2E8GA

The structure of protein from p. horikoshii at 1.7 angstrom resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
MWDTSKDYRLLVAEKSVELFIRTIEGAKFRGQWDKKRSIQLAKEMIPDIQALRYSYIDPEELVDTPQMKDLKEKAKGIIEALGGEDWHHKFLSQASREDREKVEEQVARIKFFLNTILNLDRRLKLGKINDPVIAVDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVTNDLTVKEGNRVAVALLPPRNFFGIVSEGMFLGAGEGVLKNVKGEIGGLPKGIPLEALNETRNAVEAFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of protein PH0536 from Pyrococcus horikoshii at 1.7 A resolution reveals a novel assembly of an oligonucleotide/oligosaccharide-binding fold and an alpha-helical bundle
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
molecule keywords Hypothetical protein PH0536
total genus 81
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF18489 Alpha_Helical Alpha helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.150 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2e8gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e8gA02
4K0KQ 4JI0Q 1ASYA 4KHZA 4KI0A 2ATWA 2GN5A 3PIPA 4A3KH 4DR2L 4KLKA 2AMCB 2B3GA 1N34L 4X62Q 3HOZG 1PYSB 2D0OA 4LUOA 1KRTA 2E2HH 1IL2A 3HOYH 2UUCL 5M5YH 4QL5A 3L7ZC 1YVCA 1VQFA 1VCIA 2MNAA 2JQOA 4A3JG 2Q2TA 1HJPA 1QUQA 3BU2A 1VQJA 3GDEA 2H5XA 4H02A 5IY0A 5C3EH 3J80c 3RN2A 4BA2I 3GTPH 2AHOB 1UE7A 1CSQA 2KCTA 1CKMA 3EBEA 4DAYB 3S15H 4AQYL 4GLXA 2KENA 4DNIA 2ID0A 2HT1A 3CC4A 1QUQB 1TXYA 2JEBI 4LWCA 4TVAB 2JA8H 2K75A 1L2FA 1YBYA 4MTNA 3S1RH 4DR6Q 4HJ8A 4DUYQ 4RG1A 1K8GA 3I4OA 4POFA 1PH7A 4WJ4A 4YWMA 4Y7NH 4DV7L 4RMFA 2CCZA 1KRSA 1YZ6A 1TWGH 1HZ9A 5IE8A 3JAMi 4C3HH 4PG3A 1MIUA 1V9PA 4DV6Q 3T1HQ 1VQKA 3PUVA 4BY7H 5JJLA 3ER0A 2I5LX 4HIMA 1Q86C 1FJGL 1RL2A 4YHHL 3PO3G 3U4VA 5FLMH 3CPWA 1PH2A 1KIXA 3CF5A 3I4MG 2FXQA 3HOXG 4A75A 4AQYQ 2NZHA 3CD6A 4LF7L 3M7NA 3RNUA 1Y1WG 1HNWQ 1J5EL 4JYAQ 1NBWA 4GLAC 2Z6KC 2VQFL 2HIVA 4A3MH 2CWPA 1VQ5A 2R92G 3S17H 4A3FH 1K73C 5M3FG 4DUYL 4AYBG 1PH8A 2JA6G 5K36G 4R1JA 3PO2G 1XMQL 1MKHA 4JCVE 4EX5A 4A3JH 3K0XA 2RF4A 2D62A 3K80C 3TQYA 2E2IH 3K8AA 4P74A 1XNRL 2B63G 4X6AH 1XJVA 3JC66 5LMUQ 4JI1Q 3HOWG 4OO1I 2JA7H 4QY7A 3HOVH 1V43A 4OO1G 1A62A 3H3VH 3PUWA 3KJOA 2NVXH 4DR4Q 5GAHC 3B6YA 2K5NA 2B29A 3KF6B 1EFWA 3S1MH 4A3EG 5C4JH 2HHHL 1WFQA 1VQIA 4B3RL 1NJIC 1EOVA 5IP7H 1JE5A 1K8AC 3DLLA 4PZ7A 1YI2A 3H0GH 4LF4L 3PUXA 1XNQQ 3A0JA 3PSIA 1VQ8A 5GADC 1VQOA 4BBRG 4JI5Q 2YV5A 5IWAQ 1TWCH 1YHBA 1OTCA 5FJ8G 3CCUA 1AH9A 1YJNA 3H15A 1VQMA 2C35B 5GROA 1M90C 2NVQH 2CQOA 4NB3A 4JV5L 1D8LA 4JC0A 1CUKA 3PGZA 1N8RC 1IBML 1N33L 1AE2A 2KHIA 1YEZA 4LF9L 3FHWA 1VQ4A 2UUAL 4DV3Q 4LFCL 2HIXA 4BY7G 1PH6A 1J6QA 1EUJA 4IPHA 4X64Q 2VZAA 4DV4Q 1YJ9A 1XNQL 2IX0A 4O2DA 1WYDA 3HOUH 3ULJA 1YITA 4IO9A 1S72A 4KHPQ 1RIPA 4B3MQ 1L1OA 1E22A 5J3BA 1Z9FA 3TREA 1EWIA 1JB7A 2WFWA 3CCMA 3L0OA 1X3FA 3STBC 5IP9G 3AYHB 2BA0A 1A0IA 1EQQA 4WJ3M 3EN2A 1JJGA 4DV3L 3TS2A 1FGUA 5E7NA 5LMNQ 2AKWB 2DGYA 3HKSA 1S40A 2CWAA 5M3MH 4IFDJ 3BJUA 2E5LL 1CKNA 2EXDA 2JA7G 1XMOQ 1N36L 2VNUD 2KBNA 1XPOA 1VQGA 4JBMA 3J81j 4R4QA 1GVPA 3H3VI 2N49A 1EQRA 4OWXB 5GAGC 1FL0A 1Q1EA 3HKZE 1SFOH 2VUMG 2UUCQ 1LYLA 1W2BA 2EIFA 4QJFA 4QQBX 1KC8C 1HNWL 5IYBG 1IBKQ 1QVFA 2JEAI 4OONA 4A3DG 3F1ZA 1PVOA 2ZJQA 2R7ZG 2F52A 3AEVA 1S3OA 1P8LA 1G291 4DUZQ 4DR1Q 1TWAH 1VQ7A 1U0LA 2AWOA 4DK6C 1Y1WH 3I4MH 4HJAA 4BA1I 2R7DA 4HIDA 4A93H 2V1CC 1N33Q 1YNXA 1MJCA 4DV7Q 1HNXL 3GTMH 3ULPA 5FLMG 4L5TA 4YCUA 2K52A 4JI8Q 3L2PA 4B3ML 4JI0L 4J15A 4GS3A 1VQHA 5ELOA 5M5WH 1KAWA 2JA5G 1H95A 1AE3A 5EAYA 4ME3A 5IYDH 1BKBA 3G6EA 4A3GH 4DPGA 3KJPA 1VQ9A 2NZOA 3FP9A 2OCEA 2R93G 1N34Q 3CMEA 2CKZB 1L0WA 4B3SL 3M3YH 1WCMH 5IYBH 1VQDA 4IJHA 4HIOA 2VY3A 4YWKA 3KF8B 3U4ZA 5IWAL 2ZM6Q 2ZTDA 2XGTA 2UU9L 4DR5Q 3GTKH 1Q81C 3NBHB 4PZ8A 3TS0A 1IBLL 3J7ZC 1QVCA 2LXKA 5HY6A 4X65Q 3HFZB 5C3EG 1VQCA 4R4IA 2MQHA 1XPRA 2E5LQ 1IBMQ 3CC2A 3M4OH 2N3SA 4BY1G 3RLOA 1N9WA 2Y0SE 1L1OB 2OQKA 4GKKQ 4LFAQ 4DV0L 1LM0A 4JI2Q 3GTGH 3W1GA 2NVTH 1UWVA 4QGUA 1QZGA 3S2HH 1A63A 2JJQA 4X64L 4DR4L 1NMFA 1X54A 4JBJA 4BY1H 1OXUA 1WJJA 3D31A 1ASZA 4B3SQ 1E1TA 1IZ6A 4YY3Q 1VS0A 4B3RQ 3CCVA 3I2ZA 1QZHA 4DR2Q 4JI4Q 4JBKA 3E0EA 2Y0SG 2PMZE 2R93H 4UY8C 4GNXA 1KD1C 1U5KA 1IBLQ 4GN5A 4A3CG 1UE1A 4DUZL 4DR1L 3CW2C 2R92H 4JI6Q 4JI5L 1WI5A 3T1HL 1KL9A 1Y1VH 2JA9A 4YCWA 4LF4Q 3PO3H 1C9OA 2YYZA 4LF6L 4JI4L 4JV5Q 4P72A 5IYDG 4DR3L 1G51A 4JOIC 1T9HA 5LMNW 5JEAJ 3MEFA 4A76A 5C0XG 3UE1A 2MO0A 4DK3C 5C0XI 1X55A 4DV5Q 4OX9L 1UE6A 1GM5A 4L5SA 4AYBE 3ICEA 1UE5A 2I5HA 5IT9c 3GTOH 4HJ7A 2K50A 5GAEC 3DM3A 4DR3Q 3SGIA 4A4IA 2UXBL 2KHJA 4JI1L 3CCEA 1JJCB 1BBWA 3AQQA 2OQ0A 4IPCA 4X65L 4A3CH 4IJLA 1XNRQ 1BBUA 5IP7G 4LFBL 4JOIA 3J81i 4K0KL 1B70B 4GOPB 3PF5A 4XTCS 4HJ9A 4X66Q 2VQEL 4DV0Q 4LFAL 2WB1G 1TWHH 1HR0L 4IFDI 4R4OA 2Q2UA 5C4XH 3A74A 2MFIA 5IYCG 4BXXG 4IFDG 4R4CA 3HOVG 1X9NA 2A1AA 2F3IA 2BH2A 3HOZH 1GKHA 4GKJQ 4IOAA 3K7AH 3F2DA 3S14H 1HZBA 3KDFB 5H1SE 4B3TQ 3HOWH 5C44H 1SR3A 2XTIA 2VQFQ 2E2JH 2KCMA 1SE8A 4A3FG 4LNQA 4GN3B 4NXNL 4O0AA 4UP9A 4NXMQ 2JE6I 1KXLA 1Q82C 5FLXc 4AH6A 3KF6A 1LTLA 1X3GA 2YTYA 1X6OA 3KYHC 2UU9Q 5JJKA 2I5MX 4QIWE 1VQPA 1N32L 4C2MH 4A3GG 3PF4A 3OTOQ 1IBKL 4DR7L 1E7ZA 2IHEA 2PQAB 1I94Q 2UUBQ 3AFQA 4HJ5A 3PUYA 3TRZA 1PHJA 3GD7A 3I55A 3OYYA 4OX9Q 5GQOA 5HGQA 2AWNA 5JEAG 4YHHQ 4JI2L 2K14A 3CCJA 4BBRH 4NXNQ 1IXRA 2VL6A 4A93G 1C0AA 2PQAA 1EIYB 1VQ6A 2PI2E 3H0GG 1EYGA 1V1QA 4DKAC 1CKOA 1SMXA 4JI3Q 5LMNL 2RHQB 3CMAA 1I50H 1X3EA 4DV2L 4JI6L 2IHFA 4LFCQ 4R4TA 3FKIH 1YHQA 2ES2A 4UPAA 1HZAA 3K7UC 3RLNA 4IPDA 4OXPA 4XIGS 1PH5A 1I94L 4LF9Q 3S1QH 1WOCA 2K5VA 3HKZG 1OXTA 5IYCH 2IT1A 2Z6KA 4BXXH 1PFSA 2QGQA 3T1YL 4P71A 2VS1A 1GD7A 4A3KG 3CP0A 2ZM6L 4B3TL 4DV5L 1JT8A 3ERSX 3BZKA 2HQLA 3CPFA 2BH8A 5M3FH 2UXBQ 2LSSA 2IX1A 4YY3L 5ELNA 3UDXA 2HHHQ 2K4KA 4A3MG 4A3IH 2ZTEA 3F2CA 4LF8Q 1WCMG 2OTJA 2UXDL 3T1YQ 2R6GA 2ASBA 4LFBQ 2R7FA 3MXNB 4IOCA 3CCSA 1EIFA 1I3QH 4LF6Q 2YTXA 3E9IA 4BBSG 5JJIA 3I4NG 1OXSC 4JG2A 3RR5A 3PCOB 4A3LH 2A19A 4IPGA 1XMQQ 2BA1A 2PI2A 5C0XJ 2K5HA 1PV4A 1B7YB 3CQZH 3G48A 4GKKL 2F4VQ 1R9TH 2YTVA 3K81C 2CFMA 3GO5A 3S2DH 3KLWA 4TQUS 3F2BA 1VQLA 5AJ3L 3M4QA 2N78A 4UP7A 3KDFA 4GOPA 3OW2A 1NMGA 2WAQG 2L15A 4A3IG 1VQNA 1QVGA 2EQSA 1B8AA 1FJGQ 3A5UA 1D7QA 3RZDH 3NELA 2ZJPA 4X62L 5C44G 2N8NA 1YIJA 2VUMH 4PMWA 3PV0A 1OXVA 2F4VL 3I7FA 3W1BA 2ZTCA 2ALYB 3F8TA 4C3JH 4OWWB 3KFUA 1Q12A 1YHAA 2DUDA 2WAQE 1LUZA 1YJWA 1K3RA 4JBWA 5M3MG 5BR8L 3CAMA 1HR0W 4Y52H 3Q8DA 5IP9H 2B63H 3FKIG 4LW1A 4YWLA 3PO2H 1Q1BA 3JAMc 2GVAA 3ZJYC 1K9MC 3E9HA 3M4PA 4DV4L 4JI7Q 2UXDQ 1PYBA 4DR6L 3HOXH 1Z47A 3RLFA 3GTQH 4NXML 1UEBA 1CKNB 4LUZA 3J7A5 1JMCA 3HOUG 4MZ9A 1JJ2A 3G71A 3CCRA 1SN8A 3PIOA 2RHSB 1VQAA 4OWTB 3UDFA 5M5XH 4BBSH 3I56A 2VQEQ 5DLQE 4C3IH 1DGSA 4A3LG 1W3SA 1E3PA 4L5QA 4LUVA 1BVSA 3M85A 2WB1E 4GLVB 4JI7L 5AJ3Q 1K83H 4YCVA 2I0QA 4DV1Q 1M1KC 4LF5L 1K0RA 1J5EQ 4JYAL 4DR7Q 3AFPA 3J81c 3BZCA 4A3BH 3NEMA 4DAMA 1Q46A 2JA8G 3PUZA 3S16H 4A3DH 4ALPA 2NVYH 3RN5A 3KOJA 1IYJB 1Q8KA 1VQBA 3CC7A 4HIKA 2R7ZH 4DV2Q 1PA6A 1I6HH 4A3EH 2UUAQ 1Y14B 4FDBA 4UP8A 1P16A 4JI3L 4DV6L 2OTLA 1OXXK 4MNOA 1A8VA 3HOYG 3NENA 2UXCQ 2D0PA 2Q2IA 3GTJH 4AIMA 4GN4B 2ZJRA 3S1NH 2A8VA 1X65A 2RCNA 3RZOH 3D0FA 2IY5B 2OWOA 2JK8A 4APVA 1XPUA 1NE3A 1TWFH 3CXCA 3S24A 4GNXB 5C4XG 1NY4A 4P75A 4EQ5A 2UUBL 1XTDA 4POGA 1GO3E 3EIVA 2UXCL 1L1OC 1HZCA 1I5FA 3UE0A 3WWVA 3IRBA 3OTOL 4A3BG 2GVBA 1HR0Q 1HH2P 2QEXA 3TEHB 1KQSA 4L5RC 4PZ6A 2JA6H 1N32Q 1HNZL 1CSPA 1FVIA 1SRUA 2LXJA 1SROA 3UDIA 1C7YA 1Q7YC 4GOPC 1E24A 3W5OA 4GKJL 1XMOL 1O7IA 1VQEA 1KHIA 1N36Q 1PH1A 2JA5H 1E1OA 1NTGA 5LMUL 2Q2HA 2YU9H 2MO1A 3UDGA 1PH3A 3I4NH 3U50C 2Z0SA 4DV1L 3ULLA 2PNHA 4LF5Q 4KHPL 1SLJA 4DR5L 4LF8L 3J80i 1Y1VG 1HNZQ 3CCQA 3A5ZB 3G4SA 2WP8J 4JI8L 1MJEA 1PH4A 1X56A 3LGJA 2E8GA 3GTLH 1HNXQ 2VW9A 1G6PA 3U58A 4LF7Q 5FJ8H 3VDYA 5BR8Q 4GNXC 3CCLA 3M9BA 4P73A 1PH9A 4X66L 2NN6G 3STBD 4NPSA 2QA4A 2NN6I
chains in the Genus database with same CATH superfamily
1SE2A 2HDMA 4J8QA 1ASYA 2HD3A 1DOMA 1LTTD 4KI0A 5IGFA 4KLKA 2K01A 3HOZG 4LUOA 1KRTA 1IL2A 2UUCL 5M5YH 1EYAA 1YVCA 3TP8A 3CKIB 3F2UA 1JB3A 3S14B 5ELDA 2Q2TA 3VYTA 1QUQA 1B3QA 3GDEA 5IY0A 2JN4A 2PNRC 3RN2A 3I4MB 2AHOB 1UE7A 4AQYL 1BQQT 1A2UA 2NUCA 1TXYA 4BY1B 1R4QB 4KK7A 4RG1A 4WJ4A 3I4OA 4YWMA 2CCZA 1KRSA 3N6RA 5IE8A 1HZ9A 5LL6X 3SDZA 4PV1C 1R9TB 4PG3A 3R8BA 3VYUA 4K8JA 3ER0A 2I5LX 3DHQA 3ZYYX 4MN3A 1PH2A 1CK1A 5F2DA 3GTQB 1FYCA 3HOXG 3K5MA 1GUGA 1STHA 2NBFA 4PMBA 4AQYQ 5FO8B 4LF7L 3RNUA 1Y1WG 3RZDB 4GLAC 2K03A 2VQFL 3A7AB 4C3IB 3S17H 4A3FH 1K73C 1PH8A 3GTGB 2J7ZA 1MKHA 3CRKC 3FKIB 2RF4A 3S1QB 1EYDA 4DAYA 3HOWG 2A6EC 3HOVH 4OO1G 3BDOA 2F0FA 3KJOA 4DXGA 2IP6A 4IUPA 2NVXH 5GAHC 3B6YA 1W6KA 3J7YW 1AW7A 3S1MH 1IKMA 4WJWA 5BN4A 5M3FB 1EWHA 1FNVA 4PZ7A 4LF4L 3H0GH 2L9HA 1XNQQ 5DEHA 4OELB 1TWCH 1C8CA 4KKUA 2XWBB 4ZRZA 2QKIC 5GROA 2HQEA 2NVQH 2CQOA 4IZ8A 2CH4W 2KHIA 2UUAL 4DV3Q 2HIXA 1J6QA 1SNOA 1PMRA 1FR3A 3HEJA 2F0EA 4O2DA 3HOUH 4IO9A 1S72A 4XDXA 1L1OA 1E22A 5J1ZA 1Z9FA 2K33A 4MIUA 1AN8A 3CCMA 4XYOA 1SE4A 1H9KA 5IP9G 1A0IA 1O78A 1STBA 3TS2A 1V1PB 5LMNQ 1S40A 2QILA 2VUMB 4YZ9A 2QDLA 3BJUA 2I46A 2E5LL 5JPMC 1MHWC 1XMOQ 1N36L 1DM0B 1XPOA 5C6AA 3J81j 1IYUA 2DJFC 4R4QA 2KECA 3PIO3 3K59A 1SFOH 3MXUA 1W2BA 1DYQA 1X32A 2EIFA 4QJFA 2EZVA 1IBKQ 4YIJA 2R7ZG 1YNJC 2V6EA 2TMPA 1G291 1VQ7A 2FU2A 2K32A 4A93H 1BO0A 3GQBA 1MJCA 2BOSA 4B3ML 4JI0L 4J15A 4FO2A 5ELOA 1H95A 1KAWA 1ICWA 5IYDH 3DEOA 3NTKA 3E5SA 2K5DA 2ZW3A 4OIKA 3LJ2A 4A3GH 4DPGA 1NCVA 1I3QB 4RH6A 2NZOA 3OW7A 2R93G 3CMEA 2CKZB 1L0WA 2FUG1 3MXNA 2KKMA 1VQDA 4KY6A 1X3PA 5IWAL 2EJMA 2XGTA 4PZ8A 4QUFA 1QVCA 4C3JG 4X65Q 1XPRA 4XT3B 3SK4A 3LWUA 2OQKA 4GKKQ 1QB5D 2XTRA 2F66B 2Z1CA 3OPOA 3GTGH 2SEBD 4AS3A 3S1NB 1MD2D 4DR4L 4BY1H 1OXUA 4LMQD 