PQEA 1VQBA 3CCJA 1N36Q 1AZPA 1AW7A 3I4MG 5IGBA 4R8IA 4J1MA 4OGQC 1K83B 1DD2A 1WCMB 5EPJA 1PH5A 1PTOD 4KY5A 3D6WA 3D8GA 4ID6A 3Q6SA 1EIYB 2Z4HA 3A74A 2JAEA 1B9NA 4EVOA 4RG1A 1GUNA 1H9MA 1G6PA 4HIKA 4K5WA 4C3HH 1Y69U 1FGUA 3ULLA 4BY1H 4C3IG 5DAUA 1N33L 3VA9A 2MO1A 4CBVA 4BBSG 3KLWA 3Q0AA 4A3GH 4FO2A 3BYYB 3HKZB 2OXPA 2FXQA 3BJUA 3KLSX 5M3FH 3OIPA 2ETDA 1C8CA 2OTLA 2NTTA 4IUPA 4J8QA 2IL8A 4DAYB 3BDOA 1JWMD 2VUMB 2MP1A 1IKMA 5E1FA 3F2CA 3DHQA 5CBEE 3K5MA 1KLUD 2RVLA 1TWHH 4A3KG 3H09A 4J15A 5ELDA 1K73C 5EKKA 1HUNA 3CCEA 4V0BA 1XX8A 1XXGA 5C4HA 4RFBA 1YHAA 2FFKB 1EYDA 2K01A 5BR8L 2UU9Q 1WTVA 3G6EA 1XNRL 1A63A 3R2IA 1D2BA 5G3LF 3IFDA 4JI1L 4ZYSA 4OXPA 4C2MB 1BCPF 2HD3A 3OIQA 2MHVA 3UDXA 2OF1A 2X69A 4LFCQ 4X3KA 2EVBA 1VDZA 3SR1A 3K59A 2DJFC 1DOLA 4OIJA 3UDIA 4MN3A 2LKVA 1UWVA 4DV0L 1SN8A 2IHFA 5C4ZA 4MTKA 2JYOA 3OTOQ 4HJ8A 3BVZA 2UUBQ 5KRUA 1RTOA 4K5XA 3AEVA 2Y0SG 4JI7Q 1F2YA 3NSWA 1Q86C 4NDXA 4C3JH 3S2DH 3I4MB 2LXKA 4YZCA 3J80c 4DNIA 4TQUS 3P75A 2L55A 2Q2UA 1VQJA 2R6GA 3L0OA 4YY3Q 4ZCKA 4YWKA 5LMNL 4G4KA 1IL8A 4QIWE 4X65Q 1WTPA 1I3QH 4ILWA 2UXBQ 2HHHL 3RZDB 5M9OA 4C3IB 2QSBA 3KP9A 3OW2A 1BCPC 1O78A 4LW1A 4HMIA 4BY1G 1Y8OB 2V6EA 2YU9H 1B2TA 4BBSB 2NVXH 1TWAB 1W2BA 1JB3A 4DAPA 1PHJA 2CCZA 4EGVA 4RCNA 3GV6A 1I4XA 4A93H 1O7IA 5JAVA 1R4QB 3I91A 1PH4A 2BE5C 1UEBA 3A7LA 2Q2IA 4A3CG 4FF2A 5HURA 2PQAA 1J6QA 2NZ1D 5EKLA 2R93G 1NCVA 4GLAC 4KHPQ 2QW7A 4FP5D 3HZXA 2CWPA 2RHQB 2K19A 3ERSX 3HKSA 1DONA 2WB1G 2MO0A 3VYRA 1YNJD 2K1BA 4G76A 2QGMA 1PXUA 3U58A 5ELNA 1A2UA 1KDCA 2PPBC 5CV9A 4QQBX 1RIPA 4A3EH 4UHVA 1STAA 1K0RA 1EIGA 1QNUA 3OW7A 5IGEA 2YFAA 3CCQA 2B2UA 2F0OA 2L1BA 2UXCL 3BDCA 3I73A 4QUCA 1V9PA 1QZHA 1QVCA 5IGCA 4RGOS 3I56A 2VQEL 1AFPA 5FO7B 3HOWH 3LWUA 1EWHA 4UP8A 3I9V1 3I55A 3J80L 3SHLA 2TMPA 4LFAL 2SEBD 3K80C 2Y0SB 3GD7A 5C3EH 2NN6I 5BR8Q 2Q2TA 4LMQD 2HIXA 1XNRQ 3GTPB 2F0HA 4CGYB 2R92G 1CUKA 1Q8IA 3UE0A 4BY7B 1E22A 1CA5A 2Q2HA 1IYVA 2RHSB 3BDLA 4KI0A 4A3DG 1JOOA 1TQOA 1YHBA 4WRDA 2R61A 4ZLTF 2E2JH 5JEAG 3U50C 4DV0Q 4X6AH 3DM3A 3P20A 1VQ5A 2K28A 1SDFA 3IAYA 3NBHA 1ASYA 3OWFA 3ITPA 4OHJA 1IBLL 1SJHD 1HFGA 5IWAL 3NUCA 1E2VA 3I72A 2VQFL 4BY1B 1SJ8A 3HGBA 3PV0A 1BBXC 4JBWA 3T51B 2E75C 2QEXA 1ENFA 4EQ5A 3BG3A 4DR7L 1LABA 2NWGA 5CV6A 4RMFA 1TXYA 2IWHA 1LTAD 3H94A 5LMNQ 3NK9A 2R93B 1SEBD 1LT5D 3BYTB 1GUWA 1CK1A 1BKBA 4B3SL 2HHHQ 1SFOB 3TSSA 2RIOA 3FBVA 4X3TA 1H9SB 4RCOA 1HJPA 1Y8PB 2H4OA 3U4VA 2WKDA 4X66Q 3KFUA 1RTNA 4YWMA 2SDFA 5JOBA 4RAUC 5BN3A 5I6YA 4B3TL 1ESFA 4B9WA 1L2FA 1FD7D 1GUOA 3GTMH 3LNNA 5JVG3 2JA6G 1AE3A 1JORA 4K5VA 1QOHA 1X55A 4ABNA 3GO5A 4FF3A 3QJYA 2JA5H 1GXDC 5M5YH 1LLRD 1HZ9A 2E2HB 1STYA 1TT2A 3TP6A 4IN3A 1XPRA 2I07B 2DNCA 3LWEA 4F88A 5C3WA 2A2DA 1YJNA 2PMZE 3TREA 3VR3A 4DAMA 1HA5A 3S2HB 3S1QH 5CV7A 2WP8J 2J7ZA 4KHZA 1JQYD 2N55A 5IYBH 1VQKA 2R92B 2DNEA 4GOPB 1O7ZA 2UXCQ 3A56A 3I4OA 1Z6HA 4JI6L 4A3DB 1TS3A 4IFDG 1CKNA 4P2CB 2PZWA 1CT1D 4UAIA 2VQEQ 3Q23A 2IX3A 2CKZB 1K8OA 2MFIA 2L5TA 1DXMA 1EOTA 1KD1C 1TWCB 2RSOA 2B2TA 5J39A 2XTQA 2QILA 1JOQA 4DV4L 4LFAQ 3J81i 2KEDA 4XT3B 3KYHC 4LUVA 1LTBD 1PRTB 2K5HA 3EN2A 5T1GA 3NTKA 4CKEA 4AYBE 4DV6L 2UUAL 1KAAA 4OIKA 2K75A 4IALA 4DA2A 1C7YA 4OWTB 4O2DA 3KDFA 1EWCA 4IOCA 4OAUC 3FKIG 1I4GA 4H0LC 2AUJD 2F3WA 1VQNA 1X3EA 2DY8A 1IW7D 2K7VA 4XT1B 4FXKC 4I7AA 5D14A 1TWFB 2D0PA 4B08A 1BBWA 1D8LA 2WKCA 2A69C 1RJTA 4IOAA 1IBLQ 5IWAQ 2F66B 1C48A 5FLMG 3K8AA 4NPSA 1NTGA 5M5WB 3S1RH 1HNZL 2SNMA 1CM9A 2JA6B 1L0XB 3S17B 1FL0A 4JI4L 4DR7Q 3PSIA 4LUZA 3CRKC 1F9RA 4DV2L 3K5OA 4GZYC 4DV7Q 3EFXD 1K83H 1S5CD 1WCMH 3S9WA 3ULJA 2P5ZX 4B3SQ 3EQLC 4X3SA 1G2TA 1C0AA 3S1MB 4FNFA 3NWSA 1PH7A 5EQ0A 2HQEA 1UAPA 2CW0C 4GKKL 2CVRA 3X3NA 2ZT9C 1P8LA 3GV3A 4DNTB 4U68A 4FXDA 1TWGB 2N3SA 2NYZD 4DV1L 4KLKA 4DR2L 2KCNA 4DV3L 3WOEA 3MFYA 1OO9B 2PQAB 5C4XG 4ZUIA 3DA4A 1A3VA 1Q3LA 1I6HB 5E3FA 1VQCA 2O5JC 1HZBA 4JG2A 3PF5A 3H15A 4KN7C 2QA4A 1KDBA 3S15H 4LF4L 2RSNA 1HCZA 3OYYA 1STEA 1QWYA 1SRUA 2XGTA 3MXUA 4R9WA 2E76C 3PO2G 5I9OA 1NSNS 4NV5A 3CXCA 3FKIB 4JI6Q 3E9HA 5CV5A 3UE1A 1OXTA 4Z7GA 3SE0A 1ICWA 3TP7A 3F2BA 1HR0L 1EEFD 1U9RA 5KEEA 3DWAA 3PUXA 3F2DA 4HJ5A 1YZ6A 2EY6A 3JAME 2E2IB 4C2MH 2X6LA 4LK1C 3JAMi 1H95A 3QOLA 1BF4A 2FEFA 1UNSA 3KF8A 4N9TA 5IP7H 1QUQA 2QKIC 2JB2A 5FKAC 2PZUA 4DGZA 4UPAA 1SYDA 3NWTA 2B2WC 1LTRD 1X3FA 1ENCA 2YTYA 2KENA 3HEJA 1B50A 1UE5A 4KD4A 4YIJA 2A8VA 1L0WA 1S3OA 2Z9HA 1F9PA 2JB1A 1I4RA 1CSQA 5FLXc 3I4MH 5IY0A 2FMMA 4I7ZC 3NXWA 4RH6A 3M4QA 2C9OA 2CHBD 1SE3A 1HHVA 2P22B 2HCIA 2RLDA 1LTSD 2V4DA 2F0EA 2A6ED 3J7A5 3T16A 2EJMA 1KDAA 2ZRRA 2KBNA 4LF9L 5KGUA 1WI5A 3TDQA 5GADC 3F4MA 3K5LA 1KHIA 2QGQA 5G3LD 1QNKA 1G51A 3DO9A 4ZKCB 1BCPD 2MQHA 1G91A 4B3MQ 2PI2E 2L0CA 1UE7A 1HNZQ 2TSSA 1L1OB 1D5XC 4C3IH 5D3IB 4YCWA 2JA8G 1JWSD 3ICEA 1B7YB 1YBYA 1WTQA 4DV2Q 4MTNA 4BBSH 1PRTF 1TWAH 1EQRA 3S14B 2ZM6L 1N34L 5C4XB 1NNXA 1G8ZD 2RBMA 3MEFA 4LJZC 3CMAA 1MKHA 4DAVA 4GNXB 3FEWX 4OX9L 2A19A 1HXYD 3NENA 2E8GA 3J7AV 2H5XA 2IT1A 2R3ZA 5TSSA 1K9MC 1XNQQ 3M4YA 3TZUA 1AEXA 4BWGB 4OWXB 3F8TA 3PO2B 4GKKQ 1KRTA 3MA2B 3CCRA 2QEJC 2K52A 1BOSA 3EIVA 5C44H 4DR6L 5I2YA 1V1OA 3D4DA 1HQMC 3I4LA 4RWSC 1JMCA 1HH2P 3FMCA 4GOPC 2F3VA 4DV3Q 2N49A 1SJED 1YNNC 2BL7A 3KBXA 1SMXA 5K5PA 4M8AA 3DWPA 4PZ6A 3TN2A 4DK1A 1OXUA 5GQOA 1STNA 3VR5A 4A4IA 4HSPA 2JSOA 4LF4Q 5FJ8G 5FLXL 1NR4A 2BOSA 1LM0A 3NBIA 3HFZB 3PUYA 1AN8A 2IHEA 1PRTC 2MJFB 2F0VA 1H9KA 5CC4A 2F0SA 4A3BG 1I4QA 4O1PA 5GAGC 3I4NG 4O1OA 3GTPH 2YFBA 4A3IG 4XTCS 4BY7H 3FNBA 2Z6KC 4YZ9A 5IT9c 4K14A 3U9SA 2A1AA 2ICIA 1DZ1A 2LY7A 3PMFA 3CQZB 4FVMA 2EYFA 1KLGD 2B2VC 2RDFA 2IPKD 4Q0FA 4OAVB 1PA6A 4ZK9B 4NXML 1F2MA 1EFID 4GN5A 4UP7A 2XRSD 4KK7A 1MSGA 3H3VH 2EXDA 2PNHA 1LT4D 3ULPA 2JA8B 3BVGA 4FYDA 1WVLA 5HGQA 2PI2A 4G7HC 5DNFA 3GTLB 3C46A 4F87A 1PYWD 5A35A 4ZRZA 4G57A 1OXXK 3W1BA 1PV4A 2HIVA 4R1JA 1PH9A 4MHEA 4A3CH 4PQXA 4JVZA 1W6JA 2VNUD 5K36H 2PNRC 3T1YQ 2R93H 4WJ3M 3S15B 3B55A 4K2LA 2KA7A 1CFMA 2F0KA 1SFOH 3Q24A 3SXHA 4X62Q 1NMGA 1V1PA 2MJ8A 4P75A 3K7AH 4IQZA 3J7ZC 2F0MA 2LMCB 5C44G 1EFWA 3CPFA 2VS1A 3LJ2A 2ZM6Q 1N34Q 5AJ3Q 3K81C 2EZVA 4LF8Q 1RL2A 4Z9CB 3OHXC 1Q7YC 3NQTA 4HEDA 2OEOA 3E3XA 4LF5Q 1E1OA 4RHRA 5ELFA 3KF6B 3C1FA 1UE6A 1CQVA 3K0XA 2KHSA 1PH8A 2E2HH 4R8NA 4LF7Q 2O2LD 3BZKA 4IUUA 2F0WA 4CHTB 1PYSB 4J6HA 5IT9L 2EY2A 1GUTA 3P7JA 5GROA 3J80i 4DR6Q 1JJCB 2F0PA 3CCSA 4A3BB 2EYOA 1EY5A 3S2HH 1PFNA 3I4NB 1ZYRC 2VB2X 4JI3L 1FNUA 2HDMA 4A3IB 4QJFA 2R92H 3NE5B 3KK7A 3MWYW 5D3DA 2NTSA 2HGKA 4XYQA 4A3DH 4PMCA 1E2WA 4BY7G 1DJRD 2B2YC 5FO9B 3JSBA 1UUPA 3E0JA 5JEAH 4GLVB 4EQPA 3K6OA 1FNVA 3JC66 1V1QA 1YI2A 4UY8C 1SNCA 5JEAJ 4UP9A 1TWCH 3CKIB 3RZOB 3S1NB 1Y8NB 2NZHA 4AYBB 3STBC 3PUZA 5HY6A 1FGBD 1X3QA 5A2QL 4IPCA 3BS1A 1MGSA 3GTGB 4DNRB 1KAWA 2MPMA 3PGZA 1VF7A 4DFAA 1WTHA 3L7ZC 2FINB 3H6MA 4P74A 1CI3M 5KNCA 1SE4A 2A69D 2K32A 4KY7A 1CSPA 1TWFH 3M4PA 3AFPA 1QUQB 4X64L 5K36G 4LNQA 3M4OB 5M5XB 1CKOA 2JEBI 4QGUA 4JI2L 2EJGC 1XWEA 5KIXA 4JI0L 5LMUL 3NP8A 5C44B 3MXPA 1N33Q 3UDGA 1PVOA 1L1OC 3K7UC 4LWCA 3G4SA 3TP8A 5M5WH 3KBGA 3X3MA 4GKJL 5CYUA 3SVMA 4EX5A 1K28A 4KV6A 2CQAA 2JA6H 3FVQA 3S17H 3Q22A 4HTHA 1HTPA 3TS0A 3GTJH 2K6AA 1RCVD 4TVAB 3HS0C 2BL8A 2HUGA 3M3YB 4S3SA 4GNXC 2HQLA 2VB3X 1JWUD 2AQ3B 4NMZA 4A3MB 2K14A 2JP1A 3D0FA 4N9PA 1NAPA 2QDBA 3ZYYX 3S1MH 2CW0D 3KOJA 4OEMB 1MIUA 1VMPA 4V190 1XPOA 4HJ7A 2EPBA 1D5MC 2YV5A 2F0DA 4HR7B 1Q1EA 3HOVG 4DXFA 1TR5A 2WACA 5DEHA 3IAM1 2A68C 4HEA1 2C35B 1SYCA 4JI1Q 1TWGH 3AYHB 4IFDH 4DUYL 2C5CA 2D62A 3CCUA 1QVFA 3RUZA 5EAYA 4IFDJ 5JJZA 1JQOA 1EY4A 1GM5A 2F0NA 1I6HH 3MC0B 1LUZA 4GN3B 5ELOA 4K0KL 3M7NA 4TSSA 1D6EC 1G6ZA 2NVTH 1M8AA 3PCOB 4YHHL 1LV9A 2UXDL 3IAS1 2LXJA 3CCMA 2JXMB 3VR4A 4H02A 4IPHA 1YJ9A 2MUYA 2D0OA 4DWLA 3FKIH 3RLNA 2K4KA 2RDHA 2F0FA 3T13A 3MXNA 1EQVA 4QUFA 2E2DC 1W6KA 2L1LB 2RADA 2E2IH 1JCKB 1KNEA 4NV2A 2OQ0A 3AMUA 1IHZA 2KHJA 2ZXRA 4IJHA 2A73B 3MXGA 4O1NA 5FLMH 4I65A 3VA5A 3CC2A 4QF4A 5EPLA 3K7AB 3OMCA 4P71A 1O7LA 1GO3E 4JV5L 4JYAL 3DLLA 3HKZE 4DUZL 3CCLA 1Y1VH 1STBA 1PH6A 4R4CA 3AQQA 4X64Q 2WINB 1U5KA 3D31A 5J22A 3AFQA 4KKUA 2JQOA 1A3UA 4JI2Q 1PMRA 1SR3A 3I7FA 2JN4A 4CDCC 1DCZA 3J81j 5LMUQ 1M4VA 4DR5L 4LFBL 2RKSA 1T9HA 1F9QA 2VL6A 3ER0A 1A62A 5LHY1 3EA6A 3VYUA 3HOVB 4XQJA 4GKJQ 1YVCA 3CD6A 3SK4A 3OWEB 4Y7NB 5BN5A 2F0QA 3K58A 5FOBB 4KKTA 1JJGA 3S14H 4YCUA 5ELCA 4I1TA 5C4XH 2KECA 5IODA 3K0YA 2UUCL 1X9NA 3C2PA 4KD3A 1SNMA 2IP6A 3D3RA 4JI5L 3J81E 1HNWL 2ZW3A 1CZWA 1YNXA 2L9HA 3M7GA 1S40A 4Q5VA 2N78A 2A5HA 4R4QA 1Y14B 5C4JB 3PO2H 3KLSA 2ALYB 5NUCA 4CKCA 3EROA 1GUSA 1T5XD 4DK0A 5KYLA 1EUJA 2BA0A 2J4XA 4PZ7A 1EZ6A 3A54A 1VQ9A 5IE8A 1YNND 5C6AA 2EIFA 2RCFA 1SNPA 2XTIA 1SYGA 2FHTA 3H3VI 3QB3A 4DXGA 4K6LA 1EIFA 1JR0D 4JOIC 4JI8L 2EOTA 3TS2A 3Q8DA 4U6RA 1EQTA 3TZDA 2WV6D 1IZ6A 4CJ1B 3A8KE 4RKLA 4K8IA 1CHQD 1B3QA 2UXDQ 2KVMA 3VYSA 1L0YB 1PRTD 1GUGA 3LX0A 2F6MB 4BS9A 4JBJA 2VQFQ 1YEZA 1SNDA 5DM73 3URYA 1LTID 3MEHA 1OTCA 1PH3A 1KIXA 4OONA 1Y1VG 2ZXPA 4KY6A 1MHWC 3GTJB 4AS3A 2R7ZG 1RF2D 4U673 3RLOA 1ILQA 1PTOH 3ZJYC 4DAYA 2PCFB 2I46A 2K5VA 5ELEA 3CQZH 2XTRA 3LJ0A 3GP7A 3D6CA 4DR4L 1SSOA 2AQ1B 1RODA 1QCBD 2L4NA 3ONAB 1MD2D 4YCVA 3SGIA 2EYLA 5JPNC 3CC7A 1WYDA 2JBWA 4JV5Q 1XTCD 3CF5A 1M90C 4B3TQ 2V1CC 3I70A 3C3LA 4NP5A 2JA8H 1XJVA 4JCVE 4DF7A 2QZGA 4FXGC 1BUVT 2BA1A 4ME5A 3GTLH 3CPWA 4PMBA 3DEOA 4L5TA 5DM63 2Z1CA 2KHIA 1HFNA 1SBBB 3W3AA 4B9XA 1K0SA 2XMXA 1DOKA 5E4XA 5GAEC 3T1HL 1DM0B 2XNAC 2Y0SE 2NVTB 3DWQA 4LFBQ 4KHVA 3D4RA 3GTOB 1X3PA 3IRBA 1IBML 1IXRA 2ZTDA 1PDQA 4A3FG 3S16H 3C1EA 4NKLA 1S72A 4BXXH 3VR2A 2MNAA 1N8RC 1GJXA 4BBRG 4ODGA 4FDBA 4PL5A 4XYOA 5KNBA 2K5WA 4A3LG 3H91A 4E6IA 2XRQD 3SK5A 5T1IA 4C56C 1FNWA 2K50A 1PFMA 3O13A 3QOJA 3NTIA 2WIIB 1WJJA 5FJ8H 4DV4Q 3QIAA 3H3VC 3EJIA 4DV6Q 2UUAQ 3RN5A 3CMEA 1TKWB 1ZYRD 4Q9VA 3NHHA 4A3BH 1Q90A 4Z7HA 5LMNW 1BR9A 3KLRA 4NXNL 3VDYA 1XMOL 1Y1VB 3I4NH 3PO3H 3T56B 4A3IH 4IUNA 5I9PA 2R7ZB 5IP9G 1DOMA 1B9MA 5D65A 2R7FA 1U4RA 1IYJB 3W2DA 1FR3A 4JI8Q 2NVQB 2WB1E 4WJWA 3PIO3 1VQFA 5CGKA 1SLJA 3MZ5A 1M1KC 3NBHB 2B63G 1U0LA 4QIWB 2A2CA 2CQOA 2Z6BA 4RA8A 1BCPB 1RHPA 1J9OA 4K6DA 4POFA 4JPBW 1A0IA 4HAEA 2BH2A 3RZOH 3STBD 3S1NH 1BNZA 5EPKA 3GTKB 4QB4A 2HCCA 3N6RA 5IYCH 4JI4Q 3MXNB 3SK8A 3TBIB 1EQQA 3GTGH 2WAQE 4JK1C 4EQNA 1CA6A 4ME3A 1EY6A 1KNAA 2EDGA 3M85A 2BE5D 3ND8A 4LF6L 2QDLA 1SYFA 1H9JA 3H0GB 2EYJA 3SDJA 3KJOA 5JJKA 1I6VC 2G9DA 4BA2I 2ZTEA 4HFVA 3FHWA 3GDEA 2AWNA 5KYIA 2F0IA 4GN4B 4PL4A 1QG7A 2GVBA 5M5XH 3M4OH 1PFSA 1Q46A 4IFDI 3A5ZB 4CDDC 1KRSA 3SEBA 5CV8A 4A3FB 1ESRA 4CDEC 3IKJA 2OTJA 2Q8IB 4PL3A 3MHBA 1EY0A 4BBRB 4BXXG 1Q82C 4DV1Q 4DR2Q 1Q1BA 2NB0A 2PO4A 2OCEA 3HOYB 1TS5A 3PIP3 1EWIA 3TRZA 1HTLD 4NB3A 1BQQT 1G291 2B3GA 3T1HQ 1FJGL 3UDFA 3M3YH 1S4ZA 1Y1WB 5I6WA 4DR3L 3SK6A 2UUBL 4DV5L 1KXLA 2JA7H 4RGNA 2B2WA 4A3MH 1IBMQ 5CORA 4H7BA 4BA1I 5IT9E 1Q8KA 3EVQA 2ZTCA 4IO9A 3GTQB 3FRPB 4R4IA 4IUVA 2KKMA 4EQOA 1SROA 2EY1A 5HGTA 1VQ6A 1E24A 3G71A 2A68D 1IW7C 3NTHA 3DM1A 3PO3G 4HJ9A 1HR0Q 1CKNB 3NELA 2NN6G 1VQAA 2I0QA 2FJ2A 4JW0A 1LTGD 2J0TD 4YY3L 1PTOB 3T4AC 1YJWA 3TMEA 3RN2A 4HIDA 4HJAA 1J8IA 4DK3C 4RGTA 2OWOA 2CWAA 5LL6X 4XXEA 3S24A 3HOXG 3PF4A 4K2KA 4X65L 2B63B 1HRJA 2AMCB 2YYZA 2UXBL 1H9SA 1QJOA 1I4PA 4APVA 5L37A 1I4HA 5EBCA 1EEID 1RD9D 2E74C 2BCOA 3OSOA 1B70B
chains in the Genus database with same CATH topology
1N33Q 1X54A 3UDGA 4DR1Q 5IYBH 1XMOQ 1L1OC 3K7UC 4LWCA 1VQKA 3G4SA 4NXNQ 1PVOA 5M5WH 4GOPB 4AYBG 3KDFB 2UXCQ 4GKJL 3I4OA 5IYCG 5JJIA 4JI6L 1N36L 4EX5A 3L0IA 3NEMA 2JA6H 4IFDG 3S17H 3BZCA 1CKNA 3TS0A 2VQEQ 1VQDA 3GTJH 4POGA 2IX0A 2CKZB 1N9WA 2EQSA 4TVAB 3DA3A 2MFIA 2R7DA 4PG3A 1KD1C 3WWVA 4KHPL 4GNXC 2HQLA 1QVGA 3TQYA 1A8VA 2XTQA 4LF9Q 3HOXH 4DV4L 2ID0A 4YWLA 4LFAQ 1R9TH 2K14A 3J81i 3D0FA 1GKHA 3KYHC 4LUVA 5LNK1 2K5HA 2BH8A 2L15A 3EN2A 3JAMc 3S1MH 3KOJA 1MIUA 4AYBE 4DV6L 2UUAL 2K75A 1EYGA 4XIGS 3G48A 1XPOA 4PZ8A 4HJ7A 2YV5A 1WFQA 2RF4A 1Q1EA 5IYDG 1C7YA 2JE6I 4OWTB 4O2DA 3TEHB 4GOPA 3HOVG 3KDFA 2IY5B 3IAM1 4IOCA 4OAUC 3FKIG 5H1SE 1AE2A 4HIMA 1VQNA 1X3EA 1P16A 4HEA1 2C35B 4JI1Q 1TWGH 3AYHB 3PUVA 4DUYL 4LF6Q 2D0PA 1IL2A 4AIMA 2D62A 1BBWA 3CCUA 1WCMG 4GLXA 1D8LA 1QVFA 1KQSA 5EAYA 2HT1A 4IFDJ 5C0XJ 1YIJA 1GM5A 1VQOA 3T1YL 4OX9Q 1I6HH 3I2ZA 1LUZA 4GN3B 3F1ZA 5ELOA 4DR4Q 3M7NA 1IBLQ 4IOAA 4K0KL 1NY4A 2NVTH 4R4OA 5GAHC 1VQ8A 4WJ4A 5IWAQ 2F66B 5FLMG 1YO7A 3PCOB 4YHHL 3K8AA 1JJ2A 1IBKQ 3RZDH 3IAS1 2LXJA 4NPSA 2JA7G 4A3MG 2UXDL 4MNOA 4X62L 3CCMA 1NTGA 2Z0SA 3CP0A 2JEAI 5HGIA 4H02A 1VQMA 4IPHA 3S1RH 1AH9A 1HNZL 5IYDH 1YJ9A 3HOVH 2D0OA 4DWLA 2UU9L 3P23A 1FL0A 4JI4L 4DR7Q 1K3RA 3FKIH 3RLNA 1NJIC 2K4KA 3PSIA 4Y7NH 5AJ3L 4LF8L 4LUZA 3HOUG 4DV2L 1N32Q 2Z6KA 3HKZG 4DV7Q 4L5QA 4A76A 4A3JH 4L5SA 2ATWA 1K83H 4R4TA 2L1LB 5E7NA 4LF5L 1WCMH 1FJGQ 4GS3A 2E5LL 4LFCL 4LUOA 2E2IH 3ULJA 1YITA 4B3SQ 4NV2A 2OQKA 4IJLA 1I50H 4DR3Q 2VUMG 2OQ0A 4QL5A 2GVAA 4DV5Q 2KHJA 4LF7L 4A3KH 4IJHA 1C0AA 2JK8A 3CC4A 4A75A 5M3MG 3OTOL 1PH7A 5FLMH 3CC2A 2KCMA 2ASBA 1MJCA 4GKKL 3W1GA 4P71A 1GO3E 5C4JH 1P8LA 4JI7L 4JV5L 4JYAL 2B29A 3DLLA 3HKZE 4DUZL 3CCLA 1Y1VH 1PYBA 3UITA 2N3SA 1PH6A 2JJQA 4DV1L 3W5OA 4KLKA 1YHQA 1E3PA 4DR2L 3HOUH 4DV3L 4JBKA 4R4CA 2F52A 4DPGA 2PQAB 5C4XG 3AQQA 1KL9A 3DA4A 4X64Q 2GN5A 1NMFA 3AJFA 1VQCA 1BBUA 1U5KA 1WOCA 1HZBA 2DUDA 4JG2A 5IP7G 3D31A 3PF5A 3HOZH 3KF8B 3AFQA 3H15A 2YTXA 2JQOA 4JI2Q 2QA4A 4HIOA 1VQLA 1SR3A 3I7FA 4NXMQ 4LF4L 3S15H 1XMQQ 2NVYH 3OYYA 3J81j 5LMUQ 5M3MH 1SRUA 2XGTA 4DR5L 4X66L 3PO2G 4LFBL 1MJEA 1T9HA 3ER0A 2VL6A 1A62A 1DGSA 4AH6A 1HNXL 3FP9A 4NV5A 3E9IA 4OO1I 3CXCA 4GKJQ 1VQBA 1YVCA 3CD6A 4JI6Q 3CCJA 1N36Q 3E9HA 3UE1A 1OXTA 1K8AC 4Z7GA 4A3GG 3I4MG 3F2BA 1HR0L 5M3FG 1HZAA 3PUXA 3F2DA 4HJ5A 1YZ6A 1JJGA 3S14H 4YCUA 5C0XG 1PH5A 4C2MH 4I1TA 2YTVA 5C4XH 3JAMi 2UUCL 1H95A 1X9NA 1C9OA 1EIYB 5IP7H 3A74A 2JAEA 1QUQA 2IP6A 2JB2A 4JI5L 1HNWL 4RG1A 4O0AA 1YNXA 4UPAA 1G6PA 1NBWA 1S40A 1W3SA 2N78A 1X3FA 4C3HH 4HIKA 2VY3A 1FGUA 4P72A 1Y14B 4R4QA 3ULLA 3PO2H 2YTYA 4BY1H 2ALYB 2KENA 1UE5A 1I94L 1N33L 1VQGA 1EUJA 2A8VA 2BA0A 1L0WA 3VA9A 1S3OA 4PZ7A 2MO1A 4BBSG 2JB1A 1CSQA 3KLWA 1JT8A 5FLXc 1VQ9A 5IE8A 4A3GH 1VQPA 5IY0A 3I4MH 2EIFA 2XTIA 2FXQA 3BJUA 5M3FH 2K5NA 3H3VI 1LTLA 5J3BA 3M4QA 2WAQG 2OTLA 4A3JG 3CCVA 3RNUA 4DAYB 1EIFA 3E0EA 4JOIC 4AQYL 4JI8L 3TS2A 2P22B 3Q8DA 4U6RA 1B8AA 1X56A 4P73A 3F2CA 3J7A5 2ZRRA 1IZ6A 2KBNA 2ZJPA 1WI5A 4JBMA 4LF9L 2UXDQ 1TWHH 5GADC 4A3KG 3F4MA 1KHIA 1HR0W 2QGQA 3M9BA 4J15A 4DK6C 1K73C 1EOVA 4PMWA 1G51A 2F6MB 3DO9A 1XPUA 3CCEA 4JBJA 2MQHA 2VQFQ 1CKMA 2I5LX 1YEZA 2PI2E 4B3MQ 3GTOH 1YHAA 1UE7A 1HNZQ 1L1OB 4C3IH 2JA8G 4YCWA 5BR8L 2UU9Q 4JI3Q 3G6EA 1OTCA 1PH3A 3ICEA 1B7YB 1XNRL 1YBYA 4DV2Q 2ES2A 1A63A 2JA9A 4MTNA 3CAMA 4OONA 1Y1VG 1J5EL 1TWAH 1KIXA 4BBSH 1EQRA 4JI1L 1ASZA 4OXPA 2ZM6L 1N34L 3UDXA 4AS3A 2R7ZG 2E5LQ 1X3GA 2ZJQA 1I5FA 4LFCQ 3RLOA 3ZJYC 3MEFA 1HZCA 3CMAA 1MKHA 3UDIA 2K5VA 4DV0L 1UWVA 3CQZH 2XTRA 3LJ0A 2A19A 4GNXB 4ALPA 4OX9L 1SN8A 2IHFA 1LYLA 3HOZG 3NENA 2E8GA 4DR4L 2H5XA 2IT1A 2RCNA 3OTOQ 4HJ8A 1K9MC 1XNQQ 2UUBQ 4OWXB 3F8TA 4GKKQ 4YCVA 3SGIA 1KRTA 3CCRA 3CC7A 1V43A 3AEVA 1WYDA 2Y0SG 2K52A 3BU2A 3EIVA 4JI7Q 4JV5Q 5C44H 1Q86C 1KC8C 3CF5A 1L1OA 1M90C 2F4VL 4DR6L 3A5UA 2V1CC 4B3TQ 2JA8H 4C3JH 1XJVA 3S2DH 4JCVE 1JMCA 1HH2P 4GOPC 2LXKA 4YZCA 3J80c 4A93G 4DNIA 4DV3Q 2BA1A 4KHZA 4TQUS 2N49A 3GTLH 2VW9A 3CPWA 4L5TA 4DV7L 1SMXA 2Q2UA 1VQJA 2R6GA 3L0OA 4PZ6A 4YY3Q 1VCIA 2R7ZH 4YWKA 1OXUA 5GQOA 2CAZB 2KHIA 4GNXA 5LMNL 4A4IA 2FUG1 4LF4Q 4QIWE 5FJ8G 3B6YA 1Q81C 2LSSA 2XMXA 1LM0A 4X65Q 2NVQH 5JJLA 5GAEC 3T1HL 2F3IA 3HOYG 2Y0SE 3LGJA 1I3QH 3HFZB 4LFBQ 2UXBQ 2HHHL 4JI0Q 3PUYA 2NZOA 2IHEA 1HNXQ 4G75A 2VZAA 2MJFB 4YZDA 2I5HA 4A3EG 2AHOB 2DGYA 3KP9A 3IRBA 3OW2A 1IBML 4A3BG 1IXRA 2ZTDA 2CFMA 4LW1A 4BY1G 3RLFA 4O1PA 2V6EA 2YU9H 5GAGC 4A3FG 2NVXH 3I4NG 3S16H 4O1OA 4B3RL 3GTPH 2YFBA 1W2BA 4A3IG 1S72A 3GTKH 1PHJA 4BXXH 2MNAA 1N8RC 2CCZA 4Y52H 1E1TA 4BBRG 4XTCS 1JB7A 4A93H 1O7IA 4FDBA 4BY7H 4PL5A 3U4ZA 2Z6KC 4YZ9A 1JE5A 3EBEA 5IT9c 3PIOA 4A3LG 1PH4A 1UEBA 2A1AA 2Q2IA 4A3CG 4AS2A 3HOWG 2AWOA 2PQAA 1PH2A 1J6QA 1BVSA 2R93G 4KHPQ 2K50A 4GLAC 2IX1A 4OAVB 2CWPA 1PA6A 1WJJA 5FJ8H 4DV4Q 4L5RC 4NXML 2RHQB 2K19A 3H0GH 3ERSX 3HKSA 3RR5A 2WB1G 