1CQFA 1YNND 2A2CA 4B3RQ 1BCPD 4JI4Q 4JBKA 5JAVA 2JA6B 1Y69U 4GN5A 3BS1A 4A3CG 4DR1L 4DU9A 4JI5L 1JR0D 2EXZA 1NSNS 3PO3H 2NB0A 2YYZA 3CQZB 4LF6L 5CV8A 1CHQD 4JV5Q 4P72A 2OXPA 2RDFA 3NPPA 3KLSX 1JOOA 1T9HA 5JEAJ 4AS2A 2ENBA 2MO0A 5C0XI 1X55A 1GM5A 3ICEA 1UE5A 5IT9c 5GAEC 4DR3Q 2KHJA 4RHSA 3DXJC 4JI1L 3AQQA 1XNRQ 3SDJA 5IP7G 4KJNA 5I6YA 4HJ9A 4MHEA 5KEEA 4A3KB 3S1MB 2E74C 1HR0L 1RDPD 3A74A 4ZYSA 4R4CA 1NR4A 3K7AH 3KDFB 3T51B 5IIFA 5C44H 2ZT9C 2XTIA 2E2JH 4PL3A 2B8FA 1SEBD 3GTPB 4JPBW 1K28A 1SBBB 1KXLA 5FLXc 3K5LA 3FEWX 1U4RA 1TWFB 5JJKA 2Z9HA 3S1RB 1VQPA 2RLDA 3PO3B 1B3AA 4A3GG 3OTOQ 4C3HB 1S5CD 3PUYA 1PLFA 1JWSD 4XYQA 2EYJA 5M9OA 1F2LA 4YHHQ 4Z7HA 2MPMA 4CKCA 4DKAC 1HRJA 4WFN3 3VR5A 2RHQB 4DV2L 4JI6L 3DA4A 2KJXA 4R4TA 1YHQA 1SMYC 3RLNA 3K7UC 1PFBA 1M8AA 4ZKBB 1YO7A 2EYFA 1A3UA 4IFDH 2HGKA 3GP7A 1WVLA 1GD7A 3QOLA 1JT8A 3BZKA 3CPFA 2BH8A 3NP8A 2M9VA 5ELNA 5KNCA 1HUMA 1HA5A 1AEXA 3I4NB 2IWHA 3T1YQ 2ASBA 5I9OA 4AYBB 4IOCA 1EIFA 1S5ED 2YTXA 3P20A 1XXGA 4U68A 1Y8NB 1RTNA 2QF7A 3I4NG 4BBSG 2KEDA 1KNAA 1STGA 4JG2A 3RR5A 4A3LH 1DONA 1GUOA 3M3YB 2PCFB 3KP9A 2BA1A 2RSOA 5E4XA 4P2CB 3G48A 3V05A 2YTVA 3GO5A 3S2DH 2MP1A 2F0OA 1KLUD 2E2HB 2N78A 4HSPA 2RKSA 3C1FA 1NMGA 2WAQG 2F0HA 1ILQA 1A6XA 2G9HD 3IKJA 3BDCA 5CYUA 3D4DA 2ZJPA 5C44G 1BOSA 2EJGC 3PV0A 2F4VL 2L5TA 4RFBA 1XWEA 5FK9C 2PQEA 2ALYB 4V190 3RZOB 3KFUA 2DUDA 2WAQE 1YJWA 1K3RA 5M3MG 1F9SA 4N9TA 3CAMA 5C4XB 4F87A 3ITPA 5EJWA 3ZJYC 4JI7Q 3E9HA 2UXDQ 1Y8PB 2BL7A 3E3XA 1HXYD 4DNRB 1PZKD 3C1EA 2Q8IB 4CJ0B 1LO5D 3J7A5 1JMCA 3MVVA 2JXMB 2ETDA 2CVRA 4ME5A 4OWTB 4DNTB 1ET9A 3K58A 1W3SA 1E3PA 4JI7L 2I0QA 4LAAA 4LF5L 1KDCA 1K0RA 1J5EQ 2F3VA 3EVQA 2FFKB 4A3DH 3PUZA 3BG3A 3KOJA 1IYJB 1VQBA 4HIKA 1PA6A 5CV5A 1WTRA 4RHRA 3EROA 4JI3L 3EFXD 5KGUA 1A8VA 3AU7A 2F0PA 2F0IA 3GTJH 2A69C 1VDZA 4OL7A 4AIMA 4GN4B 2ZJRA 2A8VA 1X65A 2NVTB 2OWOA 4Z7GA 2RIOA 1NE3A 1SYGA 4FXKC 2UUBL 2B63B 3FVQA 3EIVA 3WWVA 4A3BG 2QEXA 3HRZC 1KQSA 5L37A 4R9WA 1CSPA 1FVIA 2A74C 3A7LA 1C7YA 4GOPC 3W5OA 1XMOL 1CT1D 1N36Q 1Y1VB 1RKNA 2PZUA 1RTOA 3HZXA 5LMUL 1PH3A 1M4VA 1BF4A 1Z7TA 2B2YA 3ERQA 3IAM1 1DXMA 3H94A 1PTOF 4K2LA 3A5ZB 4K5VA 1X56A 2F0GA 4XQNA 1HNXQ 2B2WA 1SJ8A 1Z6HA 2XMXA 5LL6S 5C3WA 5D14A 2FINB 4P73A 4ZQ3A 4X66L 2NN6G 3B55A 4NPSA 4RGOS 2QA4A 3C2PA 4X3KA 2CHBD 4ID6A 2GN5A 3FPPA 5EPJA 2BE5D 4OEMB 3GTJB 1EIHA 3JSBA 4JK1C 1VQFA 1VCIA 4BS9A 4YZCA 2O5JC 3P1HA 4QUCA 3DWAA 5FOBB 2MNAA 2JQOA 3K6OA 4H02A 2CW0C 2LFNA 3W3AA 5C3EH 3EBEA 3S15H 4DAYB 1CKMA 3DEPA 2JB1A 2EY2A 4GLXA 2F0JA 3CC4A 4LWCA 4GXTA 1K8GA 4POFA 2YU9B 3K57A 1TWGH 4QIWB 2LY7A 3JAMi 4NKLA 1MIUA 5JJLA 3PUVA 4BY7H 4XQQA 1Q86C 1WCMB 1ESFA 3K5NA 3U4VA 5FLMH 1KIXA 4FNFA 2X6GA 1W6JA 1STAA 2SNSA 3H3VC 4PMCA 3MFYA 1HNWQ 1J5EL 4OGQC 1NBWA 5JPNC 1VQ5A 2HIVA 2R92G 2CWPA 1E2ZA 5IGCA 5K36G 3PO2G 1H9JA 2F0KA 1XMQL 1E2VA 5HGIA 2IW3A 2EVBA 2B63G 1KLGD 2D62A 3A54A 3ONAB 3K8AA 3TQYA 2K05A 1XJVA 1Q3LA 1WTPA 3WOFA 2Z6BA 2JA7H 1V43A 2NVYB 1HHVA 3PUWA 4DR4Q 1H9RA 2B29A 1NR2A 3KF6B 1EFWA 4A3EG 4ZLTF 2HHHL 1VQIA 4B3RL 1NJIC 2WB1B 1JE5A 3EJIA 2F0QA 4H13C 2AQ1B 1YI2A 4HMJA 3A0JA 2K28A 1KNEA 3BVMA 5GADC 2XRSD 1VQOA 2YV5A 5IWAQ 1OTCA 2F0SA 2E2JB 1TWAB 1IYVA 4FF2A 1M90C 4JV5L 1D8LA 3PGZA 1N33L 1AE2A 1I4XA 1YEZA 2BDNA 1VQ4A 2V4DA 4A3BB 2ZXOA 1PH6A 1U4LA 4IPHA 4X64Q 5JVH3 4DV4Q 1PTOB 2JA5B 1WYDA 3ULJA 4B3MQ 4CJ1B 1G8ZD 1X3FA 4Z9CB 2VB3X 1MBYA 3V96A 3EN2A 3GTKB 1WTHA 2F6MB 1L0YB 1PXUA 5JOBA 2AKWB 4IFDJ 4FYDA 2EXDA 4ABNA 1VQGA 3GV3A 1EQRA 1FL0A 1Q1EA 5KIXA 4M1UB 4QQBX 1QVFA 2JEAI 1A3TA 2ZJQA 5G3LF 2F52A 4FP5D 1WTOA 1S3OA 4DUZQ 1TWAH 3UI2A 3OIQA 1JOQA 1GHKA 2R7DA 5CBEE 2DNCA 4DV7Q 1HNXL 3R2TA 5K5PA 5FLMG 5C0XH 2K52A 3L2PA 2ZXPA 4UAIA 5M5XB 2QEJC 1I4QA 1VQHA 5M5WH 4C3HG 1AE3A 5EAYA 1WTWA 4HMIA 1VQ9A 2EYMA 2QSBA 3FMCA 3G7LA 5DM63 1N34Q 4B3SL 2VY3A 3KF8B 2ZTDA 3GTKH 1QCBD 1IBLL 3TZDA 5C3EG 2F3WA 2MQHA 2E5LQ 1O7YA 4BY1G 1N9WA 2Y0SE 4WORA 4OO1H 2F0NA 4DFAA 4KV6A 4PL5A 4DV0L 3HS0C 4ZKCB 1UWVA 3S2HH 5E4WC 4X64L 1NMFA 2A6ED 4RWSC 3SR1A 1IZ6A 4YY3Q 1VS0A 3SK5A 2Z4HA 2Y0SG 1DD2A 2PMZE 4UY8C 3OSOA 5A2QE 1QWYA 2WIIB 2MUYA 3T1HL 4YCWA 2JA9A 4B9XA 1LT5D 1BUVT 4HR7B 4FF4A 4JI4L 4DR3L 2PZTA 1QNUA 4JVZA 4JOIC 1VMPA 1IL8A 3IAS1 3MEFA 3NTIA 4L6TB 2IL8A 4DK3C 4G7ZC 4OX9L 1UE6A 4GZYC 4L5SA 2I5HA 4RKLA 3CCEA 2OQ0A 2YFBA 4X65L 1TQOA 4A3CH 1GOZA 1O7ZA 1F2ZA 1MSGA 4XTCS 1PZID 2WB1G 1F77A 1F2MA 4CDCC 2JSOA 3I72A 3HOVG 3KK7A 1X9NA 1PRTD 2M00A 5A35A 4GKJQ 1ZYRC 3F2DA 5H1SE 3HOWH 2VQFQ 5K36H 3LJ0A 1TIID 2H1EA 2KCMA 2L12A 4JW0A 4LNQA 1A15A 3SK6A 4HFVA 3T56B 4NXMQ 2JE6I 1Q82C 2KOLA 1X3GA 2JA8B 3KYHC 3CRLC 5FLXL 1DZ1A 1SYEA 3A55A 1IBKL 4DR7L 3AFQA 4DAVA 3TRZA 1PHJA 3GD7A 4I7AA 1ENCA 5GQOA 5HGQA 4B9WA 2ICIA 2BL8A 3PMFA 3CCJA 5DNFA 4NXNQ 1IXRA 1EY8A 4DN4M 1EIYB 1KAAA 1CKOA 3H91A 4CDEC 4A3FB 5LMNL 1VF5C 1X3EA 3VYRA 4LFCQ 1G2SA 3FKIH 2X69A 2ES2A 4UPAA 1HZAA 4IPDA 4XIGS 3S1QH 4K8IA 2K5VA 4RCOA 2Z6KA 4U6RA 1PFSA 3T1YL 4P71A 2VS1A 4DV5L 2B2TC 3MWYW 2A5HA 4ZCKA 3E6ZX 5M3FH 2UXBQ 3VA7A 2IX1A 4O1OA 4YY3L 1STYA 2ZTEA 1BR9A 1B4OA 3J80E 3QOJA 4CDFC 3QIAA 1SAPA 1ET6A 3F4MA 2JBWA 2F0WA 3E9IA 4PNYA 4PL4A 4IN3A 1OXSC 3PCOB 1FGBD 2RDGA 3NBHA 4IPGA 1QJOA 2PI2A 5C0XJ 2K5HA 1PV4A 1B7YB 1HQRD 1K83B 3VR3A 1Q8IA 5G3LD 2F0MA 1TY0A 1SNDA 4BY7B 4K2KA 4TQUS 3M4OB 2L11A 1I4RA 4A3IG 4HCSA 2L15A 1GUTA 3HG9A 1EZ8A 1SNCA 1B8AA 3A5UA 1KTKA 3JAME 3RZDH 3NELA 4X62L 2VUMH 2B39A 2MJ8A 1OXVA 2B2WC 1EY7A 5CC4A 2ZTCA 1EY5A 4N8X1 1S5FD 3I9V1 5J22A 4IUQA 4C3JH 4G76A 4OWWB 1KABA 1YHAA 1LUZA 4KY5A 1ML0D 4JBWA 4Y52H 1HCZA 1TY2A 5TSSA 2B63H 3FKIG 4Y7NB 4A3IB 2NVXB 2EY1A 3JAMc 3A56A 3M4PA 4DV4L 1D1KA 2EY6A 3D6WA 3KF8A 3DM1A 3HOXH 3R93A 2CQAA 5C4JB 3GTQH 4NXML 1ILPA 1CKNB 3NWTA 2K1BA 5E3FA 1JJ2A 1SN8A 1GHJA 5M5XH 4BBSH 3I56A 4C3IH 4A3LG 1F9QA 2WB1E 4GLVB 1L0XB 4YCVA 1RD9D 4DV1Q 1M1KC 2B8GA 3NXWA 2L1BA 2O4XA 4RGNA 3S16H 2MGSA 2R7ZH 4O1NA 1Q8KA 3BVZA 3CC7A 1PTOD 2JB2A 1XYIA 2YFAA 4TSSA 1EY6A 1OXXK 2BDOA 3HOYG 2UXCQ 2Q2IA 2SNMA 5M5YB 3RZOH 2KQ3A 1RCVD 2JK8A 4GNXB 3CXCA 3S24A 1NY4A 4P75A 4EQ5A 1XTDA 2KVMA 4POGA 1UUPA 1HZCA 3S15B 1CM9A 3TEHB 4L5RC 4PZ6A 1N32Q 1IHZA 1SRUA 1LV9A 3UDIA 4GKJL 1VQEA 4IUUA 2WACA 4WRDA 1PTOH 5LHY1 2JA5H 3HOUB 4RAUC 1NTGA 1RODA 3R2IA 2SOBA 3I4NH 1S5BD 4KD3A 2PNHA 1ENAA 4LF8L 4OIJA 2DN8A 1FD7D 1BBXC 3D3RA 3CCQA 1HNZQ 4MTKA 2WKCA 5IGDA 1JWUD 2VW9A 1S5DD 3U58A 5FJ8H 5KRUA 3VDYA 1PTOC 1PH9A 2KA7A 4XQJA 1A3VA 3D4WA 3X3MA 4K0KQ 4JI0Q 3I90A 1EEFD 1LABA 4KHZA 4A3JB 1TWHB 2ATWA 4A3KH 4DR2L 1EIGA 4PQXA 1N34L 2B3GA 4X62Q 1PYSB 2D0OA 2O2LD 3L7ZC 5FO9B 5I2XA 1ZEQX 3HGBA 2FHTA 2H5XA 4KN4C 3J80c 1DOLA 2KCTA 3IL8A 4ULLA 4R8IA 1EEID 2KENA 2NN6H 2ID0A 4DNIA 2HT1A 2JA8H 1L2FA 3J81L 4ZK9B 3S1RH 4HJ8A 4DUYQ 2NZ1D 4V0BA 4DV7L 1EYCA 4C3HH 2A69D 4ZAIA 2Z8LA 1FJGL 1QE6A 4HIMA 2R92B 3PO3G 3CPWA 2WV6D 1CI3M 3DMUA 3CF5A 3I4MG 2FXQA 1HTLD 3NQTA 2Z6KC 4A3MH 1SE3A 2RCFA 3L3OC 3T13A 1UAPA 4JCVE 4EX5A 1DOKA 3K80C 1XNRL 1B1ZA 3LWEA 2E2IH 4X6AH 4O42A 3JC66 5LMUQ 4JI1Q 2XVSA 1JE4A 4OO1I 1QILA 3MC0B 3H3VH 2QGMA 3PO2B 5DM73 1D2BA 3J81E 4I7ZC 1J8IA 3I8ZA 5EGTA 3SEBA 1EOVA 4FVMA 2XRQD 3PUXA 1LT4D 1ZKOA 3ND9A 4JI5Q 3CCUA 1MGSA 1VF7A 1AH9A 4CJ2C 4G7OC 2K19A 2C35B 2E76C 2WKDA 4NB3A 3URYA 1TWGB 4JC0A 1CUKA 1N8RC 1IBML 4LF9L 3FHWA 4UHVA 4BY7G 1EUJA 1HFNA 2VZAA 2RVLA 1YJ9A 1YITA 1EFID 4KHPQ 1RIPA 3TREA 1EY9A 4CDDC 3KLSA 1JB7A 2WFWA 3MXGA 3S2DB 3L0OA 1SYBA 4I1TA 3AYHB 4UDUC 5E7NA 4KTAA 2JYOA 1GUWA 3HKSA 1U4MA 1BDOA 1GUNA 2CWAA 3A8IE 3KUPA 2DY8A 4L8JA 2D5DA 1JQOA 2JA7G 2VNUD 1MSHA 2KBNA 4JBMA 1GVPA 2N49A 3HKZE 2L0CA 2UUCQ 1NNXA 4HEDA 3P23A 1HNWL 1KC8C 1I4GA 1PVOA 3H0GB 1K0SA 5JJZA 4RGMA 5CGKA 1P8LA 1Y1WH 4DK6C 3I4MH 2NVQB 2V1CC 1YNXA 4IUNA 3OIPA 1U4PA 2RA4A 3GTMH 2PZWA 1G91A 1O80A 4JI8Q 4N8FA 4DGZA 4GS3A 4QF4A 5FKAC 1QOHA 2JB3A 4EQNA 4ZUIA 2A6HD 3WDNA 3FP9A 3K5OA 1WCMH 3S16B 1D5XC 2XSCA 2KCCA 5IYBH 4YWKA 1B2TA 2DNEA 4IURA 3UITA 2UU9L 2QZGA 4DR5Q 4K6LA 2VXWA 2RQXA 5HY6A 3J7ZC 3MAQA 4R4IA 1EQTA 3CC2A 1DCZA 1Y8OB 2PMZB 4LFAQ 1HA6A 1LM0A 3W1GA 2NVTH 1QZGA 4NV5A 4QGUA 1A63A 2JJQA 1X54A 4JBJA 1SJHD 1CFMA 1PFNA 1NUCA 3D31A 1H9SB 1ASZA 3BYTB 5T1GA 1E1TA 4B3SQ 1TS3A 1SNQA 3CCVA 3I2ZA 1QZHA 4DR2Q 3E0EA 3BVGA 1SYFA 4L63B 3TDQA 1U5KA 1UE1A 4DUZL 2R92H 1K8MA 2PO4A 3NK9A 4H7BA 1WI5A 1KL9A 1Y1VH 4LF4Q 3FPUB 1EZ6A 3BZDB 1C9OA 2JP1A 3NSWA 5IYDG 2DJGC 1BNZA 1UEAB 5LMNW 1LTSD 5C0XG 3NUCA 4J6HA 3IFTA 4DV5Q 4AYBE 4DK1A 3MA2B 3JAML 2K50A 4F88A 4DWLA 4HCEA 3DM3A 4A4IA 2UXBL 1JJCB 3RUZA 4IPCA 1BBUA 4LFBL 4JOIA 2K5WA 3J81i 1LTGD 3I4LA 1B70B 4K0KL 4TRDA 2VQEL 4LFAL 1TWHH 1G6ZA 5C5LA 4IFDI 4R4OA 3VA9A 3QO2A 5C4XH 2Q2UA 5IYCG 2MFIA 3FDTA 4BXXG 1K8OA 1AP0A 1TVXA 5CV6A 3NBIA 1JICA 2BH2A 1GKHA 1PYWD 3FNBA 3TP5A 4IOAA 1HZBA 2KCNA 4B3TQ 2H4OA 1SR3A 1SE8A 4A3FG 4GN3B 4NXNL 2N55A 2EYPA 3T53B 4F7XA 5I2YA 3ND8A 5ISRA 4AH6A 3KF6A 1LTLA 2YTYA 1X6OA 3QJYA 2I5MX 1WTXA 2P5ZX 1STEA 1N32L 2F0DA 1T5EA 3Q6SA 3PF4A 5ELCA 1E7ZA 2IHEA 1PZJD 1I94Q 2QCPX 3I55A 3OYYA 4OX9Q 2AWNA 5JEAG 1ESRA 4ILWA 2K14A 2B2TA 1RJTA 2VL6A 4A93G 1C0AA 4IUVA 3TP6A 3TMEA 1H9MA 2A73B 2PI2E 3H0GG 2BCOA 1EYGA 1BCPF 1SMYD 1V1QA 1SMXA 3SHLA 4KD4A 1TS2A 5D3IB 3J7AF 2IHFA 3MEHA 4A3GB 4RA8A 2RADA 1F2YA 4F8MA 4LF9Q 1I94L 3EA6A 1WOCA 1ZYRD 1ZXTA 3HOVB 3P7JA 1IW7C 4B3TL 3OMGA 1EY4A 2ZRRA 3DA3A 1C48A 2HQLA 3VR2A 3IAYA 2R3ZA 5E1FA 3Q0AA 2K4KA 3VR4A 4A3MG 1JWMD 4A3IH 3GTMB 3F2CA 1EWCA 4HN7A 1D5ZC 3H6MA 4OAUC 4HAEA 5JEAH 4LFBQ 1QNKA 4G57A 3MXNB 5I6WA 5I9PA 3CCSA 3X3NA 3SXHA 3T16A 4K6DA 5JJIA 1CHPD 4QCLA 4XXEA 2A19A 4IUTA 2M2LA 2O5IC 1R9TH 3I91A 3H09A 3K81C 3U9SA 3F2BA 2FMMA 2AQ3B 5AJ3L 3VR6A 4UP7A 5KNDA 3HOYB 3OW2A 1QVGA 1FJGQ 4FF3A 2QW7A 5M3MB 2AQ2B 3FBVA 1C4QA 1WTQA 2K04A 1Q12A 5EBDA 1E2WA 2Q8TA 3FRPB 1HR0W 2B2VA 2G9DA 5IP9H 4M8AA 4YWLA 2GVAA 1V1PA 5T1IA 4DR6L 4HTHA 2F0UA 3AJFA 1Z47A 3RLFA 2F4IA 1AZQA 1YNNC 3E0JA 3T4AC 1SDFA 4MZ9A 5JVG3 3HOUG 3G71A 2RHSB 1VQAA 3UDFA 4H0LC 3LX0A 1DGSA 5DAUA 4LUVA 3M85A 5AJ3Q 4IALA 1I4PA 2KUMA 1GJXA 3MFGA 4JYAL 4G75A 4DR7Q 3M4YA 3J81c 2D2CC 5ELBA 4KN7C 3NEMA 4K14A 2JA8G 3KBXA 4ALPA 1PDQA 3RN5A 1I6HH 2EYHA 1QG7A 3L9AX 4A3EH 4BBRB 2UUAQ 1P16A 2FJ2A 4DV6L 5IOCA 3NENA 1I50B 2R61A 5J39A 3S1NH 4RKBA 2RCNA 3D0FA 3D8GA 5CMDA 1XPUA 1TWFH 4DK0A 5EKIA 4LK1C 1GO3E 2UXCL 1L1OC 1I5FA 3IRBA 5C4ZA 1TR5A 4OHJA 1VMCA 3V2TA 1HNZL 2SDFA 2R93B 2LXJA 4DF7A 1SROA 1Q7YC 1E24A 1O7IA 1KHIA 2AUKA 2KEEA 5EPKA 3SVMA 2YU9H 1PFMA 2HCCA 4N9PA 1D6EC 4DV1L 4KHPL 1HTPA 1SLJA 2A68C 2L1LB 2X6LA 1LTID 3J80i 3FVVA 3G4SA 1A2TA 4X3UA 3WOEA 1PH4A 1MJEA 3LGJA 2E8GA 2N88A 4LF7Q 5ELEA 1SYCA 4GNXC 3CCLA 3M9BA 4KKTA 5NUCA 2NN6I 2Y0SB 4A3EB 2DY7A 2WINB 2G5DA 3PIPA 4KJOA 2AMCB 3NHHA 2E2HH 2A2DA 3HOYH 2Q8RE 4QL5A 1PRTC 3W2DA 3K7AB 4CBVA 3G6JB 4A3JG 2NWGA 1HJPA 3BU2A 1VQJA 1SSOA 3GTPH 4BA2I 1CSQA 2NYZD 2F1MA 3RMHA 1QUQB 2JEBI 4TVAB 4HSVA 2XWJB 2K75A 1YBYA 5D65A 4MTNA 3PQIA 4DR6Q 2J4XA 2OF1A 3TP7A 1PH7A 3MHBA 4Y7NH 4RMFA 1LTAD 1YZ6A 1V9PA 4DV6Q 3T1HQ 1VQKA 4C3IG 1EOTA 1EU3A 1RL2A 4YHHL 1B53A 1J9OA 3N52A 4E6IA 3J7AV 1X3QA 4A75A 2NZHA 3CD6A 3M7NA 3D6CA 4JYAQ 1JQYD 4DXFA 5M3FG 4DUYL 4AYBG 1FNUA 2JA6G 4R1JA 4A3JH 3K0XA 1E0BA 4P74A 2AUJD 2GSCA 3L0IA 1LACA 3AB9A 1HQMC 4QY7A 1A62A 1SJED 1I6HB 2RBMA 2K5NA 3HKZB 1NAPA 5C4JH 1WFQA 2EDGA 5IP7H 1K8AC 3DLLA 1LTBD 1HUNA 2B2YC 5A2QL 2PPBC 3PSIA 1VQ8A 4BBSB 5IGEA 3OWEB 4BBRG 1YHBA 5C44B 5FJ8G 4NP5A 1JC7A 1YJNA 3H15A 1VQMA 3VA5A 5CBAE 2EE1A 4K5WA 4C1NI 3NE5B 3KBGA 2K7VA 4LFCL 2XNAC 3AMUA 2IJ0A 1XNQL 2IX0A 2CAZB 2B2UC 5J3BA 1EWIA 4ZUJA 4R8NA 2B2VC 4S3SA 1DJRD 3OOCA 4XT1B 1LT3D 2MJFB 3STBC 2BA0A 1EQQA 5EQ0A 4WJ3M 1JJGA 4DV3L 1I4HA 1F9RA 1B9MA 1FGUA 2F0TA 5IGBA 2DGYA 3QWNA 4J1MA 3R3OA 1JORA 1XTCD 4B08A 1SNPA 5M3MH 1AFPA 2E2DC 3OMCA 1CKNA 1D1IA 1TS5A 4RCNA 2F03A 1HFGA 3H3VI 4OWXB 5GAGC 2VUMG 1LYLA 4YZDA 4CHTB 5IYBG 4A3DG 5HGTA 4OONA 3F1ZA 5CR3A 5EBCA 5KYIA 3D4RA 4Q5VA 3AEVA 2F0LA 1TWCB 3HOXB 4DR1Q 5C3EB 1U0LA 2AWOA 1CZGA 3A8JE 2RDHA 3P75A 4BA1I 4HIDA 4HJAA 1N33Q 4FXDA 2K5QA 3ULPA 4L5TA 4YCUA 4CGYB 1SYDA 3Q24A 3IFDA 2Z4IA 1WD1A 2JA5G 1WD0A 1CZWA 5CV7A 4ME3A 4DA2A 1FNWA 1BKBA 3G6EA 4HEA1 3KJPA 2BE5C 1RF2D 1AZPA 3GTOB 2OCEA 1UNSA 2CH4A 3M3YH 4A3DB 4KMUC 4IJHA 4HIOA 3U4ZA 4BWGB 2ZM6Q 2D9UA 2XN9C 1Q90A 1Q81C 3NBHB 5LNK1 3TS0A 3M7GA 3O13A 2LXKA 3HFZB 1VQCA 1IBMQ 4X3SA 3M4OH 2N3SA 3RLOA 1L1OB 1H9SA 5FO7B 1TU2B 4JI2Q 5BN5A 3PIP3 1IW7D 3BYYB 3TBIB 5BN3A 1WJJA 3Q23A 3A8KE 3OWFA 4C56C 3DWPA 1KDBA 2R93H 3DUZA 4GNXA 1KD1C 1IBLQ 3NTHA 1B9NA 2FEFA 3CW2C 3NWSA 5KNBA 4JI6Q 1Y1WB 2NTSA 1EY0A 4A93B 4C1NK 4O1PA 3I73A 2JAEA 1G51A 3OHXC 5IT9E 4A3MB 1HPCA 4A76A 1WTVA 3UE1A 4RGTA 5ELFA 1D5MC 3GTOH 4HJ7A 3GTLB 3SGIA 3SE0A 1BBWA 1R4PB 3CHBD 1O7LA 4LJZC 4IJLA 4KHVA 4I65A 2RSNA 4KKSA 4GOPB 3PF5A 5IGGA 4NDXA 2PYKA 4X66Q 4C3JB 4DV0Q 2MHVA 1TKWB 1PRTF 5CV4A 2L55A 4IFDG 3QB3A 2A1AA 2F3IA 3HOZH 3S14H 3LNNA 5FLXE 4EQPA 2IX3A 1CA6A 3MXPA 3DO9A 4O0AA 4UP9A 3RD4A 1YNJD 4CKEA 2UU9Q 1XX8A 3GV6A 4QIWE 2PW7A 3MTSA 1BXTA 4C2MH 2PQAB 2OT2A 5C3XA 2UUBQ 4HJ5A 4U673 4EGVA 2HUGA 3DWQA 4JI2L 1B50A 4Q0FA 1ICFB 4BBRH 5AFWA 2PQAA 1VQ6A 2EYLA 3Q22A 4NV2A 3SK8A 3S17B 4JI3Q 5M5WB 3CMAA 4CKBA 1I50H 2PW5A 3BDLA 3QG1A 3I70A 4X3TA 3NQIA 1BCPC 5CV9A 1SFOB 4OXPA 1PH5A 2E2IB 1TT2A 3HKZG 2LS01 2EJFC 1OXTA 1EU4A 5IYCH 2IT1A 4ODGA 2GA4B 4FF1A 4BXXH 2QGQA 4A3KG 3CP0A 2ZM6L 1KDAA 3ERSX 2EOTA 3I3CA 3U9OA 3CU7A 3TN2A 1G2TA 1V1OA 2LSSA 3UDXA 2HHHQ 3EQLC 3MZ5A 4IQZA 1U9RA 1TS4A 4LF8Q 1WCMG 2OTJA 2UXDL 2EYOA 2R6GA 2B2UA 5IODA 1MI2A 2A6HC 2R7FA 1LLRD 2F0VA 1K3BC 2CW0D 5I4DA 1I3QH 4LF6Q 4KY7A 4G4KA 1XMQQ 4K5XA 5D3DA 2NTTA 4G7HC 3CQZH 3HP3A 4DAPA 4GKKL 2F4VQ 5C5MA 2OEOA 4EQOA 1T5XD 2CFMA 1B44D 3KLWA 1VQLA 1II3A 3M4QA 1LTRD 5EKLA 3KDFA 4GOPA 1VQNA 1GUSA 3TZUA 2K6AA 1GXDC 2EQSA 2HDLA 3S2HB 1D7QA 5COYA 1YIJA 2N8NA 4PMWA 2EY5A 1BCPB 2P22B 1CTMA 3S9WA 5C4HA 3I7FA 3W1BA 1S4ZA 3F8TA 1CQVA 2E75C 5BR8L 3Q8DA 2JA7B 2HCIA 2QDBA 4LW1A 3C3LA 5CORA 3HOZB 3PO2H 1SXTA 1Q1BA 2ICEC 5IT9L 1K9MC 2TSSA 2EPBA 1PYBA 4FXGC 3J80L 2WAQB 5HURA 1UEBA 1IKLA 4LUZA 2A68D 2XIWA 3CCRA 3PIOA 1SNMA 2VQEQ 1STNA 5DLQE 4EVOA 2C9OA 4L5QA 4Q9VA 4NMZA 1BVSA 1V8QA 2FMCA 1K83H 3K0YA 2XTQA 4NW2A 3LJ1A 3AFPA 5EKKA 3BZCA 4QMGA 4DAMA 4A3BH 1Q46A 1PRTB 2NVYH 4DV2Q 3QR8A 1Y14B 4FDBA 2VB2X 4UP8A 1EL0A 2OTLA 3HOWB 4MNOA 1TDPA 2L4NA 1RHPA 2ZXRA 2D0PA 2KHSA 4QB4A 2IY5B 3KLRA 4APVA 1OO9B 5C4XG 1ONLA 3TSSA 3UE0A 3OTOL 2GVBA 4C2MB 1F9PA 1HR0Q 1HH2P 2C5CA 2JA6H 3C46A 1JCKB 1PH1A 2J0TD 1E1OA 2Q2HA 2MO1A 3UDGA 1CA5A 2LMCB 5KYLA 3VYSA 2I07B 3U50C 2Z0SA 4LF5Q 3ULLA 4DR5L 5EPLA 1Y1VG 2IPKD 2WP8J 4JI8L 1LT6D 1ENFA 1JOKA 3GTLH 4TKOB 1G6PA 4H44C 4OAVB 5BR8Q 2LKVA 1EQVA 2R7ZB 1I6VC 3STBD
chains in the Genus database with same CATH topology
4K0KQ 4JI0Q 1ASYA 4KHZA 4KI0A 2ATWA 2GN5A 3PIPA 4A3KH 4DR2L 4KLKA 2AMCB 2B3GA 1N34L 4X62Q 3HOZG 1PYSB 2D0OA 4LUOA 1KRTA 2E2HH 1IL2A 2A2DA 3HOYH 2UUCL 5M5YH 4QL5A 3JSBA 3L7ZC 1YVCA 1VQFA 1VCIA 4YZCA 2MNAA 2JQOA 4A3JG 2Q2TA 1HJPA 1QUQA 3BU2A 1VQJA 3GDEA 2H5XA 4H02A 5IY0A 5C3EH 3J80c 3RN2A 4BA2I 3GTPH 2AHOB 1UE7A 1CSQA 2KCTA 1CKMA 3EBEA 4DAYB 3S15H 4AQYL 2JB1A 4GLXA 2KENA 4DNIA 2ID0A 2HT1A 3CC4A 1QUQB 1TXYA 2JEBI 4LWCA 4TVAB 2JA8H 2K75A 1L2FA 1YBYA 4MTNA 3S1RH 4DR6Q 4HJ8A 4DUYQ 4RG1A 4GXTA 1K8GA 3I4OA 4POFA 1PH7A 4WJ4A 4YWMA 4Y7NH 4DV7L 4RMFA 2CCZA 1KRSA 1YZ6A 1TWGH 1HZ9A 5IE8A 3JAMi 4C3HH 4PG3A 1MIUA 1V9PA 4DV6Q 3T1HQ 1VQKA 3PUVA 4BY7H 5JJLA 3ER0A 2I5LX 4HIMA 1Q86C 1FJGL 1RL2A 4YHHL 3PO3G 3U4VA 5FLMH 3CPWA 1PH2A 1KIXA 3CF5A 3I4MG 2FXQA 3HOXG 4A75A 4AQYQ 2NZHA 3CD6A 4LF7L 3M7NA 3RNUA 1Y1WG 1HNWQ 1J5EL 4JYAQ 1NBWA 4GLAC 2Z6KC 2VQFL 2HIVA 4A3MH 2CWPA 1VQ5A 2R92G 3S17H 4A3FH 1K73C 5M3FG 4DUYL 4AYBG 1PH8A 2JA6G 5K36G 4R1JA 3PO2G 1XMQL 5HGIA 1MKHA 4JCVE 4EX5A 4A3JH 3K0XA 2RF4A 2D62A 3K80C 3TQYA 2E2IH 3K8AA 4P74A 1XNRL 2B63G 4X6AH 1XJVA 3JC66 5LMUQ 3L0IA 4JI1Q 3HOWG 4OO1I 2JA7H 4QY7A 3HOVH 1V43A 4OO1G 1A62A 3H3VH 3PUWA 3KJOA 2NVXH 2IP6A 4DR4Q 5GAHC 3B6YA 2K5NA 2B29A 3KF6B 1EFWA 3S1MH 4A3EG 5C4JH 2HHHL 1WFQA 1VQIA 4B3RL 1NJIC 1EOVA 5IP7H 1JE5A 1K8AC 3DLLA 4PZ7A 1YI2A 3H0GH 4LF4L 3PUXA 1XNQQ 3A0JA 3PSIA 1VQ8A 5GADC 1VQOA 4BBRG 4JI5Q 2YV5A 5IWAQ 1TWCH 1YHBA 1OTCA 5FJ8G 3CCUA 1AH9A 1YJNA 3H15A 1VQMA 2K19A 2C35B 5GROA 1M90C 2NVQH 2CQOA 4NB3A 4JV5L 1D8LA 4JC0A 1CUKA 3PGZA 1N8RC 1IBML 1N33L 1AE2A 2KHIA 1YEZA 4LF9L 3FHWA 1I6HH 1VQ4A 2UUAL 4DV3Q 4LFCL 2HIXA 4BY7G 1PH6A 1J6QA 1EUJA 4IPHA 4X64Q 2VZAA 4DV4Q 1YJ9A 1XNQL 2IX0A 4O2DA 1WYDA 3HOUH 3ULJA 1YITA 4IO9A 1S72A 2CAZB 4KHPQ 1RIPA 4B3MQ 1L1OA 1E22A 5J3BA 1Z9FA 3TREA 1EWIA 1JB7A 2WFWA 3CCMA 3L0OA 1X3FA 2MJFB 3STBC 4I1TA 5IP9G 3AYHB 2BA0A 1A0IA 1EQQA 4WJ3M 3EN2A 1JJGA 4DV3L 3TS2A 2F6MB 1FGUA 5E7NA 5LMNQ 2AKWB 2DGYA 3HKSA 1S40A 4YZ9A 2CWAA 5M3MH 4IFDJ 3BJUA 2E5LL 1CKNA 2EXDA 2JA7G 1XMOQ 1N36L 2VNUD 2KBNA 1XPOA 1VQGA 4JBMA 3J81j 4R4QA 1GVPA 3H3VI 2N49A 1EQRA 4OWXB 5GAGC 1FL0A 1Q1EA 3HKZE 1SFOH 2VUMG 2UUCQ 1LYLA 4YZDA 1W2BA 3P23A 2EIFA 4QJFA 1KC8C 4QQBX 5IYBG 1IBKQ 1QVFA 2JEAI 4OONA 4A3DG 3F1ZA 1PVOA 2ZJQA 2R7ZG 2F52A 3AEVA 1S3OA 1P8LA 2V6EA 1G291 4DUZQ 4DR1Q 1TWAH 1VQ7A 1U0LA 2AWOA 4DK6C 1Y1WH 3I4MH 4HJAA 4BA1I 2R7DA 4HIDA 4A93H 2V1CC 1N33Q 1YNXA 1MJCA 4DV7Q 1HNXL 3GTMH 3ULPA 5FLMG 4L5TA 4YCUA 2K52A 4JI8Q 3L2PA 4B3ML 4JI0L 4J15A 4GS3A 1VQHA 5ELOA 5M5WH 1KAWA 2JA5G 1H95A 1AE3A 2JB3A 4ME3A 5EAYA 5IYDH 1BKBA 3LJ2A 3G6EA 4A3GH 4HEA1 4DPGA 3KJPA 1VQ9A 2NZOA 3FP9A 2OCEA 2R93G 1N34Q 3CMEA 2CKZB 1L0WA 2FUG1 4B3SL 3M3YH 1WCMH 2KKMA 5IYBH 1VQDA 4IJHA 4HIOA 2VY3A 4YWKA 3KF8B 3U4ZA 5IWAL 2ZM6Q 3UITA 2XGTA 2ZTDA 4DR5Q 2UU9L 3GTKH 1Q81C 3NBHB 5LNK1 4PZ8A 3TS0A 1IBLL 3J7ZC 1QVCA 2LXKA 5HY6A 4X65Q 3HFZB 5C3EG 1VQCA 4R4IA 2MQHA 1XPRA 2E5LQ 1IBMQ 3CC2A 3M4OH 2N3SA 4BY1G 3RLOA 1N9WA 2Y0SE 1L1OB 2OQKA 4GKKQ 2XTRA 2F66B 4PL5A 1LM0A 4LFAQ 4JI2Q 3W1GA 4DV0L 2NVTH 3GTGH 1UWVA 4NV5A 4AS3A 4QGUA 1QZGA 2JJQA 4X64L 3S2HH 1A63A 4DR4L 1NMFA 1X54A 4JBJA 4BY1H 1OXUA 1WJJA 3D31A 1ASZA 4B3SQ 1E1TA 1HNWL 1IZ6A 4YY3Q 1VS0A 2A2CA 4B3RQ 3CCVA 3I2ZA 1QZHA 4DR2Q 4JI4Q 4JBKA 3E0EA 2Y0SG 2PMZE 2R93H 4UY8C 4GNXA 1KD1C 1U5KA 1IBLQ 4GN5A 4A3CG 1UE1A 4DUZL 4DR1L 3CW2C 2R92H 4JI6Q 4JI5L 1WI5A 3T1HL 1KL9A 1Y1VH 2JA9A 4YCWA 4LF4Q 3PO3H 1C9OA 2YYZA 4O1PA 4JI4L 4LF6L 4JV5Q 4P72A 5IYDG 4DR3L 2JAEA 1G51A 4JOIC 1T9HA 5LMNW 3IAS1 5JEAJ 4AS2A 3MEFA 4A76A 5C0XG 3UE1A 2MO0A 4DK3C 5C0XI 1X55A 4DV5Q 4OX9L 1UE6A 1GM5A 4L5SA 4AYBE 3ICEA 1UE5A 2I5HA 5IT9c 3GTOH 4HJ7A 2K50A 4DWLA 5GAEC 3DM3A 4DR3Q 3SGIA 4A4IA 2UXBL 2KHJA 4JI1L 3CCEA 1JJCB 1BBWA 3AQQA 2OQ0A 4IPCA 2YFBA 4X65L 4A3CH 4IJLA 1XNRQ 3SDJA 1BBUA 5IP7G 4JOIA 4LFBL 3J81i 4K0KL 1B70B 4GOPB 3PF5A 4XTCS 4HJ9A 4X66Q 2VQEL 4DV0Q 4LFAL 2WB1G 1TWHH 1HR0L 4IFDI 4R4OA 3VA9A 5C4XH 2Q2UA 3A74A 2MFIA 5IYCG 4BXXG 4IFDG 4R4CA 3HOVG 1X9NA 2A1AA 2F3IA 2BH2A 3HOZH 1GKHA 4GKJQ 4IOAA 3K7AH 3F2DA 3S14H 1HZBA 3KDFB 5H1SE 4B3TQ 3HOWH 5C44H 1SR3A 2XTIA 2VQFQ 2E2JH 4PL3A 3LJ0A 1SE8A 2KCMA 3DO9A 4A3FG 4LNQA 4GN3B 4NXNL 4HFVA 4O0AA 4UP9A 4NXMQ 2JE6I 1KXLA 1Q82C 5FLXc 4AH6A 3KF6A 1LTLA 1X3GA 2YTYA 1X6OA 3KYHC 2UU9Q 5JJKA 2I5MX 4QIWE 1VQPA 1N32L 4C2MH 4A3GG 3PF4A 3OTOQ 1IBKL 4DR7L 1E7ZA 2IHEA 2PQAB 1I94Q 2UUBQ 3AFQA 4HJ5A 3PUYA 3TRZA 1PHJA 3GD7A 3I55A 3OYYA 4OX9Q 5GQOA 5HGQA 2AWNA 5JEAG 4YHHQ 4Z7HA 4JI2L 2K14A 3CCJA 4BBRH 4NXNQ 1IXRA 2VL6A 4A93G 1C0AA 2PQAA 1EIYB 1VQ6A 2PI2E 3H0GG 1EYGA 1V1QA 4DKAC 1CKOA 4NV2A 1SMXA 4JI3Q 5LMNL 2RHQB 3CMAA 1I50H 1X3EA 4DV2L 4JI6L 3DA4A 2IHFA 4LFCQ 4R4TA 3FKIH 1YHQA 2ES2A 4UPAA 