2MO0A 4GN5A 4UP7A 5C3EG 4G76A 3H3VH 2EXDA 2PNHA 3U58A 5ELNA 1I94Q 4DV6Q 2UUAQ 3RN5A 3CMEA 3ULPA 4QQBX 1RIPA 4A3EH 4Q9VA 1K0RA 4A3BH 4Z7HA 5LMNW 5HGQA 2PI2A 1K8GA 2YFAA 4NXNL 4DR1L 3VDYA 4A3FH 3CCQA 1XMOL 3I4NH 3PO3H 4A3IH 1PH1A 4OWWB 2UXCL 4BBRH 1OXXK 1V9PA 3W1BA 5IP9G 1QZHA 4DUYQ 1QVCA 2R7FA 1PV4A 2HIVA 1IYJB 4R1JA 4AQYQ 1GVPA 1PH9A 4JI8Q 3I56A 2VQEL 3HOYH 4A3LH 4A3CH 4IPDA 3HOWH 2WB1E 3A0JA 4UP8A 1SE8A 3I9V1 3I55A 2VNUD 3T1YQ 2R93H 4WJ3M 1VQFA 1SLJA 1QZGA 4K0KQ 1M1KC 3NBHB 2B63G 1U0LA 2A2CA 2CQOA 2WFWA 4YHHQ 1Y1WH 4LFAL 1SFOH 3K80C 2BH2A 4POFA 3RZOH 1A0IA 3GD7A 4X62Q 5C3EH 2NN6I 1NMGA 5DLQE 3STBD 1XTDA 4P75A 5BR8Q 2Q2TA 2KCTA 3K7AH 3S1NH 3J7ZC 1VQHA 5C44G 2HIXA 1XNRQ 1EFWA 3J81c 3CPFA 3GTQH 1J5EQ 5IYCH 2R92G 1CUKA 3UE0A 3PIPA 2VS1A 1E22A 3LJ2A 3MXNB 2ZM6Q 1N34Q 4JI4Q 2Q2HA 5AJ3Q 2RHSB 3K81C 4KI0A 4LF8Q 1RL2A 4A3DG 1EQQA 3GTGH 1Q7YC 1E7ZA 2WAQE 1YHBA 2E2JH 5IP9H 4ME3A 5JEAG 3M85A 3U50C 2ZJRA 4DV0Q 4LF5Q 4LF6L 4X6AH 3DM3A 1X6OA 1VQ5A 1E1OA 1VQ7A 1GD7A 4OO1G 1UE6A 1UE1A 3KF6B 3SDJA 3K0XA 3KJOA 1PH8A 2E2HH 5JJKA 4LF7Q 4BA2I 3BZKA 2ZTEA 4HFVA 1Z47A 3FHWA 2AWNA 3GDEA 1ASYA 1PYSB 1OXVA 4GN4B 4GXTA 4PL4A 1VQIA 2GVBA 5M5XH 1PFSA 1Q46A 1IBLL 3M4OH 4IFDI 5GROA 3J80i 5IWAL 5C0XI 1JJCB 3CCSA 1IBKL 2F4VQ 4DR6Q 2VQFL 4B3ML 3A5ZB 1SJ8A 1KRSA 4QY7A 3S2HH 4JI3L 3PV0A 2OTJA 4JBWA 2QEXA 4JYAQ 3PUWA 4PL3A 4DUZQ 4QJFA 1NE3A 2R92H 4EQ5A 4BXXG 1Q82C 4DV1Q 4DR2Q 4DR7L 1Q1BA 4A3DH 2OCEA 4BY7G 1N32L 4RMFA 2JA5G 1TXYA 3JSBA 1EWIA 3TRZA 1Z9FA 5LMNQ 1VS0A 4GLVB 4NB3A 1G291 2B3GA 3JC66 1V1QA 1YI2A 3KF6A 3T1HQ 4UY8C 1FJGL 3UDFA 1BKBA 3M3YH 5JEAJ 1XNQL 4B3SL 4UP9A 1TWCH 2HHHQ 4DR3L 2UUBL 1KXLA 2RIOA 3FBVA 4DV5L 3H0GG 2JA7H 4MZ9A 1HJPA 3U4VA 4A3MH 1VQEA 1IBMQ 2NZHA 4IPGA 4BA1I 4DR5Q 4X66Q 3KFUA 1Q8KA 2ZTCA 4IO9A 4YWMA 3STBC 5IYBG 4B3RQ 1X65A 4R4IA 3PUZA 4JC0A 4B3TL 5HY6A 2KKMA 1L2FA 2B63H 1SROA 3GTMH 1VQ6A 1E24A 3G71A 4IPCA 2N8NA 2JA6G 3PO3G 1KAWA 4HJ9A 3LJ1A 1AE3A 3PGZA 1HR0Q 1CKNB 2AKWB 2NN6G 1VQAA 3NELA 2I0QA 1X55A 2I5MX 3GO5A 3L7ZC 4P74A 2JB3A 1VQ4A 4YY3L 1D7QA 3CW2C 2JA5H 1YJWA 1FVIA 4JOIA 1CSPA 1TWFH 3M4PA 5M5YH 1HZ9A 3AFPA 4HIDA 4HJAA 1OXSC 3RN2A 4DK3C 2UUCQ 1QUQB 2VUMH 4X64L 2OWOA 2CWAA 3HOXG 1XPRA 3S24A 3PF4A 5K36G 4LNQA 4X65L 4JI5Q 1HNWQ 1CKOA 2AMCB 4DKAC 2JEBI 4QGUA 2YYZA 4JI2L 2UXBL 2A2DA 3L2PA 1YJNA 4JI0L 2PMZE 3TREA 4APVA 4DAMA 1Y1WG 1XMQL 3KJPA 3S1QH 2WP8J 5LMUL 1Q12A 1B70B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N33 Q;  1X54 A;  3UDG A;  4DR1 Q;  5IYB H;  1XMO Q;  1L1O C;  3K7U C;  4LWC A;  1VQK A;  3G4S A;  4NXN Q;  1PVO A;  5M5W H;  4GOP B;  4AYB G;  3KDF B;  2UXC Q;  4GKJ L;  3I4O A;  5IYC G;  5JJI A;  4JI6 L;  1N36 L;  4EX5 A;  3NEM A;  2JA6 H;  4IFD G;  3S17 H;  3BZC A;  1CKN A;  3TS0 A;  2VQE Q;  1VQD A;  3GTJ H;  4POG A;  2IX0 A;  2CKZ B;  1N9W A;  2EQS A;  4TVA B;  2MFI A;  2R7D A;  4PG3 A;  1KD1 C;  3WWV A;  4KHP L;  4GNX C;  2HQL A;  1QVG A;  3TQY A;  1A8V A;  4LF9 Q;  3HOX H;  4DV4 L;  2ID0 A;  4YWL A;  4LFA Q;  1R9T H;  2K14 A;  3J81 i;  3D0F A;  1GKH A;  3KYH C;  4LUV A;  2L15 A;  2K5H A;  2BH8 A;  3EN2 A;  3JAM c;  3S1M H;  3KOJ A;  1MIU A;  4AYB E;  4DV6 L;  2UUA L;  2K75 A;  1EYG A;  4XIG S;  3G48 A;  1XPO A;  4PZ8 A;  4HJ7 A;  2YV5 A;  1WFQ A;  2RF4 A;  1Q1E A;  5IYD G;  1C7Y A;  2JE6 I;  4OWT B;  4O2D A;  3TEH B;  4GOP A;  3HOV G;  3KDF A;  2IY5 B;  4IOC A;  3FKI G;  5H1S E;  1AE2 A;  4HIM A;  1VQN A;  1X3E A;  1P16 A;  2C35 B;  4JI1 Q;  1TWG H;  3AYH B;  3PUV A;  4DUY L;  4LF6 Q;  2D0P A;  1IL2 A;  4AIM A;  2D62 A;  1BBW A;  3CCU A;  1WCM G;  4GLX A;  1D8L A;  1QVF A;  1KQS A;  5EAY A;  2HT1 A;  4IFD J;  5C0X J;  1YIJ A;  1GM5 A;  1VQO A;  3T1Y L;  4OX9 Q;  1I6H H;  3I2Z A;  1LUZ A;  4GN3 B;  3F1Z A;  5ELO A;  4DR4 Q;  3M7N A;  1IBL Q;  4IOA A;  4K0K L;  1NY4 A;  2NVT H;  4R4O A;  5GAH C;  1VQ8 A;  4WJ4 A;  5IWA Q;  5FLM G;  1IBK Q;  3PCO B;  4YHH L;  3K8A A;  1JJ2 A;  2JA7 G;  3RZD H;  2LXJ A;  2UXD L;  4NPS A;  4A3M G;  4MNO A;  4X62 L;  3CCM A;  1NTG A;  2Z0S A;  3CP0 A;  2JEA I;  4H02 A;  1VQM A;  4IPH A;  3S1R H;  1AH9 A;  1HNZ L;  5IYD H;  1YJ9 A;  3HOV H;  2D0O A;  2UU9 L;  1FL0 A;  4JI4 L;  4DR7 Q;  1K3R A;  3FKI H;  3RLN A;  1NJI C;  2K4K A;  3PSI A;  4Y7N H;  5AJ3 L;  4LF8 L;  4LUZ A;  3HOU G;  4DV2 L;  1N32 Q;  2Z6K A;  3HKZ G;  4DV7 Q;  4L5Q A;  4A76 A;  4A3J H;  4L5S A;  2ATW A;  1K83 H;  4R4T A;  5E7N A;  4LF5 L;  1WCM H;  1FJG Q;  4GS3 A;  2E5L L;  4LFC L;  4LUO A;  2E2I H;  3ULJ A;  1YIT A;  4B3S Q;  2OQK A;  4IJL A;  1I50 H;  4DR3 Q;  2VUM G;  2OQ0 A;  4QL5 A;  2GVA A;  4DV5 Q;  2KHJ A;  4LF7 L;  4A3K H;  4IJH A;  1C0A A;  2JK8 A;  3CC4 A;  4A75 A;  5M3M G;  3OTO L;  1PH7 A;  5FLM H;  3CC2 A;  2KCM A;  2ASB A;  1MJC A;  4GKK L;  3W1G A;  4P71 A;  1GO3 E;  5C4J H;  1P8L A;  4JI7 L;  4JV5 L;  4JYA L;  2B29 A;  3DLL A;  3HKZ E;  4DUZ L;  3CCL A;  1Y1V H;  1PYB A;  2N3S A;  1PH6 A;  2JJQ A;  4DV1 L;  3W5O A;  4KLK A;  1YHQ A;  1E3P A;  4DR2 L;  3HOU H;  4DV3 L;  4JBK A;  4R4C A;  2F52 A;  4DPG A;  2PQA B;  5C4X G;  3AQQ A;  1KL9 A;  4X64 Q;  2GN5 A;  1NMF A;  1VQC A;  1BBU A;  1U5K A;  1WOC A;  1HZB A;  2DUD A;  4JG2 A;  5IP7 G;  3D31 A;  3PF5 A;  3HOZ H;  3KF8 B;  3AFQ A;  3H15 A;  2YTX A;  2JQO A;  4JI2 Q;  2QA4 A;  4HIO A;  1VQL A;  1SR3 A;  3I7F A;  4NXM Q;  4LF4 L;  3S15 H;  1XMQ Q;  2NVY H;  3OYY A;  3J81 j;  5LMU Q;  5M3M H;  1SRU A;  2XGT A;  4DR5 L;  4X66 L;  3PO2 G;  4LFB L;  1MJE A;  1T9H A;  3ER0 A;  2VL6 A;  1A62 A;  1DGS A;  4AH6 A;  1HNX L;  3FP9 A;  3E9I A;  4OO1 I;  3CXC A;  4GKJ Q;  1VQB A;  1YVC A;  3CD6 A;  4JI6 Q;  3CCJ A;  1N36 Q;  3E9H A;  3UE1 A;  1OXT A;  1K8A C;  4A3G G;  3I4M G;  3F2B A;  1HR0 L;  5M3F G;  1HZA A;  3PUX A;  3F2D A;  4HJ5 A;  1YZ6 A;  1JJG A;  3S14 H;  4YCU A;  5C0X G;  1PH5 A;  4C2M H;  2YTV A;  5C4X H;  3JAM i;  2UUC L;  1H95 A;  1X9N A;  1C9O A;  1EIY B;  5IP7 H;  3A74 A;  1QUQ A;  4JI5 L;  1HNW L;  4RG1 A;  4O0A A;  1YNX A;  4UPA A;  1G6P A;  1NBW A;  1S40 A;  1W3S A;  2N78 A;  1X3F A;  4C3H H;  4HIK A;  2VY3 A;  1FGU A;  4P72 A;  1Y14 B;  4R4Q A;  3ULL A;  3PO2 H;  2YTY A;  4BY1 H;  2ALY B;  2KEN A;  1UE5 A;  1I94 L;  1N33 L;  1VQG A;  1EUJ A;  2A8V A;  2BA0 A;  1L0W A;  1S3O A;  4PZ7 A;  2MO1 A;  4BBS G;  1CSQ A;  3KLW A;  1JT8 A;  5FLX c;  1VQ9 A;  5IE8 A;  4A3G H;  1VQP A;  5IY0 A;  3I4M H;  2EIF A;  2XTI A;  2FXQ A;  3BJU A;  5M3F H;  2K5N A;  3H3V I;  1LTL A;  5J3B A;  3M4Q A;  2WAQ G;  2OTL A;  4A3J G;  3CCV A;  3RNU A;  4DAY B;  1EIF A;  3E0E A;  4JOI C;  4AQY L;  4JI8 L;  3TS2 A;  3Q8D A;  1B8A A;  1X56 A;  4P73 A;  3F2C A;  3J7A 5;  2KBN A;  1IZ6 A;  2ZJP A;  4JBM A;  1WI5 A;  4LF9 L;  2UXD Q;  1TWH H;  5GAD C;  4A3K G;  1KHI A;  1HR0 W;  2QGQ A;  3M9B A;  4J15 A;  4DK6 C;  1K73 C;  1EOV A;  4PMW A;  1G51 A;  1XPU A;  3CCE A;  4JBJ A;  2MQH A;  2VQF Q;  1CKM A;  2I5L X;  1YEZ A;  2PI2 E;  4B3M Q;  3GTO H;  1YHA A;  1UE7 A;  1HNZ Q;  1L1O B;  4C3I H;  2JA8 G;  4YCW A;  5BR8 L;  2UU9 Q;  4JI3 Q;  3G6E A;  1OTC A;  1PH3 A;  3ICE A;  1B7Y B;  1XNR L;  1YBY A;  4DV2 Q;  2ES2 A;  1A63 A;  2JA9 A;  4MTN A;  3CAM A;  4OON A;  1Y1V G;  1J5E L;  1TWA H;  1KIX A;  4BBS H;  1EQR A;  4JI1 L;  1ASZ A;  4OXP A;  2ZM6 L;  1N34 L;  3UDX A;  2R7Z G;  2E5L Q;  1X3G A;  2ZJQ A;  1I5F A;  4LFC Q;  3RLO A;  3ZJY C;  3MEF A;  1HZC A;  3CMA A;  1MKH A;  3UDI A;  2K5V A;  4DV0 L;  1UWV A;  3CQZ H;  4GNX B;  4ALP A;  2A19 A;  4OX9 L;  3HOZ G;  1SN8 A;  2IHF A;  1LYL A;  3NEN A;  2E8G A;  4DR4 L;  2H5X A;  2IT1 A;  2RCN A;  3OTO Q;  4HJ8 A;  1K9M C;  1XNQ Q;  2UUB Q;  4OWX B;  3F8T A;  4GKK Q;  4YCV A;  3SGI A;  1KRT A;  3CCR A;  3CC7 A;  1V43 A;  3AEV A;  1WYD A;  2Y0S G;  2K52 A;  3BU2 A;  3EIV A;  4JI7 Q;  4JV5 Q;  5C44 H;  1Q86 C;  1KC8 C;  3CF5 A;  1L1O A;  1M90 C;  2F4V L;  4DR6 L;  3A5U A;  2V1C C;  4B3T Q;  2JA8 H;  4C3J H;  1XJV A;  3S2D H;  4JCV E;  1JMC A;  1HH2 P;  4GOP C;  2LXK A;  3J80 c;  4A93 G;  4DNI A;  4DV3 Q;  2BA1 A;  4KHZ A;  4TQU S;  2N49 A;  3GTL H;  2VW9 A;  3CPW A;  4L5T A;  4DV7 L;  1SMX A;  2Q2U A;  1VQJ A;  2R6G A;  3L0O A;  4PZ6 A;  4YY3 Q;  1VCI A;  2R7Z H;  4YWK A;  1OXU A;  5GQO A;  2KHI A;  4GNX A;  5LMN L;  4A4I A;  4LF4 Q;  4QIW E;  5FJ8 G;  3B6Y A;  1Q81 C;  2LSS A;  2NVQ H;  1LM0 A;  4X65 Q;  5JJL A;  5GAE C;  3T1H L;  2F3I A;  3HOY G;  2Y0S E;  3LGJ A;  1I3Q H;  3HFZ B;  4LFB Q;  2UXB Q;  2HHH L;  4JI0 Q;  3PUY A;  2NZO A;  2IHE A;  1HNX Q;  2VZA A;  2I5H A;  4A3E G;  2AHO B;  2DGY A;  3IRB A;  3OW2 A;  1IBM L;  4A3B G;  1IXR A;  2ZTD A;  2CFM A;  4LW1 A;  4BY1 G;  3RLF A;  2YU9 H;  5GAG C;  4A3F G;  2NVX H;  3I4N G;  3S16 H;  4B3R L;  3GTP H;  1W2B A;  4A3I G;  1S72 A;  3GTK H;  1PHJ A;  4BXX H;  2MNA A;  1N8R C;  2CCZ A;  4Y52 H;  1E1T A;  4BBR G;  4XTC S;  1JB7 A;  4A93 H;  1O7I A;  4FDB A;  4BY7 H;  3U4Z A;  2Z6K C;  1JE5 A;  5IT9 c;  3EBE A;  3PIO A;  4A3L G;  1PH4 A;  1UEB A;  2A1A A;  2Q2I A;  4A3C G;  3HOW G;  2AWO A;  2PQA A;  1PH2 A;  1J6Q A;  1BVS A;  2R93 G;  4KHP Q;  2K50 A;  4GLA C;  2IX1 A;  2CWP A;  1PA6 A;  1WJJ A;  5FJ8 H;  4DV4 Q;  4L5R C;  4NXM L;  2RHQ B;  3H0G H;  3ERS X;  3HKS A;  3RR5 A;  2WB1 G;  2MO0 A;  4GN5 A;  4UP7 A;  5C3E G;  3H3V H;  2EXD A;  2PNH A;  3U58 A;  5ELN A;  1I94 Q;  4DV6 Q;  2UUA Q;  3RN5 A;  3CME A;  3ULP A;  4QQB X;  1RIP A;  4A3E H;  1K0R A;  4A3B H;  5LMN W;  5HGQ A;  2PI2 A;  1K8G A;  4NXN L;  4DR1 L;  3VDY A;  4A3F H;  3CCQ A;  1XMO L;  3I4N H;  3PO3 H;  4A3I H;  1PH1 A;  4OWW B;  2UXC L;  4BBR H;  1OXX K;  1V9P A;  3W1B A;  5IP9 G;  1QZH A;  4DUY Q;  1QVC A;  2R7F A;  1PV4 A;  2HIV A;  1IYJ B;  4R1J A;  4AQY Q;  1GVP A;  1PH9 A;  4JI8 Q;  3I56 A;  2VQE L;  3HOY H;  4A3L H;  4A3C H;  4IPD A;  3HOW H;  2WB1 E;  3A0J A;  4UP8 A;  1SE8 A;  3I55 A;  2VNU D;  3T1Y Q;  2R93 H;  4WJ3 M;  1VQF A;  1SLJ A;  1QZG A;  4K0K Q;  1M1K C;  3NBH B;  2B63 G;  1U0L A;  2CQO A;  2WFW A;  4YHH Q;  1Y1W H;  4LFA L;  1SFO H;  3K80 C;  2BH2 A;  4POF A;  3RZO H;  1A0I A;  3GD7 A;  4X62 Q;  5C3E H;  2NN6 I;  1NMG A;  5DLQ E;  3STB D;  1XTD A;  4P75 A;  5BR8 Q;  2Q2T A;  2KCT A;  3K7A H;  3S1N H;  3J7Z C;  1VQH A;  5C44 G;  2HIX A;  1XNR Q;  1EFW A;  3J81 c;  3CPF A;  3GTQ H;  1J5E Q;  5IYC H;  2R92 G;  1CUK A;  3UE0 A;  3PIP A;  2VS1 A;  1E22 A;  3MXN B;  2ZM6 Q;  1N34 Q;  4JI4 Q;  2Q2H A;  5AJ3 Q;  2RHS B;  3K81 C;  4KI0 A;  4LF8 Q;  1RL2 A;  4A3D G;  1EQQ A;  3GTG H;  1Q7Y C;  1E7Z A;  2WAQ E;  1YHB A;  2E2J H;  5IP9 H;  4ME3 A;  5JEA G;  3M85 A;  3U50 C;  2ZJR A;  4DV0 Q;  4LF5 Q;  4LF6 L;  4X6A H;  3DM3 A;  1X6O A;  1VQ5 A;  1E1O A;  1VQ7 A;  1GD7 A;  4OO1 G;  1UE6 A;  1UE1 A;  3KF6 B;  3K0X A;  3KJO A;  1PH8 A;  2E2H H;  5JJK A;  4LF7 Q;  4BA2 I;  3BZK A;  2ZTE A;  1Z47 A;  3FHW A;  3GDE A;  2AWN A;  1ASY A;  1PYS B;  1OXV A;  4GN4 B;  2GVB A;  1IBL L;  1VQI A;  5M5X H;  2B63 H;  1PFS A;  1Q46 A;  3M4O H;  4IFD I;  5GRO A;  3J80 i;  5IWA L;  5C0X I;  1JJC B;  3CCS A;  1IBK L;  2F4V Q;  4DR6 Q;  2VQF L;  4B3M L;  3A5Z B;  1KRS A;  3S2H H;  4QY7 A;  4JI3 L;  3PV0 A;  2OTJ A;  4JBW A;  2QEX A;  4JYA Q;  3PUW A;  4DUZ Q;  4QJF A;  1NE3 A;  2R92 H;  4EQ5 A;  4BXX G;  1Q82 C;  4DV1 Q;  4DR2 Q;  4DR7 L;  1Q1B A;  4A3D H;  2OCE A;  4BY7 G;  1N32 L;  4RMF A;  2JA5 G;  1TXY A;  1EWI A;  3TRZ A;  1Z9F A;  5LMN Q;  1VS0 A;  4GLV B;  4NB3 A;  1G29 1;  2B3G A;  3JC6 6;  1V1Q A;  1YI2 A;  3KF6 A;  3T1H Q;  4UY8 C;  1FJG L;  3UDF A;  1BKB A;  3M3Y H;  5JEA J;  1XNQ L;  4B3S L;  4UP9 A;  1TWC H;  2HHH Q;  4DR3 L;  2UUB L;  1KXL A;  4DV5 L;  3H0G G;  2JA7 H;  4MZ9 A;  1HJP A;  3U4V A;  4A3M H;  1VQE A;  1IBM Q;  2NZH A;  4IPG A;  4BA1 I;  4DR5 Q;  4X66 Q;  3KFU A;  1Q8K A;  2ZTC A;  4IO9 A;  4YWM A;  3STB C;  5IYB G;  4B3R Q;  1X65 A;  4R4I A;  3PUZ A;  4JC0 A;  4B3T L;  5HY6 A;  1L2F A;  1SRO A;  3GTM H;  1VQ6 A;  1E24 A;  3G71 A;  4IPC A;  2N8N A;  2JA6 G;  3PO3 G;  1KAW A;  4HJ9 A;  1AE3 A;  3PGZ A;  1HR0 Q;  1CKN B;  2AKW B;  2NN6 G;  1VQA A;  3NEL A;  2I0Q A;  1X55 A;  2I5M X;  3GO5 A;  3L7Z C;  4P74 A;  1VQ4 A;  1D7Q A;  4YY3 L;  3CW2 C;  2JA5 H;  1YJW A;  1FVI A;  4JOI A;  1CSP A;  1TWF H;  3M4P A;  5M5Y H;  1HZ9 A;  3AFP A;  4HID A;  4HJA A;  1OXS C;  3RN2 A;  4DK3 C;  2UUC Q;  1QUQ B;  2VUM H;  4X64 L;  2OWO A;  2CWA A;  3HOX G;  1XPR A;  3S24 A;  3PF4 A;  5K36 G;  4LNQ A;  4X65 L;  4JI5 Q;  1HNW Q;  1CKO A;  2AMC B;  4DKA C;  2JEB I;  4QGU A;  2YYZ A;  4JI2 L;  2UXB L;  3L2P A;  1YJN A;  4JI0 L;  2PMZ E;  3TRE A;  4APV A;  4DAM A;  1Y1W G;  1XMQ L;  3KJP A;  3S1Q H;  2WP8 J;  5LMU L;  1Q12 A;  1B70 B; 
#chains in the Genus database with same CATH topology
 1X54 A;  1XMO Q;  4NXN Q;  1LO5 D;  2PZT A;  4KTA A;  2RDG A;  4AYB G;  3KDF B;  1SMY C;  5IYC G;  5A2Q E;  1LT3 D;  3NEM A;  3BZC A;  5IGG A;  4LAA A;  5EJW A;  1VQD A;  4POG A;  1TVX A;  2B8F A;  1II3 A;  4K8J A;  2EQS A;  2R7D A;  4PG3 A;  4KHP L;  1HQR D;  4LF9 Q;  4TRD A;  2ID0 A;  1F2Z A;  4XQQ A;  5LNK 1;  2A74 C;  2BH8 A;  4ULL A;  3ND9 A;  1A3T A;  1S5E D;  2L12 A;  3G48 A;  3RD4 A;  1SNQ A;  3G6J B;  4RGM A;  4IUR A;  1WFQ A;  5IYD G;  5IGD A;  2EXZ A;  2JEA I;  2D2C C;  3TEH B;  4UDU C;  4GOP A;  1ICF B;  3S16 B;  2IY5 B;  1S5D D;  3D4W A;  3A55 A;  3K57 A;  3PUV A;  5C0X H;  4LF6 Q;  3AU7 A;  4AIM A;  2EYP A;  4HCE A;  1KQS A;  3R2T A;  5C0X J;  4OX9 Q;  2LS0 1;  3I2Z A;  1CQF A;  4R4O A;  5CR3 A;  5GAH C;  1VQ8 A;  4WJ4 A;  4CJ0 B;  1YO7 A;  3WDN A;  1JJ2 A;  2JA7 G;  3J80 E;  4A3M G;  1EU3 A;  2VXW A;  2Z0S A;  2PMZ B;  4HCS A;  3CP0 A;  4XDX A;  5HGI A;  3L9A X;  1VQM A;  3HOV H;  2M2L A;  1JE4 A;  3VR6 A;  3P23 A;  5C5M A;  3PO3 B;  3FPU B;  1K3R A;  5JPM C;  1SNO A;  1NJI C;  4Y7N H;  3HOU G;  1DYQ A;  2B2U C;  2Z6K A;  2EJF C;  3AB9 A;  4L5S A;  4A76 A;  4A3J H;  2ATW A;  1ENA A;  2NBF A;  2B2V A;  5E7N A;  1FJG Q;  2E5L L;  1SE2 A;  5ELB A;  3HOX B;  1YIT A;  1R9T B;  2OQK A;  4IJL A;  4DR3 Q;  4DV5 Q;  2JK8 A;  3CC4 A;  4A75 A;  2DJG C;  5M3M G;  2GSC A;  2CH4 A;  2KCM A;  4MIU A;  2ASB A;  2K33 A;  5CV4 A;  2F0T A;  5C3X A;  5C4J H;  2F0U A;  1A6X A;  4KJO A;  1HUM A;  1NR2 A;  1PYB A;  3UIT A;  2AUK A;  1KAB A;  4JBK A;  2F52 A;  1XYI A;  2BDO A;  4DPG A;  2GN5 A;  1BBU A;  3HOZ H;  2A6E C;  2DUD A;  2QCP X;  3KF8 B;  2YTX A;  1VQL A;  4NXM Q;  1GHJ A;  2M9V A;  2ZXO A;  2NVY H;  3HG9 A;  4C3H G;  2XIW A;  1JIC A;  4X66 L;  5I4D A;  4AH6 A;  1HNX L;  1QIL A;  3E9I A;  1EL0 A;  1PZJ D;  2XWB B;  3CRL C;  1BXT A;  1K8A C;  4A3G G;  1D1K A;  2XWJ B;  5M3F G;  3I90 A;  3T53 B;  2F0J A;  1EYA A;  1HZA A;  1WTX A;  5C0X G;  2PW7 A;  2YTV A;  2IJ0 A;  1I50 B;  1C9O A;  2K03 A;  4A3K B;  1ZXT A;  1LAC A;  4XQN A;  4G7Z C;  4O0A A;  2Z8L A;  2JA7 B;  2K5Q A;  1NBW A;  2HDL A;  1W3S A;  4H13 C;  1PTO F;  2K05 A;  2SNS A;  2VY3 A;  4P72 A;  1I94 L;  1VQG A;  2F4I A;  4CDF C;  3K5N A;  3BZD B;  4WOR A;  1D1I A;  3HOU B;  1JT8 A;  3MVV A;  2F1M A;  3QO2 A;  1VQP A;  2O5I C;  2B2Y A;  3N52 A;  2K5N A;  3BVM A;  1LTL A;  5J3B A;  2WAQ G;  4A3J G;  3CCV A;  3RNU A;  1UEA B;  3E0E A;  4AQY L;  1SXT A;  2A6H C;  1A15 A;  1B8A A;  1X56 A;  4P73 A;  2ZJP A;  4JBM A;  1BDO A;  3PQI A;  5M3M B;  1HR0 W;  3M9B A;  4DK6 C;  1AP0 A;  4M1U B;  1EOV A;  4PMW A;  1XPU A;  1MSH A;  1CKM A;  2I5L X;  3GTO H;  5EBD A;  1TII D;  4C3J G;  4JI3 Q;  3F2U A;  3I8Z A;  2ES2 A;  2JA9 A;  1U4M A;  2KJX A;  2LFN A;  3CAM A;  1J5E L;  1ET9 A;  1ASZ A;  3G7L A;  4C1N K;  2E5L Q;  1X3G A;  2ZJQ A;  1I5F A;  3V96 A;  1CHP D;  1PTO C;  1HZC A;  4OEL B;  5F2D A;  1O80 A;  4ALP A;  5IOC A;  3HOZ G;  1LYL A;  1PZK D;  1ZKO A;  2B2T C;  3J7A F;  2RCN A;  2H1E A;  1E2Z A;  4C3H B;  1ET6 A;  1SYB A;  1V43 A;  3BU2 A;  2F03 A;  1LT6 D;  1KC8 C;  1L1O A;  2F4V L;  3A5U A;  1D5Z C;  1F2L A;  4A3G B;  1GOZ A;  4KJN A;  4A93 G;  5M3F B;  2VW9 A;  3GQB A;  1WD1 A;  5CMD A;  4DV7 L;  3HRZ C;  4X3U A;  1VCI A;  2R7Z H;  2G5D A;  4IZ8 A;  1QE6 A;  3QG1 A;  4OO1 H;  2CAZ B;  4L63 B;  4GNX A;  2D9U A;  2WB1 B;  4DU9 A;  2FUG 1;  1TWH B;  3ERQ A;  1QB5 D;  2NVQ H;  3B6Y A;  1Q81 C;  2LSS A;  5JJL A;  2F3I A;  2BDN A;  3LGJ A;  1F9S A;  4ZAI A;  4JI0 Q;  4L6T B;  2NZO A;  2RQX A;  1HNX Q;  2GA4 B;  2VZA A;  4G75 A;  4YZD A;  2I5H A;  4A3E G;  2AHO B;  2DGY A;  1VMC A;  3QWN A;  2CFM A;  3FDT A;  4ZQ3 A;  3RLF A;  2DN8 A;  4CKB A;  4B3R L;  1C4Q A;  3J7Y W;  3GTK H;  4Y52 H;  1E1T A;  1K8M A;  1JB7 A;  2IW3 A;  2XN9 C;  2EYH A;  3U4Z A;  1JE5 A;  3KUP A;  1F77 A;  2WAQ B;  3EBE A;  3PIO A;  4A3J B;  2PYK A;  5ISR A;  4AS2 A;  3HOW G;  1TS4 A;  2AWO A;  1PH2 A;  1BVS A;  2IX1 A;  3MFG A;  2K5D A;  4L5R C;  1TDP A;  4H44 C;  2D5D A;  3H0G H;  3RR5 A;  3CHB D;  5C3E G;  4DN4 M;  1SYE A;  5EKI A;  2EYM A;  1I94 Q;  1V1P B;  1TS2 A;  1KTK A;  4C3J B;  3S2D B;  3A7A B;  2X6G A;  1K8G A;  2M00 A;  4DR1 L;  4KKS A;  2SOB A;  4TKO B;  4A3F H;  1CZG A;  1PH1 A;  3R3O A;  1EIH A;  4OWW B;  2PW5 A;  4BBR H;  4DUY Q;  1HPC A;  4AQY Q;  1GVP A;  4FF1 A;  4A3L H;  3HOY H;  3OOC A;  4ZKB B;  4IPD A;  2QF7 A;  3HOZ B;  3A0J A;  1SE8 A;  1EYC A;  1R4P B;  1HA6 A;  1I3Q B;  1CTM A;  1QZG A;  2AQ2 B;  4K0K Q;  1EY9 A;  2NVY B;  2WFW A;  4YHH Q;  4IUQ A;  1Y1W H;  5DLQ E;  2Z4I A;  1XTD A;  2YU9 B;  2KCT A;  2B39 A;  3R93 A;  2NVX B;  3FVV A;  1VQH A;  3J81 c;  3GTQ H;  1J5E Q;  4A93 B;  3PIP A;  1WD0 A;  3DXJ C;  4CJ2 C;  2KOL A;  3TP5 A;  1E7Z A;  5IP9 H;  1O7Y A;  5FK9 C;  2ZJR A;  2ICE C;  1X6O A;  1VQ7 A;  1GD7 A;  4OO1 G;  1BO0 A;  1UE1 A;  1X32 A;  1LTT D;  4C1N I;  1Z47 A;  3MTS A;  1OXV A;  2B63 H;  4GXT A;  1VQI A;  1YNJ C;  5C0X I;  1STH A;  4A3E B;  1IBK L;  2F4V Q;  1B53 A;  4L8J A;  4B3M L;  3FPP A;  5EGT A;  3QR8 A;  4QY7 A;  3MAQ A;  1WTO A;  4JYA Q;  1SMY D;  3PUW A;  4HN7 A;  4NW2 A;  4DUZ Q;  2KUM A;  1E0B A;  1NE3 A;  3DMU A;  1PZI D;  1N32 L;  2JA5 G;  3HOW B;  3IL8 A;  1EZ8 A;  1Z9F A;  1VS0 A;  1S5B D;  5C5L A;  1U4P A;  5BN4 A;  3I3C A;  5IGF A;  3KF6 A;  1MI2 A;  2K04 A;  3L3O C;  1XNQ L;  1JC7 A;  1WTW A;  5C3E B;  3H0G G;  4MZ9 A;  1VQE A;  4IPG A;  3VA7 A;  1TY2 A;  4DR5 Q;  5IYB G;  4B3R Q;  1X65 A;  4JC0 A;  1TY0 A;  2N8N A;  3DEP A;  2E2J B;  4OL7 A;  3LJ1 A;  3SDZ A;  3E6Z X;  1PLF A;  2AKW B;  2I5M X;  1D7Q A;  2JB3 A;  1VQ4 A;  3CW2 C;  1B4O A;  1FVI A;  4JOI A;  2UUC Q;  3HOY G;  3J81 L;  3IFT A;  1B44 D;  5COY A;  1OXS C;  2VUM H;  1ILP A;  2MGS A;  2F0G A;  3U9O A;  4JI5 Q;  1HNW Q;  4DKA C;  4RKB A;  2FMC A;  3L2P A;  1ML0 D;  5FLX E;  4KN4 C;  1Y1W G;  1XMQ L;  1SAP A;  1MBY A;  5E4W C;  1VF5 C;  3KJP A;  1Q12 A;  4DR1 Q;  1GHK A;  1RKN A;  2CH4 W;  5FO8 B;  5JJI A;  1N36 L;  3L0I A;  1NUC A;  4RHS A;  5LL6 S;  2NN6 H;  2IX0 A;  4PNY A;  1N9W A;  2KEE A;  4F7X A;  3DA3 A;  1B3A A;  2B8G A;  3NQI A;  3WWV A;  1QVG A;  3TQY A;  1A8V A;  5AFW A;  3HOX H;  3OPO A;  4YWL A;  2Q8R E;  1R9T H;  1GKH A;  4WFN 3;  1JOK A;  2L15 A;  3JAM c;  1H9R A;  3P1H A;  1WTR A;  5IIF A;  5JVH 3;  2ENB A;  1EYG A;  1U4L A;  4XIG S;  4PZ8 A;  2XVS A;  3GTM B;  2RF4 A;  1AZQ A;  2JE6 I;  5I2X A;  5H1S E;  1AE2 A;  4HIM A;  2EE1 A;  1P16 A;  5J1Z A;  3UI2 A;  2JA5 B;  5M5Y B;  1IL2 A;  1FYC A;  4GLX A;  1WCM G;  1Z7T A;  1A2T A;  2HT1 A;  2FU2 A;  1YIJ A;  1VQO A;  3T1Y L;  3A8J E;  3V2T A;  1ONL A;  4N8F A;  3F1Z A;  4DR4 Q;  1NY4 A;  3S1Q B;  1IBK Q;  3RZD H;  4QCL A;  4MNO A;  4X62 L;  2EY5 A;  4N8X 1;  2G9H D;  4F8M A;  4O42 A;  2DY7 A;  1AH9 A;  5IYD H;  3WOF A;  2UU9 L;  3DUZ A;  2O4X A;  5AJ3 L;  4LF8 L;  1N32 Q;  2F0L A;  3HKZ G;  2Q8T A;  4L5Q A;  5CBA E;  4R4T A;  1TU2 B;  2XSC A;  4KMU C;  4LF5 L;  3HP3 A;  4GS3 A;  4LFC L;  4LUO A;  1G2S A;  3A8I E;  3NPP A;  2NUC A;  1B1Z A;  1I50 H;  2VUM G;  4QL5 A;  2GVA A;  4LF7 L;  1IYU A;  4A3K H;  4IUT A;  5KND A;  4HSV A;  3OTO L;  3E5S A;  2KQ3 A;  2OT2 A;  4FF4 A;  3VYT A;  1MJC A;  2KCC A;  3W1G A;  1PFB A;  3RMH A;  1T5E A;  1ZEQ X;  4JI7 L;  2B29 A;  1EY7 A;  2N88 A;  2RA4 A;  3CU7 A;  2JJQ A;  3W5O A;  1YHQ A;  3JAM L;  1E3P A;  3HOU H;  1V8Q A;  1S5F D;  1RDP D;  1KL9 A;  4ZUJ A;  1NMF A;  4QMG A;  3AJF A;  2A6H D;  1WOC A;  4HMJ A;  5IP7 G;  4HIO A;  3R8B A;  1EU4 A;  1K3B C;  1IKL A;  4G7O C;  1XMQ Q;  5M3M H;  4PV1 C;  1STG A;  3OMG A;  3V05 A;  1MJE A;  1EY8 A;  1DGS A;  3S1R B;  3FP9 A;  4OO1 I;  2L11 A;  2PQE A;  1VQB A;  3CCJ A;  1N36 Q;  1AZP A;  1AW7 A;  3I4M G;  5IGB A;  4R8I A;  4J1M A;  4OGQ C;  1K83 B;  1DD2 A;  1WCM B;  5EPJ A;  1PH5 A;  1PTO D;  4KY5 A;  3D6W A;  3D8G A;  4ID6 A;  3Q6S A;  1EIY B;  2Z4H A;  3A74 A;  2JAE A;  1B9N A;  4EVO A;  4RG1 A;  1GUN A;  1H9M A;  1G6P A;  4HIK A;  4K5W A;  4C3H H;  1Y69 U;  1FGU A;  3ULL A;  4BY1 H;  4C3I G;  5DAU A;  1N33 L;  3VA9 A;  2MO1 A;  4CBV A;  4BBS G;  3KLW A;  3Q0A A;  4A3G H;  4FO2 A;  3BYY B;  3HKZ B;  2OXP A;  2FXQ A;  3BJU A;  3KLS X;  5M3F H;  3OIP A;  2ETD A;  1C8C A;  2OTL A;  2NTT A;  4IUP A;  4J8Q A;  2IL8 A;  4DAY B;  3BDO A;  1JWM D;  2VUM B;  2MP1 A;  1IKM A;  5E1F A;  3F2C A;  3DHQ A;  5CBE E;  3K5M A;  1KLU D;  2RVL A;  1TWH H;  4A3K G;  3H09 A;  4J15 A;  5ELD A;  1K73 C;  5EKK A;  1HUN A;  3CCE A;  4V0B A;  1XX8 A;  1XXG A;  5C4H A;  4RFB A;  1YHA A;  2FFK B;  1EYD A;  2K01 A;  5BR8 L;  2UU9 Q;  1WTV A;  3G6E A;  1XNR L;  1A63 A;  3R2I A;  1D2B A;  5G3L F;  3IFD A;  4JI1 L;  4ZYS A;  4OXP A;  4C2M B;  1BCP F;  2HD3 A;  3OIQ A;  2MHV A;  3UDX A;  2OF1 A;  2X69 A;  4LFC Q;  4X3K A;  2EVB A;  1VDZ A;  3SR1 A;  3K59 A;  2DJF C;  1DOL A;  4OIJ A;  3UDI A;  4MN3 A;  2LKV A;  1UWV A;  4DV0 L;  1SN8 A;  2IHF A;  5C4Z A;  4MTK A;  2JYO A;  3OTO Q;  4HJ8 A;  3BVZ A;  2UUB Q;  5KRU A;  1RTO A;  4K5X A;  3AEV A;  2Y0S G;  4JI7 Q;  1F2Y A;  3NSW A;  1Q86 C;  4NDX A;  4C3J H;  3S2D H;  3I4M B;  2LXK A;  4YZC A;  3J80 c;  4DNI A;  4TQU S;  3P75 A;  2L55 A;  2Q2U A;  1VQJ A;  2R6G A;  3L0O A;  4YY3 Q;  4ZCK A;  4YWK A;  5LMN L;  4G4K A;  1IL8 A;  4QIW E;  4X65 Q;  1WTP A;  1I3Q H;  4ILW A;  2UXB Q;  2HHH L;  3RZD B;  5M9O A;  4C3I B;  2QSB A;  3KP9 A;  3OW2 A;  1BCP C;  1O78 A;  4LW1 A;  4HMI A;  4BY1 G;  1Y8O B;  2V6E A;  2YU9 H;  1B2T A;  4BBS B;  2NVX H;  1TWA B;  1W2B A;  1JB3 A;  4DAP A;  1PHJ A;  2CCZ A;  4EGV A;  4RCN A;  3GV6 A;  1I4X A;  4A93 H;  1O7I A;  5JAV A;  1R4Q B;  3I91 A;  1PH4 A;  2BE5 C;  1UEB A;  3A7L A;  2Q2I A;  4A3C G;  4FF2 A;  5HUR A;  2PQA A;  1J6Q A;  2NZ1 D;  5EKL A;  2R93 G;  1NCV A;  4GLA C;  4KHP Q;  2QW7 A;  4FP5 D;  3HZX A;  2CWP A;  2RHQ B;  2K19 A;  3ERS X;  3HKS A;  1DON A;  2WB1 G;  2MO0 A;  3VYR A;  1YNJ D;  2K1B A;  4G76 A;  2QGM A;  1PXU A;  3U58 A;  5ELN A;  1A2U A;  1KDC A;  2PPB C;  5CV9 A;  4QQB X;  1RIP A;  4A3E H;  4UHV A;  1STA A;  1K0R A;  1EIG A;  1QNU A;  3OW7 A;  5IGE A;  2YFA A;  3CCQ A;  2B2U A;  2F0O A;  2L1B A;  2UXC L;  3BDC A;  3I73 A;  4QUC A;  1V9P A;  1QZH A;  1QVC A;  5IGC A;  4RGO S;  3I56 A;  2VQE L;  1AFP A;  5FO7 B;  3HOW H;  3LWU A;  1EWH A;  4UP8 A;  3I9V 1;  3I55 A;  3J80 L;  3SHL A;  2TMP A;  4LFA L;  2SEB D;  3K80 C;  2Y0S B;  3GD7 A;  5C3E H;  2NN6 I;  5BR8 Q;  2Q2T A;  4LMQ D;  2HIX A;  1XNR Q;  3GTP B;  2F0H A;  4CGY B;  2R92 G;  1CUK A;  1Q8I A;  3UE0 A;  4BY7 B;  1E22 A;  1CA5 A;  2Q2H A;  1IYV A;  2RHS B;  3BDL A;  4KI0 A;  4A3D G;  1JOO A;  1TQO A;  1YHB A;  4WRD A;  2R61 A;  4ZLT F;  2E2J H;  5JEA G;  3U50 C;  4DV0 Q;  4X6A H;  3DM3 A;  3P20 A;  1VQ5 A;  2K28 A;  1SDF A;  3IAY A;  3NBH A;  1ASY A;  3OWF A;  3ITP A;  4OHJ A;  1IBL L;  1SJH D;  1HFG A;  5IWA L;  3NUC A;  1E2V A;  3I72 A;  2VQF L;  4BY1 B;  1SJ8 A;  3HGB A;  3PV0 A;  1BBX C;  4JBW A;  3T51 B;  2E75 C;  2QEX A;  1ENF A;  4EQ5 A;  3BG3 A;  4DR7 L;  1LAB A;  2NWG A;  5CV6 A;  4RMF A;  1TXY A;  2IWH A;  1LTA D;  3H94 A;  5LMN Q;  3NK9 A;  2R93 B;  1SEB D;  1LT5 D;  3BYT B;  1GUW A;  1CK1 A;  1BKB A;  4B3S L;  2HHH Q;  1SFO B;  3TSS A;  2RIO A;  3FBV A;  4X3T A;  1H9S B;  4RCO A;  1HJP A;  1Y8P B;  2H4O A;  3U4V A;  2WKD