1HZAA 3K7UC 3RLNA 4IPDA 4OXPA 4XIGS 1PH5A 1I94L 4LF9Q 3S1QH 1WOCA 2K5VA 3HKZG 1YO7A 1OXTA 5IYCH 2IT1A 2Z6KA 4BXXH 4U6RA 1PFSA 2QGQA 3T1YL 4P71A 2VS1A 1GD7A 4A3KG 3CP0A 2ZM6L 4B3TL 4DV5L 1JT8A 3ERSX 3BZKA 2ZRRA 3DA3A 2HQLA 3CPFA 2BH8A 5M3FH 2UXBQ 2LSSA 2IX1A 4O1OA 4YY3L 5ELNA 3UDXA 2HHHQ 2K4KA 4A3MG 4A3IH 2ZTEA 3F2CA 4OAUC 4LF8Q 1WCMG 2OTJA 2UXDL 3T1YQ 2R6GA 2ASBA 4LFBQ 2R7FA 3MXNB 4IOCA 3F4MA 1EIFA 3CCSA 1I3QH 4LF6Q 2YTXA 3E9IA 4BBSG 5JJIA 4PL4A 3I4NG 1OXSC 4JG2A 3RR5A 3PCOB 4A3LH 2A19A 4IPGA 3KP9A 2BA1A 2PI2A 1XMQQ 5C0XJ 2K5HA 1PV4A 1B7YB 3CQZH 3G48A 4GKKL 2F4VQ 1R9TH 2YTVA 3K81C 2CFMA 3GO5A 3S2DH 3KLWA 4TQUS 3F2BA 1VQLA 5AJ3L 3M4QA 2N78A 4UP7A 3KDFA 4GOPA 3OW2A 1NMGA 2L15A 2WAQG 4A3IG 1VQNA 1QVGA 2EQSA 1B8AA 1FJGQ 3A5UA 1D7QA 3RZDH 3NELA 2ZJPA 4X62L 5C44G 2N8NA 1YIJA 2VUMH 4PMWA 3PV0A 3FBVA 1OXVA 2P22B 2F4VL 3I7FA 3W1BA 2ZTCA 2ALYB 3I9V1 3F8TA 4C3JH 4G76A 4OWWB 3KFUA 1Q12A 1YHAA 2DUDA 2WAQE 1LUZA 1YJWA 1K3RA 4JBWA 5M3MG 5BR8L 3CAMA 1HR0W 4Y52H 3Q8DA 5IP9H 2B63H 3FKIG 4LW1A 4YWLA 3PO2H 1Q1BA 3JAMc 2GVAA 3ZJYC 1K9MC 3E9HA 3M4PA 4DV4L 4JI7Q 2UXDQ 1PYBA 4DR6L 3HOXH 3AJFA 1Z47A 3RLFA 3GTQH 4NXML 1UEBA 1CKNB 4LUZA 3J7A5 1JMCA 3HOUG 4MZ9A 1JJ2A 3G71A 3CCRA 1SN8A 3PIOA 2RHSB 1VQAA 4OWTB 3UDFA 5M5XH 4BBSH 3I56A 2VQEQ 5DLQE 4C3IH 1DGSA 4A3LG 1W3SA 4Q9VA 1E3PA 4L5QA 4LUVA 1BVSA 3M85A 2WB1E 4GLVB 4JI7L 5AJ3Q 1K83H 4YCVA 2I0QA 4DV1Q 1M1KC 4LF5L 2XTQA 1K0RA 1J5EQ 4JYAL 3LJ1A 4G75A 3AFPA 4DR7Q 3J81c 3BZCA 4A3BH 3NEMA 4DAMA 1Q46A 2JA8G 3PUZA 3S16H 4A3DH 4ALPA 2NVYH 3RN5A 3KOJA 1IYJB 1Q8KA 1VQBA 3CC7A 4HIKA 2R7ZH 2JB2A 4DV2Q 2YFAA 4A3EH 1PA6A 2UUAQ 1Y14B 4FDBA 4UP8A 1P16A 4JI3L 4DV6L 2OTLA 1OXXK 4MNOA 1A8VA 3HOYG 3NENA 2UXCQ 2D0PA 2Q2IA 3GTJH 4AIMA 4GN4B 2ZJRA 3S1NH 2A8VA 1X65A 2RCNA 3RZOH 3D0FA 2IY5B 2OWOA 2JK8A 4Z7GA 4APVA 1XPUA 2RIOA 1NE3A 1TWFH 3CXCA 3S24A 4GNXB 5C4XG 1NY4A 4P75A 4EQ5A 2UUBL 1XTDA 4POGA 1GO3E 3EIVA 2UXCL 1L1OC 1HZCA 1I5FA 3UE0A 3WWVA 3IRBA 3OTOL 4A3BG 2GVBA 1HR0Q 1HH2P 2QEXA 3TEHB 1KQSA 4L5RC 4PZ6A 2JA6H 1N32Q 1HNZL 1CSPA 1FVIA 1SRUA 2LXJA 1SROA 3UDIA 1C7YA 1Q7YC 4GOPC 1E24A 3W5OA 4GKJL 1XMOL 1O7IA 1VQEA 1KHIA 1N36Q 1PH1A 2JA5H 1E1OA 1NTGA 5LMUL 2Q2HA 2YU9H 2MO1A 3UDGA 1PH3A 3I4NH 3U50C 2Z0SA 4DV1L 3ULLA 2PNHA 4LF5Q 4KHPL 1SLJA 4DR5L 2L1LB 4LF8L 3IAM1 3J80i 1Y1VG 1HNZQ 3CCQA 3A5ZB 3G4SA 2WP8J 4JI8L 1MJEA 1PH4A 1X56A 3LGJA 2E8GA 3GTLH 1HNXQ 2VW9A 1G6PA 3U58A 1SJ8A 5FJ8H 4LF7Q 2XMXA 4OAVB 3VDYA 5BR8Q 4GNXC 3CCLA 3M9BA 4P73A 1PH9A 4X66L 2NN6G 3STBD 4NPSA 2QA4A 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K Q;  4JI0 Q;  1ASY A;  4KHZ A;  4KI0 A;  2ATW A;  2GN5 A;  3PIP A;  4A3K H;  4DR2 L;  4KLK A;  2AMC B;  2B3G A;  1N34 L;  4X62 Q;  3HOZ G;  1PYS B;  2D0O A;  4LUO A;  1KRT A;  2E2H H;  1IL2 A;  3HOY H;  2UUC L;  5M5Y H;  4QL5 A;  3L7Z C;  1YVC A;  1VQF A;  1VCI A;  2MNA A;  2JQO A;  4A3J G;  2Q2T A;  1HJP A;  1QUQ A;  3BU2 A;  1VQJ A;  3GDE A;  2H5X A;  4H02 A;  5IY0 A;  5C3E H;  3J80 c;  3RN2 A;  4BA2 I;  3GTP H;  2AHO B;  1UE7 A;  1CSQ A;  2KCT A;  1CKM A;  3EBE A;  4DAY B;  3S15 H;  4AQY L;  4GLX A;  2KEN A;  4DNI A;  2ID0 A;  2HT1 A;  3CC4 A;  1QUQ B;  1TXY A;  2JEB I;  4LWC A;  4TVA B;  2JA8 H;  2K75 A;  1L2F A;  1YBY A;  4MTN A;  3S1R H;  4DR6 Q;  4HJ8 A;  4DUY Q;  4RG1 A;  1K8G A;  3I4O A;  4POF A;  1PH7 A;  4WJ4 A;  4YWM A;  4Y7N H;  4DV7 L;  4RMF A;  2CCZ A;  1KRS A;  1YZ6 A;  1TWG H;  1HZ9 A;  5IE8 A;  3JAM i;  4C3H H;  4PG3 A;  1MIU A;  1V9P A;  4DV6 Q;  3T1H Q;  1VQK A;  3PUV A;  4BY7 H;  5JJL A;  3ER0 A;  2I5L X;  4HIM A;  1Q86 C;  1FJG L;  1RL2 A;  4YHH L;  3PO3 G;  3U4V A;  5FLM H;  3CPW A;  1PH2 A;  1KIX A;  3CF5 A;  3I4M G;  2FXQ A;  3HOX G;  4A75 A;  4AQY Q;  2NZH A;  3CD6 A;  4LF7 L;  3M7N A;  3RNU A;  1Y1W G;  1HNW Q;  1J5E L;  4JYA Q;  1NBW A;  4GLA C;  2Z6K C;  2VQF L;  2HIV A;  4A3M H;  2CWP A;  1VQ5 A;  2R92 G;  3S17 H;  4A3F H;  1K73 C;  5M3F G;  4DUY L;  4AYB G;  1PH8 A;  2JA6 G;  5K36 G;  4R1J A;  3PO2 G;  1XMQ L;  1MKH A;  4JCV E;  4EX5 A;  4A3J H;  3K0X A;  2RF4 A;  2D62 A;  3K80 C;  3TQY A;  2E2I H;  3K8A A;  4P74 A;  1XNR L;  2B63 G;  4X6A H;  1XJV A;  3JC6 6;  5LMU Q;  4JI1 Q;  3HOW G;  4OO1 I;  2JA7 H;  4QY7 A;  3HOV H;  1V43 A;  4OO1 G;  1A62 A;  3H3V H;  3PUW A;  3KJO A;  2NVX H;  4DR4 Q;  5GAH C;  3B6Y A;  2K5N A;  2B29 A;  3KF6 B;  1EFW A;  3S1M H;  4A3E G;  5C4J H;  2HHH L;  1WFQ A;  1VQI A;  4B3R L;  1NJI C;  1EOV A;  5IP7 H;  1JE5 A;  1K8A C;  3DLL A;  4PZ7 A;  1YI2 A;  3H0G H;  4LF4 L;  3PUX A;  1XNQ Q;  3A0J A;  3PSI A;  1VQ8 A;  5GAD C;  1VQO A;  4BBR G;  4JI5 Q;  2YV5 A;  5IWA Q;  1TWC H;  1YHB A;  1OTC A;  5FJ8 G;  3CCU A;  1AH9 A;  1YJN A;  3H15 A;  1VQM A;  2C35 B;  5GRO A;  1M90 C;  2NVQ H;  2CQO A;  4NB3 A;  4JV5 L;  1D8L A;  4JC0 A;  1CUK A;  3PGZ A;  1N8R C;  1IBM L;  1N33 L;  1AE2 A;  2KHI A;  1YEZ A;  4LF9 L;  3FHW A;  1VQ4 A;  2UUA L;  4DV3 Q;  4LFC L;  2HIX A;  4BY7 G;  1PH6 A;  1J6Q A;  1EUJ A;  4IPH A;  4X64 Q;  2VZA A;  4DV4 Q;  1YJ9 A;  1XNQ L;  2IX0 A;  4O2D A;  1WYD A;  3HOU H;  3ULJ A;  1YIT A;  4IO9 A;  1S72 A;  4KHP Q;  1RIP A;  4B3M Q;  1L1O A;  1E22 A;  5J3B A;  1Z9F A;  3TRE A;  1EWI A;  1JB7 A;  2WFW A;  3CCM A;  3L0O A;  1X3F A;  3STB C;  5IP9 G;  3AYH B;  2BA0 A;  1A0I A;  1EQQ A;  4WJ3 M;  3EN2 A;  1JJG A;  4DV3 L;  3TS2 A;  1FGU A;  5E7N A;  5LMN Q;  2AKW B;  2DGY A;  3HKS A;  1S40 A;  2CWA A;  5M3M H;  4IFD J;  3BJU A;  2E5L L;  1CKN A;  2EXD A;  2JA7 G;  1XMO Q;  1N36 L;  2VNU D;  2KBN A;  1XPO A;  1VQG A;  4JBM A;  3J81 j;  4R4Q A;  1GVP A;  3H3V I;  2N49 A;  1EQR A;  4OWX B;  5GAG C;  1FL0 A;  1Q1E A;  3HKZ E;  1SFO H;  2VUM G;  2UUC Q;  1LYL A;  1W2B A;  2EIF A;  4QJF A;  4QQB X;  1KC8 C;  1HNW L;  5IYB G;  1IBK Q;  1QVF A;  2JEA I;  4OON A;  4A3D G;  3F1Z A;  1PVO A;  2ZJQ A;  2R7Z G;  2F52 A;  3AEV A;  1S3O A;  1P8L A;  1G29 1;  4DUZ Q;  4DR1 Q;  1TWA H;  1VQ7 A;  1U0L A;  2AWO A;  4DK6 C;  1Y1W H;  3I4M H;  4HJA A;  4BA1 I;  2R7D A;  4HID A;  4A93 H;  2V1C C;  1N33 Q;  1YNX A;  1MJC A;  4DV7 Q;  1HNX L;  3GTM H;  3ULP A;  5FLM G;  4L5T A;  4YCU A;  2K52 A;  4JI8 Q;  3L2P A;  4B3M L;  4JI0 L;  4J15 A;  4GS3 A;  1VQH A;  5ELO A;  5M5W H;  1KAW A;  2JA5 G;  1H95 A;  1AE3 A;  5EAY A;  4ME3 A;  5IYD H;  1BKB A;  3G6E A;  4A3G H;  4DPG A;  3KJP A;  1VQ9 A;  2NZO A;  3FP9 A;  2OCE A;  2R93 G;  1N34 Q;  3CME A;  2CKZ B;  1L0W A;  4B3S L;  3M3Y H;  1WCM H;  5IYB H;  1VQD A;  4IJH A;  4HIO A;  2VY3 A;  4YWK A;  3KF8 B;  3U4Z A;  5IWA L;  2ZM6 Q;  2ZTD A;  2XGT A;  2UU9 L;  4DR5 Q;  3GTK H;  1Q81 C;  3NBH B;  4PZ8 A;  3TS0 A;  1IBL L;  3J7Z C;  1QVC A;  2LXK A;  5HY6 A;  4X65 Q;  3HFZ B;  5C3E G;  1VQC A;  4R4I A;  2MQH A;  1XPR A;  2E5L Q;  1IBM Q;  3CC2 A;  3M4O H;  2N3S A;  4BY1 G;  3RLO A;  1N9W A;  2Y0S E;  1L1O B;  2OQK A;  4GKK Q;  4LFA Q;  4DV0 L;  1LM0 A;  4JI2 Q;  3GTG H;  3W1G A;  2NVT H;  1UWV A;  4QGU A;  1QZG A;  3S2H H;  1A63 A;  2JJQ A;  4X64 L;  4DR4 L;  1NMF A;  1X54 A;  4JBJ A;  4BY1 H;  1OXU A;  1WJJ A;  3D31 A;  1ASZ A;  4B3S Q;  1E1T A;  1IZ6 A;  4YY3 Q;  1VS0 A;  4B3R Q;  3CCV A;  3I2Z A;  1QZH A;  4DR2 Q;  4JI4 Q;  4JBK A;  3E0E A;  2Y0S G;  2PMZ E;  2R93 H;  4UY8 C;  4GNX A;  1KD1 C;  1U5K A;  1IBL Q;  4GN5 A;  4A3C G;  1UE1 A;  4DUZ L;  4DR1 L;  3CW2 C;  2R92 H;  4JI6 Q;  4JI5 L;  1WI5 A;  3T1H L;  1KL9 A;  1Y1V H;  2JA9 A;  4YCW A;  4LF4 Q;  3PO3 H;  1C9O A;  2YYZ A;  4LF6 L;  4JI4 L;  4JV5 Q;  4P72 A;  5IYD G;  4DR3 L;  1G51 A;  4JOI C;  1T9H A;  5LMN W;  5JEA J;  3MEF A;  4A76 A;  5C0X G;  3UE1 A;  2MO0 A;  4DK3 C;  5C0X I;  1X55 A;  4DV5 Q;  4OX9 L;  1UE6 A;  1GM5 A;  4L5S A;  4AYB E;  3ICE A;  1UE5 A;  2I5H A;  5IT9 c;  3GTO H;  4HJ7 A;  2K50 A;  5GAE C;  3DM3 A;  4DR3 Q;  3SGI A;  4A4I A;  2UXB L;  2KHJ A;  4JI1 L;  3CCE A;  1JJC B;  1BBW A;  3AQQ A;  2OQ0 A;  4IPC A;  4X65 L;  4A3C H;  4IJL A;  1XNR Q;  1BBU A;  5IP7 G;  4LFB L;  4JOI A;  3J81 i;  4K0K L;  1B70 B;  4GOP B;  3PF5 A;  4XTC S;  4HJ9 A;  4X66 Q;  2VQE L;  4DV0 Q;  4LFA L;  2WB1 G;  1TWH H;  1HR0 L;  4IFD I;  4R4O A;  2Q2U A;  5C4X H;  3A74 A;  2MFI A;  5IYC G;  4BXX G;  4IFD G;  4R4C A;  3HOV G;  1X9N A;  2A1A A;  2F3I A;  2BH2 A;  3HOZ H;  1GKH A;  4GKJ Q;  4IOA A;  3K7A H;  3F2D A;  3S14 H;  1HZB A;  3KDF B;  5H1S E;  4B3T Q;  3HOW H;  5C44 H;  1SR3 A;  2XTI A;  2VQF Q;  2E2J H;  2KCM A;  1SE8 A;  4A3F G;  4LNQ A;  4GN3 B;  4NXN L;  4O0A A;  4UP9 A;  4NXM Q;  2JE6 I;  1KXL A;  1Q82 C;  5FLX c;  4AH6 A;  3KF6 A;  1LTL A;  1X3G A;  2YTY A;  1X6O A;  3KYH C;  2UU9 Q;  5JJK A;  2I5M X;  4QIW E;  1VQP A;  1N32 L;  4C2M H;  4A3G G;  3PF4 A;  3OTO Q;  1IBK L;  4DR7 L;  1E7Z A;  2IHE A;  2PQA B;  1I94 Q;  2UUB Q;  3AFQ A;  4HJ5 A;  3PUY A;  3TRZ A;  1PHJ A;  3GD7 A;  3I55 A;  3OYY A;  4OX9 Q;  5GQO A;  5HGQ A;  2AWN A;  5JEA G;  4YHH Q;  4JI2 L;  2K14 A;  3CCJ A;  4BBR H;  4NXN Q;  1IXR A;  2VL6 A;  4A93 G;  1C0A A;  2PQA A;  1EIY B;  1VQ6 A;  2PI2 E;  3H0G G;  1EYG A;  1V1Q A;  4DKA C;  1CKO A;  1SMX A;  4JI3 Q;  5LMN L;  2RHQ B;  3CMA A;  1I50 H;  1X3E A;  4DV2 L;  4JI6 L;  2IHF A;  4LFC Q;  4R4T A;  3FKI H;  1YHQ A;  2ES2 A;  4UPA A;  1HZA A;  3K7U C;  3RLN A;  4IPD A;  4OXP A;  4XIG S;  1PH5 A;  1I94 L;  4LF9 Q;  3S1Q H;  1WOC A;  2K5V A;  3HKZ G;  1OXT A;  5IYC H;  2IT1 A;  2Z6K A;  4BXX H;  1PFS A;  2QGQ A;  3T1Y L;  4P71 A;  2VS1 A;  1GD7 A;  4A3K G;  3CP0 A;  2ZM6 L;  4B3T L;  4DV5 L;  1JT8 A;  3ERS X;  3BZK A;  2HQL A;  3CPF A;  2BH8 A;  5M3F H;  2UXB Q;  2LSS A;  2IX1 A;  4YY3 L;  5ELN A;  3UDX A;  2HHH Q;  2K4K A;  4A3M G;  4A3I H;  2ZTE A;  3F2C A;  4LF8 Q;  1WCM G;  2OTJ A;  2UXD L;  3T1Y Q;  2R6G A;  2ASB A;  4LFB Q;  2R7F A;  3MXN B;  4IOC A;  3CCS A;  1EIF A;  1I3Q H;  4LF6 Q;  2YTX A;  3E9I A;  4BBS G;  5JJI A;  3I4N G;  1OXS C;  4JG2 A;  3RR5 A;  3PCO B;  4A3L H;  2A19 A;  4IPG A;  1XMQ Q;  2BA1 A;  2PI2 A;  5C0X J;  2K5H A;  1PV4 A;  1B7Y B;  3CQZ H;  3G48 A;  4GKK L;  2F4V Q;  1R9T H;  2YTV A;  3K81 C;  2CFM A;  3GO5 A;  3S2D H;  3KLW A;  4TQU S;  3F2B A;  1VQL A;  5AJ3 L;  3M4Q A;  2N78 A;  4UP7 A;  3KDF A;  4GOP A;  3OW2 A;  1NMG A;  2WAQ G;  2L15 A;  4A3I G;  1VQN A;  1QVG A;  2EQS A;  1B8A A;  1FJG Q;  3A5U A;  1D7Q A;  3RZD H;  3NEL A;  2ZJP A;  4X62 L;  5C44 G;  2N8N A;  1YIJ A;  2VUM H;  4PMW A;  3PV0 A;  1OXV A;  2F4V L;  3I7F A;  3W1B A;  2ZTC A;  2ALY B;  3F8T A;  4C3J H;  4OWW B;  3KFU A;  1Q12 A;  1YHA A;  2DUD A;  2WAQ E;  1LUZ A;  1YJW A;  1K3R A;  4JBW A;  5M3M G;  5BR8 L;  3CAM A;  1HR0 W;  4Y52 H;  3Q8D A;  5IP9 H;  2B63 H;  3FKI G;  4LW1 A;  4YWL A;  3PO2 H;  1Q1B A;  3JAM c;  2GVA A;  3ZJY C;  1K9M C;  3E9H A;  3M4P A;  4DV4 L;  4JI7 Q;  2UXD Q;  1PYB A;  4DR6 L;  3HOX H;  1Z47 A;  3RLF A;  3GTQ H;  4NXM L;  1UEB A;  1CKN B;  4LUZ A;  3J7A 5;  1JMC A;  3HOU G;  4MZ9 A;  1JJ2 A;  3G71 A;  3CCR A;  1SN8 A;  3PIO A;  2RHS B;  1VQA A;  4OWT B;  3UDF A;  5M5X H;  4BBS H;  3I56 A;  2VQE Q;  5DLQ E;  4C3I H;  1DGS A;  4A3L G;  1W3S A;  1E3P A;  4L5Q A;  4LUV A;  1BVS A;  3M85 A;  2WB1 E;  4GLV B;  4JI7 L;  5AJ3 Q;  1K83 H;  4YCV A;  2I0Q A;  4DV1 Q;  1M1K C;  4LF5 L;  1K0R A;  1J5E Q;  4JYA L;  4DR7 Q;  3AFP A;  3J81 c;  3BZC A;  4A3B H;  3NEM A;  4DAM A;  1Q46 A;  2JA8 G;  3PUZ A;  3S16 H;  4A3D H;  4ALP A;  2NVY H;  3RN5 A;  3KOJ A;  1IYJ B;  1Q8K A;  1VQB A;  3CC7 A;  4HIK A;  2R7Z H;  4DV2 Q;  1PA6 A;  1I6H H;  4A3E H;  2UUA Q;  1Y14 B;  4FDB A;  4UP8 A;  1P16 A;  4JI3 L;  4DV6 L;  2OTL A;  1OXX K;  4MNO A;  1A8V A;  3HOY G;  3NEN A;  2UXC Q;  2D0P A;  2Q2I A;  3GTJ H;  4AIM A;  4GN4 B;  2ZJR A;  3S1N H;  2A8V A;  1X65 A;  2RCN A;  3RZO H;  3D0F A;  2IY5 B;  2OWO A;  2JK8 A;  4APV A;  1XPU A;  1NE3 A;  1TWF H;  3CXC A;  3S24 A;  4GNX B;  5C4X G;  1NY4 A;  4P75 A;  4EQ5 A;  2UUB L;  1XTD A;  4POG A;  1GO3 E;  3EIV A;  2UXC L;  1L1O C;  1HZC A;  1I5F A;  3UE0 A;  3WWV A;  3IRB A;  3OTO L;  4A3B G;  2GVB A;  1HR0 Q;  1HH2 P;  2QEX A;  3TEH B;  1KQS A;  4L5R C;  4PZ6 A;  2JA6 H;  1N32 Q;  1HNZ L;  1CSP A;  1FVI A;  1SRU A;  2LXJ A;  1SRO A;  3UDI A;  1C7Y A;  1Q7Y C;  4GOP C;  1E24 A;  3W5O A;  4GKJ L;  1XMO L;  1O7I A;  1VQE A;  1KHI A;  1N36 Q;  1PH1 A;  2JA5 H;  1E1O A;  1NTG A;  5LMU L;  2Q2H A;  2YU9 H;  2MO1 A;  3UDG A;  1PH3 A;  3I4N H;  3U50 C;  2Z0S A;  4DV1 L;  3ULL A;  2PNH A;  4LF5 Q;  4KHP L;  1SLJ A;  4DR5 L;  4LF8 L;  3J80 i;  1Y1V G;  1HNZ Q;  3CCQ A;  3A5Z B;  3G4S A;  2WP8 J;  4JI8 L;  1MJE A;  1PH4 A;  1X56 A;  3LGJ A;  2E8G A;  3GTL H;  1HNX Q;  2VW9 A;  1G6P A;  3U58 A;  4LF7 Q;  5FJ8 H;  3VDY A;  5BR8 Q;  4GNX C;  3CCL A;  3M9B A;  4P73 A;  1PH9 A;  4X66 L;  2NN6 G;  3STB D;  4NPS A;  2QA4 A;  2NN6 I; 
#chains in the Genus database with same CATH topology
 1SE2 A;  2HDM A;  4J8Q A;  1ASY A;  2HD3 A;  1DOM A;  1LTT D;  4KI0 A;  5IGF A;  4KLK A;  2K01 A;  3HOZ G;  4LUO A;  1KRT A;  1IL2 A;  2UUC L;  5M5Y H;  1EYA A;  1YVC A;  3TP8 A;  3CKI B;  3F2U A;  1JB3 A;  3S14 B;  5ELD A;  2Q2T A;  3VYT A;  1QUQ A;  1B3Q A;  3GDE A;  5IY0 A;  2JN4 A;  2PNR C;  3RN2 A;  3I4M B;  2AHO B;  1UE7 A;  4AQY L;  1BQQ T;  1A2U A;  2NUC A;  1TXY A;  4BY1 B;  1R4Q B;  4KK7 A;  4RG1 A;  4WJ4 A;  3I4O A;  4YWM A;  2CCZ A;  1KRS A;  3N6R A;  5IE8 A;  1HZ9 A;  5LL6 X;  3SDZ A;  4PV1 C;  1R9T B;  4PG3 A;  3R8B A;  3VYU A;  4K8J A;  3ER0 A;  2I5L X;  3DHQ A;  3ZYY X;  4MN3 A;  1PH2 A;  1CK1 A;  5F2D A;  3GTQ B;  1FYC A;  3HOX G;  3K5M A;  1GUG A;  1STH A;  2NBF A;  4PMB A;  4AQY Q;  5FO8 B;  4LF7 L;  3RNU A;  1Y1W G;  3RZD B;  4GLA C;  2K03 A;  2VQF L;  3A7A B;  4C3I B;  3S17 H;  4A3F H;  1K73 C;  1PH8 A;  3GTG B;  2J7Z A;  1MKH A;  3CRK C;  3FKI B;  2RF4 A;  3S1Q B;  1EYD A;  4DAY A;  3HOW G;  2A6E C;  3HOV H;  4OO1 G;  3BDO A;  2F0F A;  3KJO A;  4DXG A;  2IP6 A;  4IUP A;  2NVX H;  5GAH C;  3B6Y A;  1W6K A;  3J7Y W;  1AW7 A;  3S1M H;  1IKM A;  4WJW A;  5BN4 A;  5M3F B;  1EWH A;  1FNV A;  4PZ7 A;  4LF4 L;  3H0G H;  2L9H A;  1XNQ Q;  5DEH A;  4OEL B;  1TWC H;  1C8C A;  4KKU A;  2XWB B;  4ZRZ A;  2QKI C;  5GRO A;  2HQE A;  2NVQ H;  2CQO A;  4IZ8 A;  2CH4 W;  2KHI A;  2UUA L;  4DV3 Q;  2HIX A;  1J6Q A;  1SNO A;  1PMR A;  1FR3 A;  3HEJ A;  2F0E A;  4O2D A;  3HOU H;  4IO9 A;  1S72 A;  4XDX A;  1L1O A;  1E22 A;  5J1Z A;  1Z9F A;  2K33 A;  4MIU A;  1AN8 A;  3CCM A;  4XYO A;  1SE4 A;  1H9K A;  5IP9 G;  1A0I A;  1O78 A;  1STB A;  3TS2 A;  1V1P B;  5LMN Q;  1S40 A;  2QIL A;  2VUM B;  4YZ9 A;  2QDL A;  3BJU A;  2I46 A;  2E5L L;  5JPM C;  1MHW C;  1XMO Q;  1N36 L;  1DM0 B;  1XPO A;  5C6A A;  3J81 j;  1IYU A;  2DJF C;  4R4Q A;  2KEC A;  3PIO 3;  3K59 A;  1SFO H;  3MXU A;  1W2B A;  1DYQ A;  1X32 A;  2EIF A;  4QJF A;  2EZV A;  1IBK Q;  4YIJ A;  2R7Z G;  1YNJ C;  2V6E A;  2TMP A;  1G29 1;  1VQ7 A;  2FU2 A;  2K32 A;  4A93 H;  1BO0 A;  3GQB A;  1MJC A;  2BOS A;  4B3M L;  4JI0 L;  4J15 A;  4FO2 A;  5ELO A;  1H95 A;  1KAW A;  1ICW A;  5IYD H;  3DEO A;  3NTK A;  3E5S A;  2K5D A;  2ZW3 A;  4OIK A;  3LJ2 A;  4A3G H;  4DPG A;  1NCV A;  1I3Q B;  4RH6 A;  2NZO A;  3OW7 A;  2R93 G;  3CME A;  2CKZ B;  1L0W A;  2FUG 1;  3MXN A;  2KKM A;  1VQD A;  4KY6 A;  1X3P A;  5IWA L;  2EJM A;  2XGT A;  4PZ8 A;  4QUF A;  1QVC A;  4C3J G;  4X65 Q;  1XPR A;  4XT3 B;  3SK4 A;  3LWU A;  2OQK A;  4GKK Q;  1QB5 D;  2XTR A;  2F66 B;  2Z1C A;  3OPO A;  3GTG H;  2SEB D;  4AS3 A;  3S1N B;  1MD2 D;  4DR4 L;  4BY1 H;  1OXU A;  4LMQ D;  1CQF A;  1YNN D;  2A2C A;  4B3R Q;  1BCP D;  4JI4 Q;  4JBK A;  5JAV A;  2JA6 B;  1Y69 U;  4GN5 A;  3BS1 A;  4A3C G;  4DR1 L;  4DU9 A;  4JI5 L;  1JR0 D;  2EXZ A;  1NSN S;  3PO3 H;  2NB0 A;  2YYZ A;  3CQZ B;  4LF6 L;  5CV8 A;  1CHQ D;  4JV5 Q;  4P72 A;  2OXP A;  2RDF A;  3NPP A;  3KLS X;  1JOO A;  1T9H A;  5JEA J;  4AS2 A;  2ENB A;  2MO0 A;  5C0X I;  1X55 A;  1GM5 A;  3ICE A;  1UE5 A;  5IT9 c;  5GAE C;  4DR3 Q;  2KHJ A;  4RHS A;  3DXJ C;  4JI1 L;  3AQQ A;  1XNR Q;  3SDJ A;  5IP7 G;  4KJN A;  5I6Y A;  4HJ9 A;  4MHE A;  5KEE A;  4A3K B;  3S1M B;  2E74 C;  1HR0 L;  1RDP D;  3A74 A;  4ZYS A;  4R4C A;  1NR4 A;  3K7A H;  3KDF B;  3T51 B;  5IIF A;  5C44 H;  2ZT9 C;  2XTI A;  2E2J H;  4PL3 A;  2B8F A;  1SEB D;  3GTP B;  4JPB W;  1K28 A;  1SBB B;  1KXL A;  5FLX c;  3K5L A;  3FEW X;  1U4R A;  1TWF B;  5JJK A;  2Z9H A;  3S1R B;  1VQP A;  2RLD A;  3PO3 B;  1B3A A;  4A3G G;  3OTO Q;  4C3H B;  1S5C D;  3PUY A;  1PLF A;  1JWS D;  4XYQ A;  2EYJ A;  5M9O A;  1F2L A;  4YHH Q;  4Z7H A;  2MPM A;  4CKC A;  4DKA C;  1HRJ A;  4WFN 3;  3VR5 A;  2RHQ B;  4DV2 L;  4JI6 L;  3DA4 A;  2KJX A;  4R4T A;  1YHQ A;  1SMY C;  3RLN A;  3K7U C;  1PFB A;  1M8A A;  4ZKB B;  1YO7 A;  2EYF A;  1A3U A;  4IFD H;  2HGK A;  3GP7 A;  1WVL A;  1GD7 A;  3QOL A;  1JT8 A;  3BZK A;  3CPF A;  2BH8 A;  3NP8 A;  2M9V A;  5ELN A;  5KNC A;  1HUM A;  1HA5 A;  1AEX A;  3I4N B;  2IWH A;  3T1Y Q;  2ASB A;  5I9O A;  4AYB B;  4IOC A;  1EIF A;  1S5E D;  2YTX A;  3P20 A;  1XXG A;  4U68 A;  1Y8N B;  1RTN A;  2QF7 A;  3I4N G;  4BBS G;  2KED A;  1KNA A;  1STG A;  4JG2 A;  3RR5 A;  4A3L H;  1DON A;  1GUO A;  3M3Y B;  2PCF B;  3KP9 A;  2BA1 A;  2RSO A;  5E4X A;  4P2C B;  3G48 A;  3V05 A;  2YTV A;  3GO5 A;  3S2D H;  2MP1 A;  2F0O A;  1KLU D;  2E2H B;  2N78 A;  4HSP A;  2RKS A;  3C1F A;  1NMG A;  2WAQ G;  2F0H A;  1ILQ A;  1A6X A;  2G9H D;  3IKJ A;  3BDC A;  5CYU A;  3D4D A;  2ZJP A;  5C44 G;  1BOS A;  2EJG C;  3PV0 A;  2F4V L;  2L5T A;  4RFB A;  1XWE A;  5FK9 C;  2PQE A;  2ALY B;  4V19 0;  3RZO B;  3KFU A;  2DUD A;  2WAQ E;  1YJW A;  1K3R A;  5M3M G;  1F9S A;  4N9T A;  3CAM A;  5C4X B;  4F87 A;  3ITP A;  5EJW A;  3ZJY C;  4JI7 Q;  3E9H A;  2UXD Q;  1Y8P B;  2BL7 A;  3E3X A;  1HXY D;  4DNR B;  1PZK D;  3C1E A;  2Q8I B;  4CJ0 B;  1LO5 D;  3J7A 5;  1JMC A;  3MVV A;  2JXM B;  2ETD A;  2CVR A;  4ME5 A;  4OWT B;  4DNT B;  1ET9 A;  3K58 A;  1W3S A;  1E3P A;  4JI7 L;  2I0Q A;  4LAA A;  4LF5 L;  1KDC A;  1K0R A;  1J5E Q;  2F3V A;  3EVQ A;  2FFK B;  4A3D H;  3PUZ A;  3BG3 A;  3KOJ A;  1IYJ B;  1VQB A;  4HIK A;  1PA6 A;  5CV5 A;  1WTR A;  4RHR A;  3ERO A;  4JI3 L;  3EFX D;  5KGU A;  1A8V A;  3AU7 A;  2F0P A;  2F0I A;  3GTJ H;  2A69 C;  1VDZ A;  4OL7 A;  4AIM A;  4GN4 B;  2ZJR A;  2A8V A;  1X65 A;  2NVT B;  2OWO A;  4Z7G A;  2RIO A;  1NE3 A;  1SYG A;  4FXK C;  2UUB L;  2B63 B;  3FVQ A;  3EIV A;  3WWV A;  4A3B G;  2QEX A;  3HRZ C;  1KQS A;  5L37 A;  4R9W A;  1CSP A;  1FVI A;  2A74 C;  3A7L A;  1C7Y A;  4GOP C;  3W5O A;  1XMO L;  1CT1 D;  1N36 Q;  1Y1V B;  1RKN A;  2PZU A;  1RTO A;  3HZX A;  5LMU L;  1PH3 A;  1M4V A;  1BF4 A;  1Z7T A;  2B2Y A;  3ERQ A;  3IAM 1;  1DXM A;  3H94 A;  1PTO F;  4K2L A;  3A5Z B;  4K5V A;  1X56 A;  2F0G A;  4XQN A;  1HNX Q;  2B2W A;  1SJ8 A;  1Z6H A;  2XMX A;  5LL6 S;  5C3W A;  5D14 A;  2FIN B;  4P73 A;  4ZQ3 A;  4X66 L;  2NN6 G;  3B55 A;  4NPS A;  4RGO S;  2QA4 A;  3C2P A;  4X3K A;  2CHB D;  4ID6 A;  2GN5 A;  3FPP A;  5EPJ A;  2BE5 D;  4OEM B;  3GTJ B;  1EIH A;  3JSB A;  4JK1 C;  1VQF A;  1VCI A;  4BS9 A;  4YZC A;  2O5J C;  3P1H A;  4QUC A;  3DWA A;  5FOB B;  2MNA A;  2JQO A;  3K6O A;  4H02 A;  2CW0 C;  2LFN A;  3W3A A;  5C3E H;  3EBE A;  3S15 H;  4DAY B;  1CKM A;  3DEP A;  2JB1 A;  2EY2 A;  4GLX A;  2F0J A;  3CC4 A;  4LWC A;  