A;  4X66 Q;  3KFU A;  1RTN A;  4YWM A;  2SDF A;  5JOB A;  4RAU C;  5BN3 A;  5I6Y A;  4B3T L;  1ESF A;  4B9W A;  1L2F A;  1FD7 D;  1GUO A;  3GTM H;  3LNN A;  5JVG 3;  2JA6 G;  1AE3 A;  1JOR A;  4K5V A;  1QOH A;  1X55 A;  4ABN A;  3GO5 A;  4FF3 A;  3QJY A;  2JA5 H;  1GXD C;  5M5Y H;  1LLR D;  1HZ9 A;  2E2H B;  1STY A;  1TT2 A;  3TP6 A;  4IN3 A;  1XPR A;  2I07 B;  2DNC A;  3LWE A;  4F88 A;  5C3W A;  2A2D A;  1YJN A;  2PMZ E;  3TRE A;  3VR3 A;  4DAM A;  1HA5 A;  3S2H B;  3S1Q H;  5CV7 A;  2WP8 J;  2J7Z A;  4KHZ A;  1JQY D;  2N55 A;  5IYB H;  1VQK A;  2R92 B;  2DNE A;  4GOP B;  1O7Z A;  2UXC Q;  3A56 A;  3I4O A;  1Z6H A;  4JI6 L;  4A3D B;  1TS3 A;  4IFD G;  1CKN A;  4P2C B;  2PZW A;  1CT1 D;  4UAI A;  2VQE Q;  3Q23 A;  2IX3 A;  2CKZ B;  1K8O A;  2MFI A;  2L5T A;  1DXM A;  1EOT A;  1KD1 C;  1TWC B;  2RSO A;  2B2T A;  5J39 A;  2XTQ A;  2QIL A;  1JOQ A;  4DV4 L;  4LFA Q;  3J81 i;  2KED A;  4XT3 B;  3KYH C;  4LUV A;  1LTB D;  1PRT B;  2K5H A;  3EN2 A;  5T1G A;  3NTK A;  4CKE A;  4AYB E;  4DV6 L;  2UUA L;  1KAA A;  4OIK A;  2K75 A;  4IAL A;  4DA2 A;  1C7Y A;  4OWT B;  4O2D A;  3KDF A;  1EWC A;  4IOC A;  4OAU C;  3FKI G;  1I4G A;  4H0L C;  2AUJ D;  2F3W A;  1VQN A;  1X3E A;  2DY8 A;  1IW7 D;  2K7V A;  4XT1 B;  4FXK C;  4I7A A;  5D14 A;  1TWF B;  2D0P A;  4B08 A;  1BBW A;  1D8L A;  2WKC A;  2A69 C;  1RJT A;  4IOA A;  1IBL Q;  5IWA Q;  2F66 B;  1C48 A;  5FLM G;  3K8A A;  4NPS A;  1NTG A;  5M5W B;  3S1R H;  1HNZ L;  2SNM A;  1CM9 A;  2JA6 B;  1L0X B;  3S17 B;  1FL0 A;  4JI4 L;  4DR7 Q;  3PSI A;  4LUZ A;  3CRK C;  1F9R A;  4DV2 L;  3K5O A;  4GZY C;  4DV7 Q;  3EFX D;  1K83 H;  1S5C D;  1WCM H;  3S9W A;  3ULJ A;  2P5Z X;  4B3S Q;  3EQL C;  4X3S A;  1G2T A;  1C0A A;  3S1M B;  4FNF A;  3NWS A;  1PH7 A;  5EQ0 A;  2HQE A;  1UAP A;  2CW0 C;  4GKK L;  2CVR A;  3X3N A;  2ZT9 C;  1P8L A;  3GV3 A;  4DNT B;  4U68 A;  4FXD A;  1TWG B;  2N3S A;  2NYZ D;  4DV1 L;  4KLK A;  4DR2 L;  2KCN A;  4DV3 L;  3WOE A;  3MFY A;  1OO9 B;  2PQA B;  5C4X G;  4ZUI A;  3DA4 A;  1A3V A;  1Q3L A;  1I6H B;  5E3F A;  1VQC A;  2O5J C;  1HZB A;  4JG2 A;  3PF5 A;  3H15 A;  4KN7 C;  2QA4 A;  1KDB A;  3S15 H;  4LF4 L;  2RSN A;  1HCZ A;  3OYY A;  1STE A;  1QWY A;  1SRU A;  2XGT A;  3MXU A;  4R9W A;  2E76 C;  3PO2 G;  5I9O A;  1NSN S;  4NV5 A;  3CXC A;  3FKI B;  4JI6 Q;  3E9H A;  5CV5 A;  3UE1 A;  1OXT A;  4Z7G A;  3SE0 A;  1ICW A;  3TP7 A;  3F2B A;  1HR0 L;  1EEF D;  1U9R A;  5KEE A;  3DWA A;  3PUX A;  3F2D A;  4HJ5 A;  1YZ6 A;  2EY6 A;  3JAM E;  2E2I B;  4C2M H;  2X6L A;  4LK1 C;  3JAM i;  1H95 A;  3QOL A;  1BF4 A;  2FEF A;  1UNS A;  3KF8 A;  4N9T A;  5IP7 H;  1QUQ A;  2QKI C;  2JB2 A;  5FKA C;  2PZU A;  4DGZ A;  4UPA A;  1SYD A;  3NWT A;  2B2W C;  1LTR D;  1X3F A;  1ENC A;  2YTY A;  2KEN A;  3HEJ A;  1B50 A;  1UE5 A;  4KD4 A;  4YIJ A;  2A8V A;  1L0W A;  1S3O A;  2Z9H A;  1F9P A;  2JB1 A;  1I4R A;  1CSQ A;  5FLX c;  3I4M H;  5IY0 A;  2FMM A;  4I7Z C;  3NXW A;  4RH6 A;  3M4Q A;  2C9O A;  2CHB D;  1SE3 A;  1HHV A;  2P22 B;  2HCI A;  2RLD A;  1LTS D;  2V4D A;  2F0E A;  2A6E D;  3J7A 5;  3T16 A;  2EJM A;  1KDA A;  2ZRR A;  2KBN A;  4LF9 L;  5KGU A;  1WI5 A;  3TDQ A;  5GAD C;  3F4M A;  3K5L A;  1KHI A;  2QGQ A;  5G3L D;  1QNK A;  1G51 A;  3DO9 A;  4ZKC B;  1BCP D;  2MQH A;  1G91 A;  4B3M Q;  2PI2 E;  2L0C A;  1UE7 A;  1HNZ Q;  2TSS A;  1L1O B;  1D5X C;  4C3I H;  5D3I B;  4YCW A;  2JA8 G;  1JWS D;  3ICE A;  1B7Y B;  1YBY A;  1WTQ A;  4DV2 Q;  4MTN A;  4BBS H;  1PRT F;  1TWA H;  1EQR A;  3S14 B;  2ZM6 L;  1N34 L;  5C4X B;  1NNX A;  1G8Z D;  2RBM A;  3MEF A;  4LJZ C;  3CMA A;  1MKH A;  4DAV A;  4GNX B;  3FEW X;  4OX9 L;  2A19 A;  1HXY D;  3NEN A;  2E8G A;  3J7A V;  2H5X A;  2IT1 A;  2R3Z A;  5TSS A;  1K9M C;  1XNQ Q;  3M4Y A;  3TZU A;  1AEX A;  4BWG B;  4OWX B;  3F8T A;  3PO2 B;  4GKK Q;  1KRT A;  3MA2 B;  3CCR A;  2QEJ C;  2K52 A;  1BOS A;  3EIV A;  5C44 H;  4DR6 L;  5I2Y A;  1V1O A;  3D4D A;  1HQM C;  3I4L A;  4RWS C;  1JMC A;  1HH2 P;  3FMC A;  4GOP C;  2F3V A;  4DV3 Q;  2N49 A;  1SJE D;  1YNN C;  2BL7 A;  3KBX A;  1SMX A;  5K5P A;  4M8A A;  3DWP A;  4PZ6 A;  3TN2 A;  4DK1 A;  1OXU A;  5GQO A;  1STN A;  3VR5 A;  4A4I A;  4HSP A;  2JSO A;  4LF4 Q;  5FJ8 G;  5FLX L;  1NR4 A;  2BOS A;  1LM0 A;  3NBI A;  3HFZ B;  3PUY A;  1AN8 A;  2IHE A;  1PRT C;  2MJF B;  2F0V A;  1H9K A;  5CC4 A;  2F0S A;  4A3B G;  1I4Q A;  4O1P A;  5GAG C;  3I4N G;  4O1O A;  3GTP H;  2YFB A;  4A3I G;  4XTC S;  4BY7 H;  3FNB A;  2Z6K C;  4YZ9 A;  5IT9 c;  4K14 A;  3U9S A;  2A1A A;  2ICI A;  1DZ1 A;  2LY7 A;  3PMF A;  3CQZ B;  4FVM A;  2EYF A;  1KLG D;  2B2V C;  2RDF A;  2IPK D;  4Q0F A;  4OAV B;  1PA6 A;  4ZK9 B;  4NXM L;  1F2M A;  1EFI D;  4GN5 A;  4UP7 A;  2XRS D;  4KK7 A;  1MSG A;  3H3V H;  2EXD A;  2PNH A;  1LT4 D;  3ULP A;  2JA8 B;  3BVG A;  4FYD A;  1WVL A;  5HGQ A;  2PI2 A;  4G7H C;  5DNF A;  3GTL B;  3C46 A;  4F87 A;  1PYW D;  5A35 A;  4ZRZ A;  4G57 A;  1OXX K;  3W1B A;  1PV4 A;  2HIV A;  4R1J A;  1PH9 A;  4MHE A;  4A3C H;  4PQX A;  4JVZ A;  1W6J A;  2VNU D;  5K36 H;  2PNR C;  3T1Y Q;  2R93 H;  4WJ3 M;  3S15 B;  3B55 A;  4K2L A;  2KA7 A;  1CFM A;  2F0K A;  1SFO H;  3Q24 A;  3SXH A;  4X62 Q;  1NMG A;  1V1P A;  2MJ8 A;  4P75 A;  3K7A H;  4IQZ A;  3J7Z C;  2F0M A;  2LMC B;  5C44 G;  1EFW A;  3CPF A;  2VS1 A;  3LJ2 A;  2ZM6 Q;  1N34 Q;  5AJ3 Q;  3K81 C;  2EZV A;  4LF8 Q;  1RL2 A;  4Z9C B;  3OHX C;  1Q7Y C;  3NQT A;  4HED A;  2OEO A;  3E3X A;  4LF5 Q;  1E1O A;  4RHR A;  5ELF A;  3KF6 B;  3C1F A;  1UE6 A;  1CQV A;  3K0X A;  2KHS A;  1PH8 A;  2E2H H;  4R8N A;  4LF7 Q;  2O2L D;  3BZK A;  4IUU A;  2F0W A;  4CHT B;  1PYS B;  4J6H A;  5IT9 L;  2EY2 A;  1GUT A;  3P7J A;  5GRO A;  3J80 i;  4DR6 Q;  1JJC B;  2F0P A;  3CCS A;  4A3B B;  2EYO A;  1EY5 A;  3S2H H;  1PFN A;  3I4N B;  1ZYR C;  2VB2 X;  4JI3 L;  1FNU A;  2HDM A;  4A3I B;  4QJF A;  2R92 H;  3NE5 B;  3KK7 A;  3MWY W;  5D3D A;  2NTS A;  2HGK A;  4XYQ A;  4A3D H;  4PMC A;  1E2W A;  4BY7 G;  1DJR D;  2B2Y C;  5FO9 B;  3JSB A;  1UUP A;  3E0J A;  5JEA H;  4GLV B;  4EQP A;  3K6O A;  1FNV A;  3JC6 6;  1V1Q A;  1YI2 A;  4UY8 C;  1SNC A;  5JEA J;  4UP9 A;  1TWC H;  3CKI B;  3RZO B;  3S1N B;  1Y8N B;  2NZH A;  4AYB B;  3STB C;  3PUZ A;  5HY6 A;  1FGB D;  1X3Q A;  5A2Q L;  4IPC A;  3BS1 A;  1MGS A;  3GTG B;  4DNR B;  1KAW A;  2MPM A;  3PGZ A;  1VF7 A;  4DFA A;  1WTH A;  3L7Z C;  2FIN B;  3H6M A;  4P74 A;  1CI3 M;  5KNC A;  1SE4 A;  2A69 D;  2K32 A;  4KY7 A;  1CSP A;  1TWF H;  3M4P A;  3AFP A;  1QUQ B;  4X64 L;  5K36 G;  4LNQ A;  3M4O B;  5M5X B;  1CKO A;  2JEB I;  4QGU A;  4JI2 L;  2EJG C;  1XWE A;  5KIX A;  4JI0 L;  5LMU L;  3NP8 A;  5C44 B;  3MXP A;  1N33 Q;  3UDG A;  1PVO A;  1L1O C;  3K7U C;  4LWC A;  3G4S A;  3TP8 A;  5M5W H;  3KBG A;  3X3M A;  4GKJ L;  5CYU A;  3SVM A;  4EX5 A;  1K28 A;  4KV6 A;  2CQA A;  2JA6 H;  3FVQ A;  3S17 H;  3Q22 A;  4HTH A;  1HTP A;  3TS0 A;  3GTJ H;  2K6A A;  1RCV D;  4TVA B;  3HS0 C;  2BL8 A;  2HUG A;  3M3Y B;  4S3S A;  4GNX C;  2HQL A;  2VB3 X;  1JWU D;  2AQ3 B;  4NMZ A;  4A3M B;  2K14 A;  2JP1 A;  3D0F A;  4N9P A;  1NAP A;  2QDB A;  3ZYY X;  3S1M H;  2CW0 D;  3KOJ A;  4OEM B;  1MIU A;  1VMP A;  4V19 0;  1XPO A;  4HJ7 A;  2EPB A;  1D5M C;  2YV5 A;  2F0D A;  4HR7 B;  1Q1E A;  3HOV G;  4DXF A;  1TR5 A;  2WAC A;  5DEH A;  3IAM 1;  2A68 C;  4HEA 1;  2C35 B;  1SYC A;  4JI1 Q;  1TWG H;  3AYH B;  4IFD H;  4DUY L;  2C5C A;  2D62 A;  3CCU A;  1QVF A;  3RUZ A;  5EAY A;  4IFD J;  5JJZ A;  1JQO A;  1EY4 A;  1GM5 A;  2F0N A;  1I6H H;  3MC0 B;  1LUZ A;  4GN3 B;  5ELO A;  4K0K L;  3M7N A;  4TSS A;  1D6E C;  1G6Z A;  2NVT H;  1M8A A;  3PCO B;  4YHH L;  1LV9 A;  2UXD L;  3IAS 1;  2LXJ A;  3CCM A;  2JXM B;  3VR4 A;  4H02 A;  4IPH A;  1YJ9 A;  2MUY A;  2D0O A;  4DWL A;  3FKI H;  3RLN A;  2K4K A;  2RDH A;  2F0F A;  3T13 A;  3MXN A;  1EQV A;  4QUF A;  2E2D C;  1W6K A;  2L1L B;  2RAD A;  2E2I H;  1JCK B;  1KNE A;  4NV2 A;  2OQ0 A;  3AMU A;  1IHZ A;  2KHJ A;  2ZXR A;  4IJH A;  2A73 B;  3MXG A;  4O1N A;  5FLM H;  4I65 A;  3VA5 A;  3CC2 A;  4QF4 A;  5EPL A;  3K7A B;  3OMC A;  4P71 A;  1O7L A;  1GO3 E;  4JV5 L;  4JYA L;  3DLL A;  3HKZ E;  4DUZ L;  3CCL A;  1Y1V H;  1STB A;  1PH6 A;  4R4C A;  3AQQ A;  4X64 Q;  2WIN B;  1U5K A;  3D31 A;  5J22 A;  3AFQ A;  4KKU A;  2JQO A;  1A3U A;  4JI2 Q;  1PMR A;  1SR3 A;  3I7F A;  2JN4 A;  4CDC C;  1DCZ A;  3J81 j;  5LMU Q;  1M4V A;  4DR5 L;  4LFB L;  2RKS A;  1T9H A;  1F9Q A;  2VL6 A;  3ER0 A;  1A62 A;  5LHY 1;  3EA6 A;  3VYU A;  3HOV B;  4XQJ A;  4GKJ Q;  1YVC A;  3CD6 A;  3SK4 A;  3OWE B;  4Y7N B;  5BN5 A;  2F0Q A;  3K58 A;  5FOB B;  4KKT A;  1JJG A;  3S14 H;  4YCU A;  5ELC A;  4I1T A;  5C4X H;  2KEC A;  5IOD A;  3K0Y A;  2UUC L;  1X9N A;  3C2P A;  4KD3 A;  1SNM A;  2IP6 A;  3D3R A;  4JI5 L;  3J81 E;  1HNW L;  2ZW3 A;  1CZW A;  1YNX A;  2L9H A;  3M7G A;  1S40 A;  4Q5V A;  2N78 A;  2A5H A;  4R4Q A;  1Y14 B;  5C4J B;  3PO2 H;  3KLS A;  2ALY B;  5NUC A;  4CKC A;  3ERO A;  1GUS A;  1T5X D;  4DK0 A;  5KYL A;  1EUJ A;  2BA0 A;  2J4X A;  4PZ7 A;  1EZ6 A;  3A54 A;  1VQ9 A;  5IE8 A;  1YNN D;  5C6A A;  2EIF A;  2RCF A;  1SNP A;  2XTI A;  1SYG A;  2FHT A;  3H3V I;  3QB3 A;  4DXG A;  4K6L A;  1EIF A;  1JR0 D;  4JOI C;  4JI8 L;  2EOT A;  3TS2 A;  3Q8D A;  4U6R A;  1EQT A;  3TZD A;  2WV6 D;  1IZ6 A;  4CJ1 B;  3A8K E;  4RKL A;  4K8I A;  1CHQ D;  1B3Q A;  2UXD Q;  2KVM A;  3VYS A;  1L0Y B;  1PRT D;  1GUG A;  3LX0 A;  2F6M B;  4BS9 A;  4JBJ A;  2VQF Q;  1YEZ A;  1SND A;  5DM7 3;  3URY A;  1LTI D;  3MEH A;  1OTC A;  1PH3 A;  1KIX A;  4OON A;  1Y1V G;  2ZXP A;  4KY6 A;  1MHW C;  3GTJ B;  4AS3 A;  2R7Z G;  1RF2 D;  4U67 3;  3RLO A;  1ILQ A;  1PTO H;  3ZJY C;  4DAY A;  2PCF B;  2I46 A;  2K5V A;  5ELE A;  3CQZ H;  2XTR A;  3LJ0 A;  3GP7 A;  3D6C A;  4DR4 L;  1SSO A;  2AQ1 B;  1ROD A;  1QCB D;  2L4N A;  3ONA B;  1MD2 D;  4YCV A;  3SGI A;  2EYL A;  5JPN C;  3CC7 A;  1WYD A;  2JBW A;  4JV5 Q;  1XTC D;  3CF5 A;  1M90 C;  4B3T Q;  2V1C C;  3I70 A;  3C3L A;  4NP5 A;  2JA8 H;  1XJV A;  4JCV E;  4DF7 A;  2QZG A;  4FXG C;  1BUV T;  2BA1 A;  4ME5 A;  3GTL H;  3CPW A;  4PMB A;  3DEO A;  4L5T A;  5DM6 3;  2Z1C A;  2KHI A;  1HFN A;  1SBB B;  3W3A A;  4B9X A;  1K0S A;  2XMX A;  1DOK A;  5E4X A;  5GAE C;  3T1H L;  1DM0 B;  2XNA C;  2Y0S E;  2NVT B;  3DWQ A;  4LFB Q;  4KHV A;  3D4R A;  3GTO B;  1X3P A;  3IRB A;  1IBM L;  1IXR A;  2ZTD A;  1PDQ A;  4A3F G;  3S16 H;  3C1E A;  4NKL A;  1S72 A;  4BXX H;  3VR2 A;  2MNA A;  1N8R C;  1GJX A;  4BBR G;  4ODG A;  4FDB A;  4PL5 A;  4XYO A;  5KNB A;  2K5W A;  4A3L G;  3H91 A;  4E6I A;  2XRQ D;  3SK5 A;  5T1I A;  4C56 C;  1FNW A;  2K50 A;  1PFM A;  3O13 A;  3QOJ A;  3NTI A;  2WII B;  1WJJ A;  5FJ8 H;  4DV4 Q;  3QIA A;  3H3V C;  3EJI A;  4DV6 Q;  2UUA Q;  3RN5 A;  3CME A;  1TKW B;  1ZYR D;  4Q9V A;  3NHH A;  4A3B H;  1Q90 A;  4Z7H A;  5LMN W;  1BR9 A;  3KLR A;  4NXN L;  3VDY A;  1XMO L;  1Y1V B;  3I4N H;  3PO3 H;  3T56 B;  4A3I H;  4IUN A;  5I9P A;  2R7Z B;  5IP9 G;  1DOM A;  1B9M A;  5D65 A;  2R7F A;  1U4R A;  1IYJ B;  3W2D A;  1FR3 A;  4JI8 Q;  2NVQ B;  2WB1 E;  4WJW A;  3PIO 3;  1VQF A;  5CGK A;  1SLJ A;  3MZ5 A;  1M1K C;  3NBH B;  2B63 G;  1U0L A;  4QIW B;  2A2C A;  2CQO A;  2Z6B A;  4RA8 A;  1BCP B;  1RHP A;  1J9O A;  4K6D A;  4POF A;  4JPB W;  1A0I A;  4HAE A;  2BH2 A;  3RZO H;  3STB D;  3S1N H;  1BNZ A;  5EPK A;  3GTK B;  4QB4 A;  2HCC A;  3N6R A;  5IYC H;  4JI4 Q;  3MXN B;  3SK8 A;  3TBI B;  1EQQ A;  3GTG H;  2WAQ E;  4JK1 C;  4EQN A;  1CA6 A;  4ME3 A;  1EY6 A;  1KNA A;  2EDG A;  3M85 A;  2BE5 D;  3ND8 A;  4LF6 L;  2QDL A;  1SYF A;  1H9J A;  3H0G B;  2EYJ A;  3SDJ A;  3KJO A;  5JJK A;  1I6V C;  2G9D A;  4BA2 I;  2ZTE A;  4HFV A;  3FHW A;  3GDE A;  2AWN A;  5KYI A;  2F0I A;  4GN4 B;  4PL4 A;  1QG7 A;  2GVB A;  5M5X H;  3M4O H;  1PFS A;  1Q46 A;  4IFD I;  3A5Z B;  4CDD C;  1KRS A;  3SEB A;  5CV8 A;  4A3F B;  1ESR A;  4CDE C;  3IKJ A;  2OTJ A;  2Q8I B;  4PL3 A;  3MHB A;  1EY0 A;  4BBR B;  4BXX G;  1Q82 C;  4DV1 Q;  4DR2 Q;  1Q1B A;  2NB0 A;  2PO4 A;  2OCE A;  3HOY B;  1TS5 A;  3PIP 3;  1EWI A;  3TRZ A;  1HTL D;  4NB3 A;  1BQQ T;  1G29 1;  2B3G A;  3T1H Q;  1FJG L;  3UDF A;  3M3Y H;  1S4Z A;  1Y1W B;  5I6W A;  4DR3 L;  3SK6 A;  2UUB L;  4DV5 L;  1KXL A;  2JA7 H;  4RGN A;  2B2W A;  4A3M H;  1IBM Q;  5COR A;  4H7B A;  4BA1 I;  5IT9 E;  1Q8K A;  3EVQ A;  2ZTC A;  4IO9 A;  3GTQ B;  3FRP B;  4R4I A;  4IUV A;  2KKM A;  4EQO A;  1SRO A;  2EY1 A;  5HGT A;  1VQ6 A;  1E24 A;  3G71 A;  2A68 D;  1IW7 C;  3NTH A;  3DM1 A;  3PO3 G;  4HJ9 A;  1HR0 Q;  1CKN B;  3NEL A;  2NN6 G;  1VQA A;  2I0Q A;  2FJ2 A;  4JW0 A;  1LTG D;  2J0T D;  4YY3 L;  1PTO B;  3T4A C;  1YJW A;  3TME A;  3RN2 A;  4HID A;  4HJA A;  1J8I A;  4DK3 C;  4RGT A;  2OWO A;  2CWA A;  5LL6 X;  4XXE A;  3S24 A;  3HOX G;  3PF4 A;  4K2K A;  4X65 L;  2B63 B;  1HRJ A;  2AMC B;  2YYZ A;  2UXB L;  1H9S A;  1QJO A;  1I4P A;  4APV A;  5L37 A;  1I4H A;  5EBC A;  1EEI D;  1RD9 D;  2E74 C;  2BCO A;  3OSO A;  1B70 B; 
#chains in the Genus database with same CATH homology
 1N33 Q;  1X54 A;  3UDG A;  4DR1 Q;  5IYB H;  1XMO Q;  1L1O C;  3K7U C;  4LWC A;  1VQK A;  3G4S A;  4NXN Q;  1PVO A;  5M5W H;  4GOP B;  4AYB G;  3KDF B;  2UXC Q;  4GKJ L;  3I4O A;  5IYC G;  5JJI A;  4JI6 L;  1N36 L;  4EX5 A;  3L0I A;  3NEM A;  2JA6 H;  4IFD G;  3S17 H;  3BZC A;  1CKN A;  3TS0 A;  2VQE Q;  1VQD A;  3GTJ H;  4POG A;  2IX0 A;  2CKZ B;  1N9W A;  2EQS A;  4TVA B;  3DA3 A;  2MFI A;  2R7D A;  4PG3 A;  1KD1 C;  3WWV A;  4KHP L;  4GNX C;  2HQL A;  1QVG A;  3TQY A;  1A8V A;  2XTQ A;  4LF9 Q;  3HOX H;  4DV4 L;  2ID0 A;  4YWL A;  4LFA Q;  1R9T H;  2K14 A;  3J81 i;  3D0F A;  1GKH A;  3KYH C;  4LUV A;  5LNK 1;  2K5H A;  2BH8 A;  2L15 A;  3EN2 A;  3JAM c;  3S1M H;  3KOJ A;  1MIU A;  4AYB E;  4DV6 L;  2UUA L;  2K75 A;  1EYG A;  4XIG S;  3G48 A;  1XPO A;  4PZ8 A;  4HJ7 A;  2YV5 A;  1WFQ A;  2RF4 A;  1Q1E A;  5IYD G;  1C7Y A;  2JE6 I;  4OWT B;  4O2D A;  3TEH B;  4GOP A;  3HOV G;  3KDF A;  2IY5 B;  3IAM 1;  4IOC A;  4OAU C;  3FKI G;  5H1S E;  1AE2 A;  4HIM A;  1VQN A;  1X3E A;  1P16 A;  4HEA 1;  2C35 B;  4JI1 Q;  1TWG H;  3AYH B;  3PUV A;  4DUY L;  4LF6 Q;  2D0P A;  1IL2 A;  4AIM A;  2D62 A;  1BBW A;  3CCU A;  1WCM G;  4GLX A;  1D8L A;  1QVF A;  1KQS A;  5EAY A;  2HT1 A;  4IFD J;  5C0X J;  1YIJ A;  1GM5 A;  1VQO A;  3T1Y L;  4OX9 Q;  1I6H H;  3I2Z A;  1LUZ A;  4GN3 B;  3F1Z A;  5ELO A;  4DR4 Q;  3M7N A;  1IBL Q;  4IOA A;  4K0K L;  1NY4 A;  2NVT H;  4R4O A;  5GAH C;  1VQ8 A;  4WJ4 A;  5IWA Q;  2F66 B;  5FLM G;  1YO7 A;  3PCO B;  4YHH L;  3K8A A;  1JJ2 A;  1IBK Q;  3RZD H;  3IAS 1;  2LXJ A;  4NPS A;  2JA7 G;  4A3M G;  2UXD L;  4MNO A;  4X62 L;  3CCM A;  1NTG A;  2Z0S A;  3CP0 A;  2JEA I;  5HGI A;  4H02 A;  1VQM A;  4IPH A;  3S1R H;  1AH9 A;  1HNZ L;  5IYD H;  1YJ9 A;  3HOV H;  2D0O A;  4DWL A;  2UU9 L;  3P23 A;  1FL0 A;  4JI4 L;  4DR7 Q;  1K3R A;  3FKI H;  3RLN A;  1NJI C;  2K4K A;  3PSI A;  4Y7N H;  5AJ3 L;  4LF8 L;  4LUZ A;  3HOU G;  4DV2 L;  1N32 Q;  2Z6K A;  3HKZ G;  4DV7 Q;  4L5Q A;  4A76 A;  4A3J H;  4L5S A;  2ATW A;  1K83 H;  4R4T A;  2L1L B;  5E7N A;  4LF5 L;  1WCM H;  1FJG Q;  4GS3 A;  2E5L L;  4LFC L;  4LUO A;  2E2I H;  3ULJ A;  1YIT A;  4B3S Q;  4NV2 A;  2OQK A;  4IJL A;  1I50 H;  4DR3 Q;  2VUM G;  2OQ0 A;  4QL5 A;  2GVA A;  4DV5 Q;  2KHJ A;  4LF7 L;  4A3K H;  4IJH A;  1C0A A;  2JK8 A;  3CC4 A;  4A75 A;  5M3M G;  3OTO L;  1PH7 A;  5FLM H;  3CC2 A;  2KCM A;  2ASB A;  1MJC A;  4GKK L;  3W1G A;  4P71 A;  1GO3 E;  5C4J H;  1P8L A;  4JI7 L;  4JV5 L;  4JYA L;  2B29 A;  3DLL A;  3HKZ E;  4DUZ L;  3CCL A;  1Y1V H;  1PYB A;  3UIT A;  2N3S A;  1PH6 A;  2JJQ A;  4DV1 L;  3W5O A;  4KLK A;  1YHQ A;  1E3P A;  4DR2 L;  3HOU H;  4DV3 L;  4JBK A;  4R4C A;  2F52 A;  4DPG A;  2PQA B;  5C4X G;  3AQQ A;  1KL9 A;  3DA4 A;  4X64 Q;  2GN5 A;  1NMF A;  3AJF A;  1VQC A;  1BBU A;  1U5K A;  1WOC A;  1HZB A;  2DUD A;  4JG2 A;  