4GXT A;  1K8G A;  4POF A;  2YU9 B;  3K57 A;  1TWG H;  4QIW B;  2LY7 A;  3JAM i;  4NKL A;  1MIU A;  5JJL A;  3PUV A;  4BY7 H;  4XQQ A;  1Q86 C;  1WCM B;  1ESF A;  3K5N A;  3U4V A;  5FLM H;  1KIX A;  4FNF A;  2X6G A;  1W6J A;  1STA A;  2SNS A;  3H3V C;  4PMC A;  3MFY A;  1HNW Q;  1J5E L;  4OGQ C;  1NBW A;  5JPN C;  1VQ5 A;  2HIV A;  2R92 G;  2CWP A;  1E2Z A;  5IGC A;  5K36 G;  3PO2 G;  1H9J A;  2F0K A;  1XMQ L;  1E2V A;  5HGI A;  2IW3 A;  2EVB A;  2B63 G;  1KLG D;  2D62 A;  3A54 A;  3ONA B;  3K8A A;  3TQY A;  2K05 A;  1XJV A;  1Q3L A;  1WTP A;  3WOF A;  2Z6B A;  2JA7 H;  1V43 A;  2NVY B;  1HHV A;  3PUW A;  4DR4 Q;  1H9R A;  2B29 A;  1NR2 A;  3KF6 B;  1EFW A;  4A3E G;  4ZLT F;  2HHH L;  1VQI A;  4B3R L;  1NJI C;  2WB1 B;  1JE5 A;  3EJI A;  2F0Q A;  4H13 C;  2AQ1 B;  1YI2 A;  4HMJ A;  3A0J A;  2K28 A;  1KNE A;  3BVM A;  5GAD C;  2XRS D;  1VQO A;  2YV5 A;  5IWA Q;  1OTC A;  2F0S A;  2E2J B;  1TWA B;  1IYV A;  4FF2 A;  1M90 C;  4JV5 L;  1D8L A;  3PGZ A;  1N33 L;  1AE2 A;  1I4X A;  1YEZ A;  2BDN A;  1VQ4 A;  2V4D A;  4A3B B;  2ZXO A;  1PH6 A;  1U4L A;  4IPH A;  4X64 Q;  5JVH 3;  4DV4 Q;  1PTO B;  2JA5 B;  1WYD A;  3ULJ A;  4B3M Q;  4CJ1 B;  1G8Z D;  1X3F A;  4Z9C B;  2VB3 X;  1MBY A;  3V96 A;  3EN2 A;  3GTK B;  1WTH A;  2F6M B;  1L0Y B;  1PXU A;  5JOB A;  2AKW B;  4IFD J;  4FYD A;  2EXD A;  4ABN A;  1VQG A;  3GV3 A;  1EQR A;  1FL0 A;  1Q1E A;  5KIX A;  4M1U B;  4QQB X;  1QVF A;  2JEA I;  1A3T A;  2ZJQ A;  5G3L F;  2F52 A;  4FP5 D;  1WTO A;  1S3O A;  4DUZ Q;  1TWA H;  3UI2 A;  3OIQ A;  1JOQ A;  1GHK A;  2R7D A;  5CBE E;  2DNC A;  4DV7 Q;  1HNX L;  3R2T A;  5K5P A;  5FLM G;  5C0X H;  2K52 A;  3L2P A;  2ZXP A;  4UAI A;  5M5X B;  2QEJ C;  1I4Q A;  1VQH A;  5M5W H;  4C3H G;  1AE3 A;  5EAY A;  1WTW A;  4HMI A;  1VQ9 A;  2EYM A;  2QSB A;  3FMC A;  3G7L A;  5DM6 3;  1N34 Q;  4B3S L;  2VY3 A;  3KF8 B;  2ZTD A;  3GTK H;  1QCB D;  1IBL L;  3TZD A;  5C3E G;  2F3W A;  2MQH A;  2E5L Q;  1O7Y A;  4BY1 G;  1N9W A;  2Y0S E;  4WOR A;  4OO1 H;  2F0N A;  4DFA A;  4KV6 A;  4PL5 A;  4DV0 L;  3HS0 C;  4ZKC B;  1UWV A;  3S2H H;  5E4W C;  4X64 L;  1NMF A;  2A6E D;  4RWS C;  3SR1 A;  1IZ6 A;  4YY3 Q;  1VS0 A;  3SK5 A;  2Z4H A;  2Y0S G;  1DD2 A;  2PMZ E;  4UY8 C;  3OSO A;  5A2Q E;  1QWY A;  2WII B;  2MUY A;  3T1H L;  4YCW A;  2JA9 A;  4B9X A;  1LT5 D;  1BUV T;  4HR7 B;  4FF4 A;  4JI4 L;  4DR3 L;  2PZT A;  1QNU A;  4JVZ A;  4JOI C;  1VMP A;  1IL8 A;  3IAS 1;  3MEF A;  3NTI A;  4L6T B;  2IL8 A;  4DK3 C;  4G7Z C;  4OX9 L;  1UE6 A;  4GZY C;  4L5S A;  2I5H A;  4RKL A;  3CCE A;  2OQ0 A;  2YFB A;  4X65 L;  1TQO A;  4A3C H;  1GOZ A;  1O7Z A;  1F2Z A;  1MSG A;  4XTC S;  1PZI D;  2WB1 G;  1F77 A;  1F2M A;  4CDC C;  2JSO A;  3I72 A;  3HOV G;  3KK7 A;  1X9N A;  1PRT D;  2M00 A;  5A35 A;  4GKJ Q;  1ZYR C;  3F2D A;  5H1S E;  3HOW H;  2VQF Q;  5K36 H;  3LJ0 A;  1TII D;  2H1E A;  2KCM A;  2L12 A;  4JW0 A;  4LNQ A;  1A15 A;  3SK6 A;  4HFV A;  3T56 B;  4NXM Q;  2JE6 I;  1Q82 C;  2KOL A;  1X3G A;  2JA8 B;  3KYH C;  3CRL C;  5FLX L;  1DZ1 A;  1SYE A;  3A55 A;  1IBK L;  4DR7 L;  3AFQ A;  4DAV A;  3TRZ A;  1PHJ A;  3GD7 A;  4I7A A;  1ENC A;  5GQO A;  5HGQ A;  4B9W A;  2ICI A;  2BL8 A;  3PMF A;  3CCJ A;  5DNF A;  4NXN Q;  1IXR A;  1EY8 A;  4DN4 M;  1EIY B;  1KAA A;  1CKO A;  3H91 A;  4CDE C;  4A3F B;  5LMN L;  1VF5 C;  1X3E A;  3VYR A;  4LFC Q;  1G2S A;  3FKI H;  2X69 A;  2ES2 A;  4UPA A;  1HZA A;  4IPD A;  4XIG S;  3S1Q H;  4K8I A;  2K5V A;  4RCO A;  2Z6K A;  4U6R A;  1PFS A;  3T1Y L;  4P71 A;  2VS1 A;  4DV5 L;  2B2T C;  3MWY W;  2A5H A;  4ZCK A;  3E6Z X;  5M3F H;  2UXB Q;  3VA7 A;  2IX1 A;  4O1O A;  4YY3 L;  1STY A;  2ZTE A;  1BR9 A;  1B4O A;  3J80 E;  3QOJ A;  4CDF C;  3QIA A;  1SAP A;  1ET6 A;  3F4M A;  2JBW A;  2F0W A;  3E9I A;  4PNY A;  4PL4 A;  4IN3 A;  1OXS C;  3PCO B;  1FGB D;  2RDG A;  3NBH A;  4IPG A;  1QJO A;  2PI2 A;  5C0X J;  2K5H A;  1PV4 A;  1B7Y B;  1HQR D;  1K83 B;  3VR3 A;  1Q8I A;  5G3L D;  2F0M A;  1TY0 A;  1SND A;  4BY7 B;  4K2K A;  4TQU S;  3M4O B;  2L11 A;  1I4R A;  4A3I G;  4HCS A;  2L15 A;  1GUT A;  3HG9 A;  1EZ8 A;  1SNC A;  1B8A A;  3A5U A;  1KTK A;  3JAM E;  3RZD H;  3NEL A;  4X62 L;  2VUM H;  2B39 A;  2MJ8 A;  1OXV A;  2B2W C;  1EY7 A;  5CC4 A;  2ZTC A;  1EY5 A;  4N8X 1;  1S5F D;  3I9V 1;  5J22 A;  4IUQ A;  4C3J H;  4G76 A;  4OWW B;  1KAB A;  1YHA A;  1LUZ A;  4KY5 A;  1ML0 D;  4JBW A;  4Y52 H;  1HCZ A;  1TY2 A;  5TSS A;  2B63 H;  3FKI G;  4Y7N B;  4A3I B;  2NVX B;  2EY1 A;  3JAM c;  3A56 A;  3M4P A;  4DV4 L;  1D1K A;  2EY6 A;  3D6W A;  3KF8 A;  3DM1 A;  3HOX H;  3R93 A;  2CQA A;  5C4J B;  3GTQ H;  4NXM L;  1ILP A;  1CKN B;  3NWT A;  2K1B A;  5E3F A;  1JJ2 A;  1SN8 A;  1GHJ A;  5M5X H;  4BBS H;  3I56 A;  4C3I H;  4A3L G;  1F9Q A;  2WB1 E;  4GLV B;  1L0X B;  4YCV A;  1RD9 D;  4DV1 Q;  1M1K C;  2B8G A;  3NXW A;  2L1B A;  2O4X A;  4RGN A;  3S16 H;  2MGS A;  2R7Z H;  4O1N A;  1Q8K A;  3BVZ A;  3CC7 A;  1PTO D;  2JB2 A;  1XYI A;  2YFA A;  4TSS A;  1EY6 A;  1OXX K;  2BDO A;  3HOY G;  2UXC Q;  2Q2I A;  2SNM A;  5M5Y B;  3RZO H;  2KQ3 A;  1RCV D;  2JK8 A;  4GNX B;  3CXC A;  3S24 A;  1NY4 A;  4P75 A;  4EQ5 A;  1XTD A;  2KVM A;  4POG A;  1UUP A;  1HZC A;  3S15 B;  1CM9 A;  3TEH B;  4L5R C;  4PZ6 A;  1N32 Q;  1IHZ A;  1SRU A;  1LV9 A;  3UDI A;  4GKJ L;  1VQE A;  4IUU A;  2WAC A;  4WRD A;  1PTO H;  5LHY 1;  2JA5 H;  3HOU B;  4RAU C;  1NTG A;  1ROD A;  3R2I A;  2SOB A;  3I4N H;  1S5B D;  4KD3 A;  2PNH A;  1ENA A;  4LF8 L;  4OIJ A;  2DN8 A;  1FD7 D;  1BBX C;  3D3R A;  3CCQ A;  1HNZ Q;  4MTK A;  2WKC A;  5IGD A;  1JWU D;  2VW9 A;  1S5D D;  3U58 A;  5FJ8 H;  5KRU A;  3VDY A;  1PTO C;  1PH9 A;  2KA7 A;  4XQJ A;  1A3V A;  3D4W A;  3X3M A;  4K0K Q;  4JI0 Q;  3I90 A;  1EEF D;  1LAB A;  4KHZ A;  4A3J B;  1TWH B;  2ATW A;  4A3K H;  4DR2 L;  1EIG A;  4PQX A;  1N34 L;  2B3G A;  4X62 Q;  1PYS B;  2D0O A;  2O2L D;  3L7Z C;  5FO9 B;  5I2X A;  1ZEQ X;  3HGB A;  2FHT A;  2H5X A;  4KN4 C;  3J80 c;  1DOL A;  2KCT A;  3IL8 A;  4ULL A;  4R8I A;  1EEI D;  2KEN A;  2NN6 H;  2ID0 A;  4DNI A;  2HT1 A;  2JA8 H;  1L2F A;  3J81 L;  4ZK9 B;  3S1R H;  4HJ8 A;  4DUY Q;  2NZ1 D;  4V0B A;  4DV7 L;  1EYC A;  4C3H H;  2A69 D;  4ZAI A;  2Z8L A;  1FJG L;  1QE6 A;  4HIM A;  2R92 B;  3PO3 G;  3CPW A;  2WV6 D;  1CI3 M;  3DMU A;  3CF5 A;  3I4M G;  2FXQ A;  1HTL D;  3NQT A;  2Z6K C;  4A3M H;  1SE3 A;  2RCF A;  3L3O C;  3T13 A;  1UAP A;  4JCV E;  4EX5 A;  1DOK A;  3K80 C;  1XNR L;  1B1Z A;  3LWE A;  2E2I H;  4X6A H;  4O42 A;  3JC6 6;  5LMU Q;  4JI1 Q;  2XVS A;  1JE4 A;  4OO1 I;  1QIL A;  3MC0 B;  3H3V H;  2QGM A;  3PO2 B;  5DM7 3;  1D2B A;  3J81 E;  4I7Z C;  1J8I A;  3I8Z A;  5EGT A;  3SEB A;  1EOV A;  4FVM A;  2XRQ D;  3PUX A;  1LT4 D;  1ZKO A;  3ND9 A;  4JI5 Q;  3CCU A;  1MGS A;  1VF7 A;  1AH9 A;  4CJ2 C;  4G7O C;  2K19 A;  2C35 B;  2E76 C;  2WKD A;  4NB3 A;  3URY A;  1TWG B;  4JC0 A;  1CUK A;  1N8R C;  1IBM L;  4LF9 L;  3FHW A;  4UHV A;  4BY7 G;  1EUJ A;  1HFN A;  2VZA A;  2RVL A;  1YJ9 A;  1YIT A;  1EFI D;  4KHP Q;  1RIP A;  3TRE A;  1EY9 A;  4CDD C;  3KLS A;  1JB7 A;  2WFW A;  3MXG A;  3S2D B;  3L0O A;  1SYB A;  4I1T A;  3AYH B;  4UDU C;  5E7N A;  4KTA A;  2JYO A;  1GUW A;  3HKS A;  1U4M A;  1BDO A;  1GUN A;  2CWA A;  3A8I E;  3KUP A;  2DY8 A;  4L8J A;  2D5D A;  1JQO A;  2JA7 G;  2VNU D;  1MSH A;  2KBN A;  4JBM A;  1GVP A;  2N49 A;  3HKZ E;  2L0C A;  2UUC Q;  1NNX A;  4HED A;  3P23 A;  1HNW L;  1KC8 C;  1I4G A;  1PVO A;  3H0G B;  1K0S A;  5JJZ A;  4RGM A;  5CGK A;  1P8L A;  1Y1W H;  4DK6 C;  3I4M H;  2NVQ B;  2V1C C;  1YNX A;  4IUN A;  3OIP A;  1U4P A;  2RA4 A;  3GTM H;  2PZW A;  1G91 A;  1O80 A;  4JI8 Q;  4N8F A;  4DGZ A;  4GS3 A;  4QF4 A;  5FKA C;  1QOH A;  2JB3 A;  4EQN A;  4ZUI A;  2A6H D;  3WDN A;  3FP9 A;  3K5O A;  1WCM H;  3S16 B;  1D5X C;  2XSC A;  2KCC A;  5IYB H;  4YWK A;  1B2T A;  2DNE A;  4IUR A;  3UIT A;  2UU9 L;  2QZG A;  4DR5 Q;  4K6L A;  2VXW A;  2RQX A;  5HY6 A;  3J7Z C;  3MAQ A;  4R4I A;  1EQT A;  3CC2 A;  1DCZ A;  1Y8O B;  2PMZ B;  4LFA Q;  1HA6 A;  1LM0 A;  3W1G A;  2NVT H;  1QZG A;  4NV5 A;  4QGU A;  1A63 A;  2JJQ A;  1X54 A;  4JBJ A;  1SJH D;  1CFM A;  1PFN A;  1NUC A;  3D31 A;  1H9S B;  1ASZ A;  3BYT B;  5T1G A;  1E1T A;  4B3S Q;  1TS3 A;  1SNQ A;  3CCV A;  3I2Z A;  1QZH A;  4DR2 Q;  3E0E A;  3BVG A;  1SYF A;  4L63 B;  3TDQ A;  1U5K A;  1UE1 A;  4DUZ L;  2R92 H;  1K8M A;  2PO4 A;  3NK9 A;  4H7B A;  1WI5 A;  1KL9 A;  1Y1V H;  4LF4 Q;  3FPU B;  1EZ6 A;  3BZD B;  1C9O A;  2JP1 A;  3NSW A;  5IYD G;  2DJG C;  1BNZ A;  1UEA B;  5LMN W;  1LTS D;  5C0X G;  3NUC A;  4J6H A;  3IFT A;  4DV5 Q;  4AYB E;  4DK1 A;  3MA2 B;  3JAM L;  2K50 A;  4F88 A;  4DWL A;  4HCE A;  3DM3 A;  4A4I A;  2UXB L;  1JJC B;  3RUZ A;  4IPC A;  1BBU A;  4LFB L;  4JOI A;  2K5W A;  3J81 i;  1LTG D;  3I4L A;  1B70 B;  4K0K L;  4TRD A;  2VQE L;  4LFA L;  1TWH H;  1G6Z A;  5C5L A;  4IFD I;  4R4O A;  3VA9 A;  3QO2 A;  5C4X H;  2Q2U A;  5IYC G;  2MFI A;  3FDT A;  4BXX G;  1K8O A;  1AP0 A;  1TVX A;  5CV6 A;  3NBI A;  1JIC A;  2BH2 A;  1GKH A;  1PYW D;  3FNB A;  3TP5 A;  4IOA A;  1HZB A;  2KCN A;  4B3T Q;  2H4O A;  1SR3 A;  1SE8 A;  4A3F G;  4GN3 B;  4NXN L;  2N55 A;  2EYP A;  3T53 B;  4F7X A;  5I2Y A;  3ND8 A;  5ISR A;  4AH6 A;  3KF6 A;  1LTL A;  2YTY A;  1X6O A;  3QJY A;  2I5M X;  1WTX A;  2P5Z X;  1STE A;  1N32 L;  2F0D A;  1T5E A;  3Q6S A;  3PF4 A;  5ELC A;  1E7Z A;  2IHE A;  1PZJ D;  1I94 Q;  2QCP X;  3I55 A;  3OYY A;  4OX9 Q;  2AWN A;  5JEA G;  1ESR A;  4ILW A;  2K14 A;  2B2T A;  1RJT A;  2VL6 A;  4A93 G;  1C0A A;  