5IP7 G;  3D31 A;  3PF5 A;  3HOZ H;  3KF8 B;  3AFQ A;  3H15 A;  2YTX A;  2JQO A;  4JI2 Q;  2QA4 A;  4HIO A;  1VQL A;  1SR3 A;  3I7F A;  4NXM Q;  4LF4 L;  3S15 H;  1XMQ Q;  2NVY H;  3OYY A;  3J81 j;  5LMU Q;  5M3M H;  1SRU A;  2XGT A;  4DR5 L;  4X66 L;  3PO2 G;  4LFB L;  1MJE A;  1T9H A;  3ER0 A;  2VL6 A;  1A62 A;  1DGS A;  4AH6 A;  1HNX L;  3FP9 A;  4NV5 A;  3E9I A;  4OO1 I;  3CXC A;  4GKJ Q;  1VQB A;  1YVC A;  3CD6 A;  4JI6 Q;  3CCJ A;  1N36 Q;  3E9H A;  3UE1 A;  1OXT A;  1K8A C;  4Z7G A;  4A3G G;  3I4M G;  3F2B A;  1HR0 L;  5M3F G;  1HZA A;  3PUX A;  3F2D A;  4HJ5 A;  1YZ6 A;  1JJG A;  3S14 H;  4YCU A;  5C0X G;  1PH5 A;  4C2M H;  4I1T A;  2YTV A;  5C4X H;  3JAM i;  2UUC L;  1H95 A;  1X9N A;  1C9O A;  1EIY B;  5IP7 H;  3A74 A;  2JAE A;  1QUQ A;  2IP6 A;  2JB2 A;  4JI5 L;  1HNW L;  4RG1 A;  4O0A A;  1YNX A;  4UPA A;  1G6P A;  1NBW A;  1S40 A;  1W3S A;  2N78 A;  1X3F A;  4C3H H;  4HIK A;  2VY3 A;  1FGU A;  4P72 A;  1Y14 B;  4R4Q A;  3ULL A;  3PO2 H;  2YTY A;  4BY1 H;  2ALY B;  2KEN A;  1UE5 A;  1I94 L;  1N33 L;  1VQG A;  1EUJ A;  2A8V A;  2BA0 A;  1L0W A;  3VA9 A;  1S3O A;  4PZ7 A;  2MO1 A;  4BBS G;  2JB1 A;  1CSQ A;  3KLW A;  1JT8 A;  5FLX c;  1VQ9 A;  5IE8 A;  4A3G H;  1VQP A;  5IY0 A;  3I4M H;  2EIF A;  2XTI A;  2FXQ A;  3BJU A;  5M3F H;  2K5N A;  3H3V I;  1LTL A;  5J3B A;  3M4Q A;  2WAQ G;  2OTL A;  4A3J G;  3CCV A;  3RNU A;  4DAY B;  1EIF A;  3E0E A;  4JOI C;  4AQY L;  4JI8 L;  3TS2 A;  2P22 B;  3Q8D A;  4U6R A;  1B8A A;  1X56 A;  4P73 A;  3F2C A;  3J7A 5;  2ZRR A;  1IZ6 A;  2KBN A;  2ZJP A;  1WI5 A;  4JBM A;  4LF9 L;  2UXD Q;  1TWH H;  5GAD C;  4A3K G;  3F4M A;  1KHI A;  1HR0 W;  2QGQ A;  3M9B A;  4J15 A;  4DK6 C;  1K73 C;  1EOV A;  4PMW A;  1G51 A;  2F6M B;  3DO9 A;  1XPU A;  3CCE A;  4JBJ A;  2MQH A;  2VQF Q;  1CKM A;  2I5L X;  1YEZ A;  2PI2 E;  4B3M Q;  3GTO H;  1YHA A;  1UE7 A;  1HNZ Q;  1L1O B;  4C3I H;  2JA8 G;  4YCW A;  5BR8 L;  2UU9 Q;  4JI3 Q;  3G6E A;  1OTC A;  1PH3 A;  3ICE A;  1B7Y B;  1XNR L;  1YBY A;  4DV2 Q;  2ES2 A;  1A63 A;  2JA9 A;  4MTN A;  3CAM A;  4OON A;  1Y1V G;  1J5E L;  1TWA H;  1KIX A;  4BBS H;  1EQR A;  4JI1 L;  1ASZ A;  4OXP A;  2ZM6 L;  1N34 L;  3UDX A;  4AS3 A;  2R7Z G;  2E5L Q;  1X3G A;  2ZJQ A;  1I5F A;  4LFC Q;  3RLO A;  3ZJY C;  3MEF A;  1HZC A;  3CMA A;  1MKH A;  3UDI A;  2K5V A;  4DV0 L;  1UWV A;  3CQZ H;  2XTR A;  3LJ0 A;  2A19 A;  4GNX B;  4ALP A;  4OX9 L;  1SN8 A;  2IHF A;  1LYL A;  3HOZ G;  3NEN A;  2E8G A;  4DR4 L;  2H5X A;  2IT1 A;  2RCN A;  3OTO Q;  4HJ8 A;  1K9M C;  1XNQ Q;  2UUB Q;  4OWX B;  3F8T A;  4GKK Q;  4YCV A;  3SGI A;  1KRT A;  3CCR A;  3CC7 A;  1V43 A;  3AEV A;  1WYD A;  2Y0S G;  2K52 A;  3BU2 A;  3EIV A;  4JI7 Q;  4JV5 Q;  5C44 H;  1Q86 C;  1KC8 C;  3CF5 A;  1L1O A;  1M90 C;  2F4V L;  4DR6 L;  3A5U A;  2V1C C;  4B3T Q;  2JA8 H;  4C3J H;  1XJV A;  3S2D H;  4JCV E;  1JMC A;  1HH2 P;  4GOP C;  2LXK A;  4YZC A;  3J80 c;  4A93 G;  4DNI A;  4DV3 Q;  2BA1 A;  4KHZ A;  4TQU S;  2N49 A;  3GTL H;  2VW9 A;  3CPW A;  4L5T A;  4DV7 L;  1SMX A;  2Q2U A;  1VQJ A;  2R6G A;  3L0O A;  4PZ6 A;  4YY3 Q;  1VCI A;  2R7Z H;  4YWK A;  1OXU A;  5GQO A;  2CAZ B;  2KHI A;  4GNX A;  5LMN L;  4A4I A;  2FUG 1;  4LF4 Q;  4QIW E;  5FJ8 G;  3B6Y A;  1Q81 C;  2LSS A;  2XMX A;  1LM0 A;  4X65 Q;  2NVQ H;  5JJL A;  5GAE C;  3T1H L;  2F3I A;  3HOY G;  2Y0S E;  3LGJ A;  1I3Q H;  3HFZ B;  4LFB Q;  2UXB Q;  2HHH L;  4JI0 Q;  3PUY A;  2NZO A;  2IHE A;  1HNX Q;  4G75 A;  2VZA A;  2MJF B;  4YZD A;  2I5H A;  4A3E G;  2AHO B;  2DGY A;  3KP9 A;  3IRB A;  3OW2 A;  1IBM L;  4A3B G;  1IXR A;  2ZTD A;  2CFM A;  4LW1 A;  4BY1 G;  3RLF A;  4O1P A;  2V6E A;  2YU9 H;  5GAG C;  4A3F G;  2NVX H;  3I4N G;  3S16 H;  4O1O A;  4B3R L;  3GTP H;  2YFB A;  1W2B A;  4A3I G;  1S72 A;  3GTK H;  1PHJ A;  4BXX H;  2MNA A;  1N8R C;  2CCZ A;  4Y52 H;  1E1T A;  4BBR G;  4XTC S;  1JB7 A;  4A93 H;  1O7I A;  4FDB A;  4BY7 H;  4PL5 A;  3U4Z A;  2Z6K C;  4YZ9 A;  1JE5 A;  3EBE A;  5IT9 c;  3PIO A;  4A3L G;  1PH4 A;  1UEB A;  2A1A A;  2Q2I A;  4A3C G;  4AS2 A;  3HOW G;  2AWO A;  2PQA A;  1PH2 A;  1J6Q A;  1BVS A;  2R93 G;  4KHP Q;  2K50 A;  4GLA C;  2IX1 A;  4OAV B;  2CWP A;  1PA6 A;  1WJJ A;  5FJ8 H;  4DV4 Q;  4L5R C;  4NXM L;  2RHQ B;  2K19 A;  3H0G H;  3ERS X;  3HKS A;  3RR5 A;  2WB1 G;  2MO0 A;  4GN5 A;  4UP7 A;  5C3E G;  4G76 A;  3H3V H;  2EXD A;  2PNH A;  3U58 A;  5ELN A;  1I94 Q;  4DV6 Q;  2UUA Q;  3RN5 A;  3CME A;  3ULP A;  4QQB X;  1RIP A;  4A3E H;  4Q9V A;  1K0R A;  4A3B H;  4Z7H A;  5LMN W;  5HGQ A;  2PI2 A;  1K8G A;  2YFA A;  4NXN L;  4DR1 L;  3VDY A;  4A3F H;  3CCQ A;  1XMO L;  3I4N H;  3PO3 H;  4A3I H;  1PH1 A;  4OWW B;  2UXC L;  4BBR H;  1OXX K;  1V9P A;  3W1B A;  5IP9 G;  1QZH A;  4DUY Q;  1QVC A;  2R7F A;  1PV4 A;  2HIV A;  1IYJ B;  4R1J A;  4AQY Q;  1GVP A;  1PH9 A;  4JI8 Q;  3I56 A;  2VQE L;  3HOY H;  4A3L H;  4A3C H;  4IPD A;  3HOW H;  2WB1 E;  3A0J A;  4UP8 A;  1SE8 A;  3I9V 1;  3I55 A;  2VNU D;  3T1Y Q;  2R93 H;  4WJ3 M;  1VQF A;  1SLJ A;  1QZG A;  4K0K Q;  1M1K C;  3NBH B;  2B63 G;  1U0L A;  2A2C A;  2CQO A;  2WFW A;  4YHH Q;  1Y1W H;  4LFA L;  1SFO H;  3K80 C;  2BH2 A;  4POF A;  3RZO H;  1A0I A;  3GD7 A;  4X62 Q;  5C3E H;  2NN6 I;  1NMG A;  5DLQ E;  3STB D;  1XTD A;  4P75 A;  5BR8 Q;  2Q2T A;  2KCT A;  3K7A H;  3S1N H;  3J7Z C;  1VQH A;  5C44 G;  2HIX A;  1XNR Q;  1EFW A;  3J81 c;  3CPF A;  3GTQ H;  1J5E Q;  5IYC H;  2R92 G;  1CUK A;  3UE0 A;  3PIP A;  2VS1 A;  1E22 A;  3LJ2 A;  3MXN B;  2ZM6 Q;  1N34 Q;  4JI4 Q;  2Q2H A;  5AJ3 Q;  2RHS B;  3K81 C;  4KI0 A;  4LF8 Q;  1RL2 A;  4A3D G;  1EQQ A;  3GTG H;  1Q7Y C;  1E7Z A;  2WAQ E;  1YHB A;  2E2J H;  5IP9 H;  4ME3 A;  5JEA G;  3M85 A;  3U50 C;  2ZJR A;  4DV0 Q;  4LF5 Q;  4LF6 L;  4X6A H;  3DM3 A;  1X6O A;  1VQ5 A;  1E1O A;  1VQ7 A;  1GD7 A;  4OO1 G;  1UE6 A;  1UE1 A;  3KF6 B;  3SDJ A;  3K0X A;  3KJO A;  1PH8 A;  2E2H H;  5JJK A;  4LF7 Q;  4BA2 I;  3BZK A;  2ZTE A;  4HFV A;  1Z47 A;  3FHW A;  2AWN A;  3GDE A;  1ASY A;  1PYS B;  1OXV A;  4GN4 B;  4GXT A;  4PL4 A;  1VQI A;  2GVB A;  5M5X H;  1PFS A;  1Q46 A;  1IBL L;  3M4O H;  4IFD I;  5GRO A;  3J80 i;  5IWA L;  5C0X I;  1JJC B;  3CCS A;  1IBK L;  2F4V Q;  4DR6 Q;  2VQF L;  4B3M L;  3A5Z B;  1SJ8 A;  1KRS A;  4QY7 A;  3S2H H;  4JI3 L;  3PV0 A;  2OTJ A;  4JBW A;  2QEX A;  4JYA Q;  3PUW A;  4PL3 A;  4DUZ Q;  4QJF A;  1NE3 A;  2R92 H;  4EQ5 A;  4BXX G;  1Q82 C;  4DV1 Q;  4DR2 Q;  4DR7 L;  1Q1B A;  4A3D H;  2OCE A;  4BY7 G;  1N32 L;  4RMF A;  2JA5 G;  1TXY A;  3JSB A;  1EWI A;  3TRZ A;  1Z9F A;  5LMN Q;  1VS0 A;  4GLV B;  4NB3 A;  1G29 1;  2B3G A;  3JC6 6;  1V1Q A;  1YI2 A;  3KF6 A;  3T1H Q;  4UY8 C;  1FJG L;  3UDF A;  1BKB A;  3M3Y H;  5JEA J;  1XNQ L;  4B3S L;  4UP9 A;  1TWC H;  2HHH Q;  4DR3 L;  2UUB L;  1KXL A;  2RIO A;  3FBV A;  4DV5 L;  3H0G G;  2JA7 H;  4MZ9 A;  1HJP A;  3U4V A;  4A3M H;  1VQE A;  1IBM Q;  2NZH A;  4IPG A;  4BA1 I;  4DR5 Q;  4X66 Q;  3KFU A;  1Q8K A;  2ZTC A;  4IO9 A;  4YWM A;  3STB C;  5IYB G;  4B3R Q;  1X65 A;  4R4I A;  3PUZ A;  4JC0 A;  4B3T L;  5HY6 A;  2KKM A;  1L2F A;  2B63 H;  1SRO A;  3GTM H;  1VQ6 A;  1E24 A;  3G71 A;  4IPC A;  2N8N A;  2JA6 G;  3PO3 G;  1KAW A;  4HJ9 A;  3LJ1 A;  1AE3 A;  3PGZ A;  1HR0 Q;  1CKN B;  2AKW B;  2NN6 G;  1VQA A;  3NEL A;  2I0Q A;  1X55 A;  2I5M X;  3GO5 A;  3L7Z C;  4P74 A;  2JB3 A;  1VQ4 A;  4YY3 L;  1D7Q A;  3CW2 C;  2JA5 H;  1YJW A;  1FVI A;  4JOI A;  1CSP A;  1TWF H;  3M4P A;  5M5Y H;  1HZ9 A;  3AFP A;  4HID A;  4HJA A;  1OXS C;  3RN2 A;  4DK3 C;  2UUC Q;  1QUQ B;  2VUM H;  4X64 L;  2OWO A;  2CWA A;  3HOX G;  1XPR A;  3S24 A;  3PF4 A;  5K36 G;  4LNQ A;  4X65 L;  4JI5 Q;  1HNW Q;  1CKO A;  2AMC B;  4DKA C;  2JEB I;  4QGU A;  2YYZ A;  4JI2 L;  2UXB L;  2A2D A;  3L2P A;  1YJN A;  4JI0 L;  2PMZ E;  3TRE A;  4APV A;  4DAM A;  1Y1W G;  1XMQ L;  3KJP A;  3S1Q H;  2WP8 J;  5LMU L;  1Q12 A;  1B70 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...