4IUV A;  3TP6 A;  3TME A;  1H9M A;  2A73 B;  2PI2 E;  3H0G G;  2BCO A;  1EYG A;  1BCP F;  1SMY D;  1V1Q A;  1SMX A;  3SHL A;  4KD4 A;  1TS2 A;  5D3I B;  3J7A F;  2IHF A;  3MEH A;  4A3G B;  4RA8 A;  2RAD A;  1F2Y A;  4F8M A;  4LF9 Q;  1I94 L;  3EA6 A;  1WOC A;  1ZYR D;  1ZXT A;  3HOV B;  3P7J A;  1IW7 C;  4B3T L;  3OMG A;  1EY4 A;  2ZRR A;  3DA3 A;  1C48 A;  2HQL A;  3VR2 A;  3IAY A;  2R3Z A;  5E1F A;  3Q0A A;  2K4K A;  3VR4 A;  4A3M G;  1JWM D;  4A3I H;  3GTM B;  3F2C A;  1EWC A;  4HN7 A;  1D5Z C;  3H6M A;  4OAU C;  4HAE A;  5JEA H;  4LFB Q;  1QNK A;  4G57 A;  3MXN B;  5I6W A;  5I9P A;  3CCS A;  3X3N A;  3SXH A;  3T16 A;  4K6D A;  5JJI A;  1CHP D;  4QCL A;  4XXE A;  2A19 A;  4IUT A;  2M2L A;  2O5I C;  1R9T H;  3I91 A;  3H09 A;  3K81 C;  3U9S A;  3F2B A;  2FMM A;  2AQ3 B;  5AJ3 L;  3VR6 A;  4UP7 A;  5KND A;  3HOY B;  3OW2 A;  1QVG A;  1FJG Q;  4FF3 A;  2QW7 A;  5M3M B;  2AQ2 B;  3FBV A;  1C4Q A;  1WTQ A;  2K04 A;  1Q12 A;  5EBD A;  1E2W A;  2Q8T A;  3FRP B;  1HR0 W;  2B2V A;  2G9D A;  5IP9 H;  4M8A A;  4YWL A;  2GVA A;  1V1P A;  5T1I A;  4DR6 L;  4HTH A;  2F0U A;  3AJF A;  1Z47 A;  3RLF A;  2F4I A;  1AZQ A;  1YNN C;  3E0J A;  3T4A C;  1SDF A;  4MZ9 A;  5JVG 3;  3HOU G;  3G71 A;  2RHS B;  1VQA A;  3UDF A;  4H0L C;  3LX0 A;  1DGS A;  5DAU A;  4LUV A;  3M85 A;  5AJ3 Q;  4IAL A;  1I4P A;  2KUM A;  1GJX A;  3MFG A;  4JYA L;  4G75 A;  4DR7 Q;  3M4Y A;  3J81 c;  2D2C C;  5ELB A;  4KN7 C;  3NEM A;  4K14 A;  2JA8 G;  3KBX A;  4ALP A;  1PDQ A;  3RN5 A;  1I6H H;  2EYH A;  1QG7 A;  3L9A X;  4A3E H;  4BBR B;  2UUA Q;  1P16 A;  2FJ2 A;  4DV6 L;  5IOC A;  3NEN A;  1I50 B;  2R61 A;  5J39 A;  3S1N H;  4RKB A;  2RCN A;  3D0F A;  3D8G A;  5CMD A;  1XPU A;  1TWF H;  4DK0 A;  5EKI A;  4LK1 C;  1GO3 E;  2UXC L;  1L1O C;  1I5F A;  3IRB A;  5C4Z A;  1TR5 A;  4OHJ A;  1VMC A;  3V2T A;  1HNZ L;  2SDF A;  2R93 B;  2LXJ A;  4DF7 A;  1SRO A;  1Q7Y C;  1E24 A;  1O7I A;  1KHI A;  2AUK A;  2KEE A;  5EPK A;  3SVM A;  2YU9 H;  1PFM A;  2HCC A;  4N9P A;  1D6E C;  4DV1 L;  4KHP L;  1HTP A;  1SLJ A;  2A68 C;  2L1L B;  2X6L A;  1LTI D;  3J80 i;  3FVV A;  3G4S A;  1A2T A;  4X3U A;  3WOE A;  1PH4 A;  1MJE A;  3LGJ A;  2E8G A;  2N88 A;  4LF7 Q;  5ELE A;  1SYC A;  4GNX C;  3CCL A;  3M9B A;  4KKT A;  5NUC A;  2NN6 I;  2Y0S B;  4A3E B;  2DY7 A;  2WIN B;  2G5D A;  3PIP A;  4KJO A;  2AMC B;  3NHH A;  2E2H H;  2A2D A;  3HOY H;  2Q8R E;  4QL5 A;  1PRT C;  3W2D A;  3K7A B;  4CBV A;  3G6J B;  4A3J G;  2NWG A;  1HJP A;  3BU2 A;  1VQJ A;  1SSO A;  3GTP H;  4BA2 I;  1CSQ A;  2NYZ D;  2F1M A;  3RMH A;  1QUQ B;  2JEB I;  4TVA B;  4HSV A;  2XWJ B;  2K75 A;  1YBY A;  5D65 A;  4MTN A;  3PQI A;  4DR6 Q;  2J4X A;  2OF1 A;  3TP7 A;  1PH7 A;  3MHB A;  4Y7N H;  4RMF A;  1LTA D;  1YZ6 A;  1V9P A;  4DV6 Q;  3T1H Q;  1VQK A;  4C3I G;  1EOT A;  1EU3 A;  1RL2 A;  4YHH L;  1B53 A;  1J9O A;  3N52 A;  4E6I A;  3J7A V;  1X3Q A;  4A75 A;  2NZH A;  3CD6 A;  3M7N A;  3D6C A;  4JYA Q;  1JQY D;  4DXF A;  5M3F G;  4DUY L;  4AYB G;  1FNU A;  2JA6 G;  4R1J A;  4A3J H;  3K0X A;  1E0B A;  4P74 A;  2AUJ D;  2GSC A;  3L0I A;  1LAC A;  3AB9 A;  1HQM C;  4QY7 A;  1A62 A;  1SJE D;  1I6H B;  2RBM A;  2K5N A;  3HKZ B;  1NAP A;  5C4J H;  1WFQ A;  2EDG A;  5IP7 H;  1K8A C;  3DLL A;  1LTB D;  1HUN A;  2B2Y C;  5A2Q L;  2PPB C;  3PSI A;  1VQ8 A;  4BBS B;  5IGE A;  3OWE B;  4BBR G;  1YHB A;  5C44 B;  5FJ8 G;  4NP5 A;  1JC7 A;  1YJN A;  3H15 A;  1VQM A;  3VA5 A;  5CBA E;  2EE1 A;  4K5W A;  4C1N I;  3NE5 B;  3KBG A;  2K7V A;  4LFC L;  2XNA C;  3AMU A;  2IJ0 A;  1XNQ L;  2IX0 A;  2CAZ B;  2B2U C;  5J3B A;  1EWI A;  4ZUJ A;  4R8N A;  2B2V C;  4S3S A;  1DJR D;  3OOC A;  4XT1 B;  1LT3 D;  2MJF B;  3STB C;  2BA0 A;  1EQQ A;  5EQ0 A;  4WJ3 M;  1JJG A;  4DV3 L;  1I4H A;  1F9R A;  1B9M A;  1FGU A;  2F0T A;  5IGB A;  2DGY A;  3QWN A;  4J1M A;  3R3O A;  1JOR A;  1XTC D;  4B08 A;  1SNP A;  5M3M H;  1AFP A;  2E2D C;  3OMC A;  1CKN A;  1D1I A;  1TS5 A;  4RCN A;  2F03 A;  1HFG A;  3H3V I;  4OWX B;  5GAG C;  2VUM G;  1LYL A;  4YZD A;  4CHT B;  5IYB G;  4A3D G;  5HGT A;  4OON A;  3F1Z A;  5CR3 A;  5EBC A;  5KYI A;  3D4R A;  4Q5V A;  3AEV A;  2F0L A;  1TWC B;  3HOX B;  4DR1 Q;  5C3E B;  1U0L A;  2AWO A;  1CZG A;  3A8J E;  2RDH A;  3P75 A;  4BA1 I;  4HID A;  4HJA A;  1N33 Q;  4FXD A;  2K5Q A;  3ULP A;  4L5T A;  4YCU A;  4CGY B;  1SYD A;  3Q24 A;  3IFD A;  2Z4I A;  1WD1 A;  2JA5 G;  1WD0 A;  1CZW A;  5CV7 A;  4ME3 A;  4DA2 A;  1FNW A;  1BKB A;  3G6E A;  4HEA 1;  3KJP A;  2BE5 C;  1RF2 D;  1AZP A;  3GTO B;  2OCE A;  1UNS A;  2CH4 A;  3M3Y H;  4A3D B;  4KMU C;  4IJH A;  4HIO A;  3U4Z A;  4BWG B;  2ZM6 Q;  2D9U A;  2XN9 C;  1Q90 A;  1Q81 C;  3NBH B;  5LNK 1;  3TS0 A;  3M7G A;  3O13 A;  2LXK A;  3HFZ B;  1VQC A;  1IBM Q;  4X3S A;  3M4O H;  2N3S A;  3RLO A;  1L1O B;  1H9S A;  5FO7 B;  1TU2 B;  4JI2 Q;  5BN5 A;  3PIP 3;  1IW7 D;  3BYY B;  3TBI B;  5BN3 A;  1WJJ A;  3Q23 A;  3A8K E;  3OWF A;  4C56 C;  3DWP A;  1KDB A;  2R93 H;  3DUZ A;  4GNX A;  1KD1 C;  1IBL Q;  3NTH A;  1B9N A;  2FEF A;  3CW2 C;  3NWS A;  5KNB A;  4JI6 Q;  1Y1W B;  2NTS A;  1EY0 A;  4A93 B;  4C1N K;  4O1P A;  3I73 A;  2JAE A;  1G51 A;  3OHX C;  5IT9 E;  4A3M B;  1HPC A;  4A76 A;  1WTV A;  3UE1 A;  4RGT A;  5ELF A;  1D5M C;  3GTO H;  4HJ7 A;  3GTL B;  3SGI A;  3SE0 A;  1BBW A;  1R4P B;  3CHB D;  1O7L A;  4LJZ C;  4IJL A;  4KHV A;  4I65 A;  2RSN A;  4KKS A;  4GOP B;  3PF5 A;  5IGG A;  4NDX A;  2PYK A;  4X66 Q;  4C3J B;  4DV0 Q;  2MHV A;  1TKW B;  1PRT F;  5CV4 A;  2L55 A;  4IFD G;  3QB3 A;  2A1A A;  2F3I A;  3HOZ H;  3S14 H;  3LNN A;  5FLX E;  4EQP A;  2IX3 A;  1CA6 A;  3MXP A;  3DO9 A;  4O0A A;  4UP9 A;  3RD4 A;  1YNJ D;  4CKE A;  2UU9 Q;  1XX8 A;  3GV6 A;  4QIW E;  2PW7 A;  3MTS A;  1BXT A;  4C2M H;  2PQA B;  2OT2 A;  5C3X A;  2UUB Q;  4HJ5 A;  4U67 3;  4EGV A;  2HUG A;  3DWQ A;  4JI2 L;  1B50 A;  4Q0F A;  1ICF B;  4BBR H;  5AFW A;  2PQA A;  1VQ6 A;  2EYL A;  3Q22 A;  4NV2 A;  3SK8 A;  3S17 B;  4JI3 Q;  5M5W B;  3CMA A;  4CKB A;  1I50 H;  2PW5 A;  3BDL A;  3QG1 A;  3I70 A;  4X3T A;  3NQI A;  1BCP C;  5CV9 A;  1SFO B;  4OXP A;  1PH5 A;  2E2I B;  1TT2 A;  3HKZ G;  2LS0 1;  2EJF C;  1OXT A;  1EU4 A;  5IYC H;  2IT1 A;  4ODG A;  2GA4 B;  4FF1 A;  4BXX H;  2QGQ A;  4A3K G;  3CP0 A;  2ZM6 L;  1KDA A;  3ERS X;  2EOT A;  3I3C A;  3U9O A;  3CU7 A;  3TN2 A;  1G2T A;  1V1O A;  2LSS A;  3UDX A;  2HHH Q;  3EQL C;  3MZ5 A;  4IQZ A;  1U9R A;  1TS4 A;  4LF8 Q;  1WCM G;  2OTJ A;  2UXD L;  2EYO A;  2R6G A;  2B2U A;  5IOD A;  1MI2 A;  2A6H C;  2R7F A;  1LLR D;  2F0V A;  1K3B C;  2CW0 D;  5I4D A;  1I3Q H;  4LF6 Q;  4KY7 A;  4G4K A;  1XMQ Q;  4K5X A;  5D3D A;  2NTT A;  4G7H C;  3CQZ H;  3HP3 A;  4DAP A;  4GKK L;  2F4V Q;  5C5M A;  2OEO A;  4EQO A;  1T5X D;  2CFM A;  1B44 D;  3KLW A;  1VQL A;  1II3 A;  3M4Q A;  1LTR D;  5EKL A;  3KDF A;  4GOP A;  1VQN A;  1GUS A;  3TZU A;  2K6A A;  1GXD C;  2EQS A;  2HDL A;  3S2H B;  1D7Q A;  5COY A;  1YIJ A;  2N8N A;  4PMW A;  2EY5 A;  1BCP B;  2P22 B;  1CTM A;  3S9W A;  5C4H A;  3I7F A;  3W1B A;  1S4Z A;  3F8T A;  1CQV A;  2E75 C;  5BR8 L;  3Q8D A;  2JA7 B;  2HCI A;  2QDB A;  4LW1 A;  3C3L A;  5COR A;  3HOZ B;  3PO2 H;  1SXT A;  1Q1B A;  2ICE C;  5IT9 L;  1K9M C;  2TSS A;  2EPB A;  1PYB A;  4FXG C;  3J80 L;  2WAQ B;  5HUR A;  1UEB A;  1IKL A;  4LUZ A;  2A68 D;  2XIW A;  3CCR A;  3PIO A;  1SNM A;  2VQE Q;  1STN A;  5DLQ E;  4EVO A;  2C9O A;  4L5Q A;  4Q9V A;  4NMZ A;  1BVS A;  1V8Q A;  2FMC A;  1K83 H;  3K0Y A;  2XTQ A;  4NW2 A;  3LJ1 A;  3AFP A;  5EKK A;  3BZC A;  4QMG A;  4DAM A;  4A3B H;  1Q46 A;  1PRT B;  2NVY H;  4DV2 Q;  3QR8 A;  1Y14 B;  4FDB A;  2VB2 X;  4UP8 A;  1EL0 A;  2OTL A;  3HOW B;  4MNO A;  1TDP A;  2L4N A;  1RHP A;  2ZXR A;  2D0P A;  2KHS A;  4QB4 A;  2IY5 B;  3KLR A;  4APV A;  1OO9 B;  5C4X G;  1ONL A;  3TSS A;  3UE0 A;  3OTO L;  2GVB A;  4C2M B;  1F9P A;  1HR0 Q;  1HH2 P;  2C5C A;  2JA6 H;  3C46 A;  1JCK B;  1PH1 A;  2J0T D;  1E1O A;  2Q2H A;  2MO1 A;  3UDG A;  1CA5 A;  2LMC B;  5KYL A;  3VYS A;  2I07 B;  3U50 C;  2Z0S A;  4LF5 Q;  3ULL A;  4DR5 L;  5EPL A;  1Y1V G;  2IPK D;  2WP8 J;  4JI8 L;  1LT6 D;  1ENF A;  1JOK A;  3GTL H;  4TKO B;  1G6P A;  4H44 C;  4OAV B;  5BR8 Q;  2LKV A;  1EQV A;  2R7Z B;  1I6V C;  3STB D; 
#chains in the Genus database with same CATH homology
 4K0K Q;  4JI0 Q;  1ASY A;  4KHZ A;  4KI0 A;  2ATW A;  2GN5 A;  3PIP A;  4A3K H;  4DR2 L;  4KLK A;  2AMC B;  2B3G A;  1N34 L;  4X62 Q;  3HOZ G;  1PYS B;  2D0O A;  4LUO A;  1KRT A;  2E2H H;  1IL2 A;  2A2D A;  3HOY H;  2UUC L;  5M5Y H;  4QL5 A;  3JSB A;  3L7Z C;  1YVC A;  1VQF A;  1VCI A;  4YZC A;  2MNA A;  2JQO A;  4A3J G;  2Q2T A;  1HJP A;  1QUQ A;  3BU2 A;  1VQJ A;  3GDE A;  2H5X A;  4H02 A;  5IY0 A;  5C3E H;  3J80 c;  3RN2 A;  4BA2 I;  3GTP H;  2AHO B;  1UE7 A;  1CSQ A;  2KCT A;  1CKM A;  3EBE A;  4DAY B;  3S15 H;  4AQY L;  2JB1 A;  4GLX A;  2KEN A;  4DNI A;  2ID0 A;  2HT1 A;  3CC4 A;  1QUQ B;  1TXY A;  2JEB I;  4LWC A;  4TVA B;  2JA8 H;  2K75 A;  1L2F A;  1YBY A;  4MTN A;  3S1R H;  4DR6 Q;  4HJ8 A;  4DUY Q;  4RG1 A;  4GXT A;  1K8G A;  3I4O A;  4POF A;  1PH7 A;  4WJ4 A;  4YWM A;  4Y7N H;  4DV7 L;  4RMF A;  2CCZ A;  1KRS A;  1YZ6 A;  1TWG H;  1HZ9 A;  5IE8 A;  3JAM i;  4C3H H;  4PG3 A;  1MIU A;  1V9P A;  4DV6 Q;  3T1H Q;  1VQK A;  3PUV A;  4BY7 H;  5JJL A;  3ER0 A;  2I5L X;  4HIM A;  1Q86 C;  1FJG L;  1RL2 A;  4YHH L;  3PO3 G;  3U4V A;  5FLM H;  3CPW A;  1PH2 A;  1KIX A;  3CF5 A;  3I4M G;  2FXQ A;  3HOX G;  4A75 A;  4AQY Q;  2NZH A;  3CD6 A;  4LF7 L;  3M7N A;  3RNU A;  1Y1W G;  1HNW Q;  1J5E L;  4JYA Q;  1NBW A;  4GLA C;  2Z6K C;  2VQF L;  2HIV A;  4A3M H;  2CWP A;  1VQ5 A;  2R92 G;  3S17 H;  4A3F H;  1K73 C;  5M3F G;  4DUY L;  4AYB G;  1PH8 A;  2JA6 G;  5K36 G;  4R1J A;  3PO2 G;  1XMQ L;  5HGI A;  1MKH A;  4JCV E;  4EX5 A;  4A3J H;  3K0X A;  2RF4 A;  2D62 A;  3K80 C;  3TQY A;  2E2I H;  3K8A A;  4P74 A;  1XNR L;  2B63 G;  4X6A H;  1XJV A;  3JC6 6;  5LMU Q;  3L0I A;  4JI1 Q;  3HOW G;  4OO1 I;  2JA7 H;  4QY7 A;  3HOV H;  1V43 A;  4OO1 G;  1A62 A;  3H3V H;  3PUW A;  3KJO A;  2NVX H;  2IP6 A;  4DR4 Q;  5GAH C;  3B6Y A;  2K5N A;  2B29 A;  3KF6 B;  1EFW A;  3S1M H;  4A3E G;  5C4J H;  2HHH L;  1WFQ A;  1VQI A;  4B3R L;  1NJI C;  1EOV A;  5IP7 H;  1JE5 A;  1K8A C;  3DLL A;  4PZ7 A;  1YI2 A;  3H0G H;  4LF4 L;  3PUX A;  1XNQ Q;  3A0J A;  3PSI A;  1VQ8 A;  5GAD C;  1VQO A;  4BBR G;  4JI5 Q;  2YV5 A;  5IWA Q;  1TWC H;  1YHB A;  1OTC A;  5FJ8 G;  3CCU A;  1AH9 A;  1YJN A;  3H15 A;  1VQM A;  2K19 A;  2C35 B;  5GRO A;  1M90 C;  2NVQ H;  2CQO A;  4NB3 A;  4JV5 L;  1D8L A;  4JC0 A;  1CUK A;  3PGZ A;  1N8R C;  1IBM L;  1N33 L;  1AE2 A;  2KHI A;  1YEZ A;  4LF9 L;  3FHW A;  1I6H H;  1VQ4 A;  2UUA L;  4DV3 Q;  4LFC L;  2HIX A;  4BY7 G;  1PH6 A;  1J6Q A;  1EUJ A;  4IPH A;  4X64 Q;  2VZA A;  4DV4 Q;  1YJ9 A;  1XNQ L;  2IX0 A;  4O2D A;  1WYD A;  3HOU H;  3ULJ A;  1YIT A;  4IO9 A;  1S72 A;  2CAZ B;  4KHP Q;  1RIP A;  4B3M Q;  1L1O A;  1E22 A;  5J3B A;  1Z9F A;  3TRE A;  1EWI A;  1JB7 A;  2WFW A;  3CCM A;  3L0O A;  1X3F A;  2MJF B;  3STB C;  4I1T A;  5IP9 G;  3AYH B;  2BA0 A;  1A0I A;  1EQQ A;  4WJ3 M;  3EN2 A;  1JJG A;  4DV3 L;  3TS2 A;  2F6M B;  1FGU A;  5E7N A;  5LMN Q;  2AKW B;  2DGY A;  3HKS A;  1S40 A;  4YZ9 A;  2CWA A;  5M3M H;  4IFD J;  3BJU A;  2E5L L;  1CKN A;  2EXD A;  2JA7 G;  1XMO Q;  1N36 L;  2VNU D;  2KBN A;  1XPO A;  1VQG A;  4JBM A;  3J81 j;  4R4Q A;  1GVP A;  3H3V I;  2N49 A;  1EQR A;  4OWX B;  5GAG C;  1FL0 A;  1Q1E A;  3HKZ E;  1SFO H;  2VUM G;  2UUC Q;  1LYL A;  4YZD A;  1W2B A;  3P23 A;  2EIF A;  4QJF A;  1KC8 C;  4QQB X;  5IYB G;  1IBK Q;  1QVF A;  2JEA I;  4OON A;  4A3D G;  3F1Z A;  1PVO A;  2ZJQ A;  2R7Z G;  2F52 A;  3AEV A;  1S3O A;  1P8L A;  2V6E A;  1G29 1;  4DUZ Q;  4DR1 Q;  1TWA H;  1VQ7 A;  1U0L A;  2AWO A;  4DK6 C;  1Y1W H;  3I4M H;  4HJA A;  4BA1 I;  2R7D A;  4HID A;  4A93 H;  2V1C C;  1N33 Q;  1YNX A;  1MJC A;  4DV7 Q;  1HNX L;  3GTM H;  3ULP A;  5FLM G;  4L5T A;  4YCU A;  2K52 A;  4JI8 Q;  3L2P A;  4B3M L;  4JI0 L;  4J15 A;  4GS3 A;  1VQH A;  5ELO A;  5M5W H;  1KAW A;  2JA5 G;  1H95 A;  1AE3 A;  2JB3 A;  4ME3 A;  5EAY A;  5IYD H;  1BKB A;  3LJ2 A;  3G6E A;  4A3G H;  4HEA 1;  4DPG A;  3KJP A;  1VQ9 A;  2NZO A;  3FP9 A;  2OCE A;  2R93 G;  1N34 Q;  3CME A;  2CKZ B;  1L0W A;  2FUG 1;  4B3S L;  3M3Y H;  1WCM H;  2KKM A;  5IYB H;  1VQD A;  4IJH A;  4HIO A;  2VY3 A;  4YWK A;  3KF8 B;  3U4Z A;  5IWA L;  2ZM6 Q;  3UIT A;  2XGT A;  2ZTD A;  4DR5 Q;  2UU9 L;  3GTK H;  1Q81 C;  3NBH B;  5LNK 1;  4PZ8 A;  3TS0 A;  1IBL L;  3J7Z C;  1QVC A;  2LXK A;  5HY6 A;  4X65 Q;  3HFZ B;  5C3E G;  1VQC A;  4R4I A;  2MQH A;  1XPR A;  2E5L Q;  1IBM Q;  3CC2 A;  3M4O H;  2N3S A;  4BY1 G;  3RLO A;  1N9W A;  2Y0S E;  1L1O B;  2OQK A;  4GKK Q;  2XTR A;  2F66 B;  4PL5 A;  1LM0 A;  4LFA Q;  4JI2 Q;  3W1G A;  4DV0 L;  2NVT H;  3GTG H;  1UWV A;  4NV5 A;  4AS3 A;  4QGU A;  1QZG A;  2JJQ A;  4X64 L;  3S2H H;  1A63 A;  4DR4 L;  1NMF A;  1X54 A;  4JBJ A;  4BY1 H;  1OXU A;  1WJJ A;  3D31 A;  1ASZ A;  4B3S Q;  1E1T A;  1HNW L;  1IZ6 A;  4YY3 Q;  1VS0 A;  2A2C A;  4B3R Q;  3CCV A;  3I2Z A;  1QZH A;  4DR2 Q;  4JI4 Q;  4JBK A;  3E0E A;  2Y0S G;  2PMZ E;  2R93 H;  4UY8 C;  4GNX A;  1KD1 C;  1U5K A;  1IBL Q;  4GN5 A;  4A3C G;  1UE1 A;  4DUZ L;  4DR1 L;  3CW2 C;  2R92 H;  4JI6 Q;  4JI5 L;  1WI5 A;  3T1H L;  1KL9 A;  1Y1V H;  2JA9 A;  4YCW A;  4LF4 Q;  3PO3 H;  1C9O A;  2YYZ A;  4O1P A;  4JI4 L;  4LF6 L;  4JV5 Q;  4P72 A;  5IYD G;  4DR3 L;  2JAE A;  1G51 A;  4JOI C;  1T9H A;  5LMN W;  3IAS 1;  5JEA J;  4AS2 A;  3MEF A;  4A76 A;  5C0X G;  3UE1 A;  2MO0 A;  4DK3 C;  5C0X I;  1X55 A;  4DV5 Q;  4OX9 L;  1UE6 A;  1GM5 A;  4L5S A;  4AYB E;  3ICE A;  1UE5 A;  2I5H A;  5IT9 c;  3GTO H;  4HJ7 A;  2K50 A;  4DWL A;  5GAE C;  3DM3 A;  4DR3 Q;  3SGI A;  4A4I A;  2UXB L;  2KHJ A;  4JI1 L;  3CCE A;  1JJC B;  1BBW A;  3AQQ A;  2OQ0 A;  4IPC A;  2YFB A;  4X65 L;  4A3C H;  4IJL A;  1XNR Q;  3SDJ A;  1BBU A;  5IP7 G;  4JOI A;  4LFB L;  3J81 i;  4K0K L;  1B70 B;  4GOP B;  3PF5 A;  4XTC S;  4HJ9 A;  4X66 Q;  2VQE L;  4DV0 Q;  4LFA L;  2WB1 G;  1TWH H;  1HR0 L;  4IFD I;  4R4O A;  3VA9 A;  5C4X H;  2Q2U A;  3A74 A;  2MFI A;  5IYC G;  4BXX G;  4IFD G;  4R4C A;  3HOV G;  1X9N A;  2A1A A;  2F3I A;  2BH2 A;  3HOZ H;  1GKH A;  4GKJ Q;  4IOA A;  3K7A H;  3F2D A;  3S14 H;  1HZB A;  3KDF B;  5H1S E;  4B3T Q;  3HOW H;  5C44 H;  1SR3 A;  2XTI A;  2VQF Q;  2E2J H;  4PL3 A;  3LJ0 A;  1SE8 A;  2KCM A;  3DO9 A;  4A3F G;  4LNQ A;  4GN3 B;  4NXN L;  4HFV A;  4O0A A;  4UP9 A;  4NXM Q;  2JE6 I;  1KXL A;  1Q82 C;  5FLX c;  4AH6 A;  3KF6 A;  1LTL A;  1X3G A;  2YTY A;  1X6O A;  3KYH C;  2UU9 Q;  5JJK A;  2I5M X;  4QIW E;  1VQP A;  1N32 L;  4C2M H;  4A3G G;  3PF4 A;  3OTO Q;  1IBK L;  4DR7 L;  1E7Z A;  2IHE A;  2PQA B;  1I94 Q;  2UUB Q;  3AFQ A;  4HJ5 A;  3PUY A;  3TRZ A;  1PHJ A;  3GD7 A;  3I55 A;  3OYY A;  4OX9 Q;  5GQO A;  5HGQ A;  2AWN A;  5JEA G;  4YHH Q;  4Z7H A;  4JI2 L;  2K14 A;  3CCJ A;  4BBR H;  4NXN Q;  1IXR A;  2VL6 A;  4A93 G;  1C0A A;  2PQA A;  1EIY B;  1VQ6 A;  2PI2 E;  3H0G G;  1EYG A;  1V1Q A;  4DKA C;  1CKO A;  4NV2 A;  1SMX A;  4JI3 Q;  5LMN L;  2RHQ B;  3CMA A;  1I50 H;  1X3E A;  4DV2 L;  4JI6 L;  3DA4 A;  2IHF A;  4LFC Q;  4R4T A;  3FKI H;  1YHQ A;  2ES2 A;  4UPA A;  1HZA A;  3K7U C;  3RLN A;  4IPD A;  4OXP A;  4XIG S;  1PH5 A;  1I94 L;  4LF9 Q;  3S1Q H;  1WOC A;  2K5V A;  3HKZ G;  1YO7 A;  1OXT A;  5IYC H;  2IT1 A;  2Z6K A;  4BXX H;  4U6R A;  1PFS A;  2QGQ A;  3T1Y L;  4P71 A;  2VS1 A;  1GD7 A;  4A3K G;  3CP0 A;  2ZM6 L;  4B3T L;  4DV5 L;  1JT8 A;  3ERS X;  3BZK A;  2ZRR A;  3DA3 A;  2HQL A;  3CPF A;  2BH8 A;  5M3F H;  2UXB Q;  2LSS A;  2IX1 A;  4O1O A;  4YY3 L;  5ELN A;  3UDX A;  2HHH Q;  2K4K A;  4A3M G;  4A3I H;  2ZTE A;  3F2C A;  4OAU C;  4LF8 Q;  1WCM G;  2OTJ A;  2UXD L;  3T1Y Q;  2R6G A;  2ASB A;  4LFB Q;  2R7F A;  3MXN B;  4IOC A;  3F4M A;  1EIF A;  3CCS A;  1I3Q H;  4LF6 Q;  2YTX A;  3E9I A;  4BBS G;  5JJI A;  4PL4 A;  3I4N G;  1OXS C;  4JG2 A;  3RR5 A;  3PCO B;  4A3L H;  2A19 A;  4IPG A;  3KP9 A;  2BA1 A;  2PI2 A;  1XMQ Q;  5C0X J;  2K5H A;  1PV4 A;  1B7Y B;  3CQZ H;  3G48 A;  4GKK L;  2F4V Q;  1R9T H;  2YTV A;  3K81 C;  2CFM A;  3GO5 A;  3S2D H;  3KLW A;  4TQU S;  3F2B A;  1VQL A;  5AJ3 L;  3M4Q A;  2N78 A;  4UP7 A;  3KDF A;  4GOP A;  3OW2 A;  1NMG A;  2L15 A;  2WAQ G;  4A3I G;  1VQN A;  1QVG A;  2EQS A;  1B8A A;  1FJG Q;  3A5U A;  1D7Q A;  3RZD H;  3NEL A;  2ZJP A;  4X62 L;  5C44 G;  2N8N A;  1YIJ A;  2VUM H;  4PMW A;  3PV0 A;  3FBV A;  1OXV A;  2P22 B;  2F4V L;  3I7F A;  3W1B A;  2ZTC A;  2ALY B;  3I9V 1;  3F8T A;  4C3J H;  4G76 A;  4OWW B;  3KFU A;  1Q12 A;  1YHA A;  2DUD A;  2WAQ E;  1LUZ A;  1YJW A;  1K3R A;  4JBW A;  5M3M G;  5BR8 L;  3CAM A;  1HR0 W;  4Y52 H;  3Q8D A;  5IP9 H;  2B63 H;  3FKI G;  4LW1 A;  4YWL A;  3PO2 H;  1Q1B A;  3JAM c;  2GVA A;  3ZJY C;  1K9M C;  3E9H A;  3M4P A;  4DV4 L;  4JI7 Q;  2UXD Q;  1PYB A;  4DR6 L;  3HOX H;  3AJF A;  1Z47 A;  3RLF A;  3GTQ H;  4NXM L;  1UEB A;  1CKN B;  4LUZ A;  3J7A 5;  1JMC A;  3HOU G;  4MZ9 A;  1JJ2 A;  3G71 A;  3CCR A;  1SN8 A;  3PIO A;  2RHS B;  1VQA A;  4OWT B;  3UDF A;  5M5X H;  4BBS H;  3I56 A;  2VQE Q;  5DLQ E;  4C3I H;  1DGS A;  4A3L G;  1W3S A;  4Q9V A;  1E3P A;  4L5Q A;  4LUV A;  1BVS A;  3M85 A;  2WB1 E;  4GLV B;  4JI7 L;  5AJ3 Q;  1K83 H;  4YCV A;  2I0Q A;  4DV1 Q;  1M1K C;  4LF5 L;  2XTQ A;  1K0R A;  1J5E Q;  4JYA L;  3LJ1 A;  4G75 A;  3AFP A;  4DR7 Q;  3J81 c;  3BZC A;  4A3B H;  3NEM A;  4DAM A;  1Q46 A;  2JA8 G;  3PUZ A;  3S16 H;  4A3D H;  4ALP A;  2NVY H;  3RN5 A;  3KOJ A;  1IYJ B;  1Q8K A;  1VQB A;  3CC7 A;  4HIK A;  2R7Z H;  2JB2 A;  4DV2 Q;  2YFA A;  4A3E H;  1PA6 A;  2UUA Q;  1Y14 B;  4FDB A;  4UP8 A;  1P16 A;  4JI3 L;  4DV6 L;  2OTL A;  1OXX K;  4MNO A;  1A8V A;  3HOY G;  3NEN A;  2UXC Q;  2D0P A;  2Q2I A;  3GTJ H;  4AIM A;  4GN4 B;  2ZJR A;  3S1N H;  2A8V A;  1X65 A;  2RCN A;  3RZO H;  3D0F A;  2IY5 B;  2OWO A;  2JK8 A;  4Z7G A;  4APV A;  1XPU A;  2RIO A;  1NE3 A;  1TWF H;  3CXC A;  3S24 A;  4GNX B;  5C4X G;  1NY4 A;  4P75 A;  4EQ5 A;  2UUB L;  1XTD A;  4POG A;  1GO3 E;  3EIV A;  2UXC L;  1L1O C;  1HZC A;  1I5F A;  3UE0 A;  3WWV A;  3IRB A;  3OTO L;  4A3B G;  2GVB A;  1HR0 Q;  1HH2 P;  2QEX A;  3TEH B;  1KQS A;  4L5R C;  4PZ6 A;  2JA6 H;  1N32 Q;  1HNZ L;  1CSP A;  1FVI A;  1SRU A;  2LXJ A;  1SRO A;  3UDI A;  1C7Y A;  1Q7Y C;  4GOP C;  1E24 A;  3W5O A;  4GKJ L;  1XMO L;  1O7I A;  1VQE A;  1KHI A;  1N36 Q;  1PH1 A;  2JA5 H;  1E1O A;  1NTG A;  5LMU L;  2Q2H A;  2YU9 H;  2MO1 A;  3UDG A;  1PH3 A;  3I4N H;  3U50 C;  2Z0S A;  4DV1 L;  3ULL A;  2PNH A;  4LF5 Q;  4KHP L;  1SLJ A;  4DR5 L;  2L1L B;  4LF8 L;  3IAM 1;  3J80 i;  1Y1V G;  1HNZ Q;  3CCQ A;  3A5Z B;  3G4S A;  2WP8 J;  4JI8 L;  1MJE A;  1PH4 A;  1X56 A;  3LGJ A;  2E8G A;  3GTL H;  1HNX Q;  2VW9 A;  1G6P A;  3U58 A;  1SJ8 A;  5FJ8 H;  4LF7 Q;  2XMX A;  4OAV B;  3VDY A;  5BR8 Q;  4GNX C;  3CCL A;  3M9B A;  4P73 A;  1PH9 A;  4X66 L;  2NN6 G;  3STB D;  4NPS A;  2QA4 A;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...