2E8GA

The structure of protein from p. horikoshii at 1.7 angstrom resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
MWDTSKDYRLLVAEKSVELFIRTIEGAKFRGQWDKKRSIQLAKEMIPDIQALRYSYIDPEELVDTPQMKDLKEKAKGIIEALGGEDWHHKFLSQASREDREKVEEQVARIKFFLNTILNLDRRLKLGKINDPVIAVDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVTNDLTVKEGNRVAVALLPPRNFFGIVSEGMFLGAGEGVLKNVKGEIGGLPKGIPLEALNETRNAVEAFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of protein PH0536 from Pyrococcus horikoshii at 1.7 A resolution reveals a novel assembly of an oligonucleotide/oligosaccharide-binding fold and an alpha-helical bundle
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
molecule keywords Hypothetical protein PH0536
total genus 81
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF18489 Alpha_Helical Alpha helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.150 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2e8gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e8gA02
1GD7A 1MJCA 4IPHA 4DV4L 4DR1L 1L1OC 1VQHA 1EQRA 1K0RA 1YHAA 2JE6I 1IZ6A 4GN4B 4XTCS 2E2IH 4UP9A 4APVA 1KIXA 4POFA 1FGUA 4QJFA 4DV2Q 1A0IA 2Z6KA 5GROA 5M3MH 4X62Q 4PZ6A 2QGQA 3H15A 4LUOA 1SRUA 3CCRA 1HNWL 2K75A 1Q12A 1VQCA 4DR3Q 3T1HQ 2D0PA 4O0AA 3OTOQ 4UY8C 3L2PA 4JBKA 3KJPA 4C3IH 3CC7A 2NVTH 4JV5L 4B3ML 1VQ5A 1RL2A 2QEXA 3PUXA 4UP7A 2VW9A 1L1OA 2VY3A 2A1AA 1I50H 1V1QA 1Y1VG 2MQHA 2VQEQ 2F4VQ 3J7A5 3PIOA 4JI7L 1HZ9A 2N78A 3UDIA 3CPWA 1Y1WG 4LF5Q 1FJGL 1IL2A 3FKIH 1VQ4A 1N32L 2IT1A 3PUZA 2DGYA 5GAHC 4GKKL 4BA2I 4IFDJ 4BXXH 3S2DH 1VQEA 3BJUA 1GKHA 4NPSA 1SN8A 4QL5A 1PH9A 1WFQA 3G4SA 4IFDI 1IBKL 3CQZH 1U5KA 3F8TA 2JA6G 1K3RA 1SMXA 2UXBL 2NN6G 5IP9G 2NN6I 2R93H 1G291 1Y14B 4TVAB 2MNAA 4A4IA 3W1BA 3MXNB 1O7IA 2D0OA 4A3DG 1V9PA 4A3EG 4LFAQ 2NVXH 5GAGC 2LXKA 5C0XJ 2JA7G 1I5FA 5GADC 3M4OH 3STBD 1EIYB 2ASBA 1B7YB 1GO3E 3K80C 4LF4Q 1K9MC 3IRBA 3ER0A 4DV4Q 3HOXG 1OXXK 2ALYB 3DM3A 4DR1Q 4GKJQ 2ZM6Q 2R7ZG 4A3LH 1N36Q 1Q8KA 4BY1H 4IJHA 2KHJA 2AWNA 2UUBQ 3CCMA 3KF8B 4JOIA 3CW2C 3JAMi 1PA6A 3J80c 2K52A 1JJGA 5IYDG 4DR2Q 4YY3L 4LFBQ 4A3FH 4YCWA 1X54A 4A3MG 1PH4A 1MKHA 4R4IA 1QVCA 1HZAA 4PZ7A 3KFUA 2Q2UA 4A3KH 3S16H 1QZGA 1SFOH 1UE6A 5FLMH 1VQ6A 3G48A 5H1SE 3HOYG 4JV5Q 3KF6B 3GTQH 1G6PA 3OW2A 1PH5A 3CPFA 4LUVA 1E1TA 3A5UA 1EUJA 3T1YL 2AHOB 2EIFA 2I0QA 2YU9H 3HOZG 1IBKQ 1PYBA 1QUQB 1EFWA 1NY4A 4A3GG 4RG1A 1N9WA 1EYGA 4YCVA 4JG2A 1C9OA 4L5RC 2B29A 3PCOB 1K8GA 3HOWG 3HOYH 4DR6Q 1VQDA 4DV6L 1P16A 2JEAI 3OYYA 3GDEA 1KC8C 1PH6A 2E5LL 5M5XH 4A3JH 4JI2Q 3I4NG 2UXCL 2VNUD 4PMWA 3G71A 4A3MH 3JAMc 5K36G 3M9BA 1N34Q 4BY7G 2UUBL 4LFCQ 4A3FG 3AEVA 1J5EL 5AJ3L 1GVPA 2OQKA 4IO9A 2UUCQ 2PI2A 4DR4Q 1IBMQ 3H3VH 1E1OA 2JA5G 4BY1G 4NXML 1YHBA 3TS2A 1PV4A 4JYAL 1I3QH 3U58A 4A3JG 3I4NH 1HNWQ 1M1KC 1JE5A 3J7ZC 1EWIA 2YTVA 3K8AA 5LMNQ 3TRZA 1OXSC 2BA0A 2JEBI 2HT1A 1L0WA 5IYBG 2AMCB 2WAQE 4NXMQ 3K7UC 2OCEA 5C4JH 5IP9H 4B3SL 2JA9A 1Q82C 4A3GH 3S17H 4IFDG 2Q2TA 3HOZH 3G6EA 4A93G 4WJ4A 1UE5A 1X3GA 3FHWA 1N34L 4GKKQ 3RR5A 1TWFH 2VL6A 1PH7A 4BXXG 2PMZE 3CCLA 2E8GA 1PFSA 2KENA 4MNOA 1KRSA 1CUKA 2I5HA 3DLLA 5FLMG 1Q81C 3RZOH 1B70B 4DV3Q 4NXNQ 4DPGA 1S40A 4A3CH 4JCVE 4HIDA 3EIVA 1X3EA 4DV0Q 1Y1WH 1NMGA 4GOPA 2R7DA 1UE1A 4P75A 3CD6A 3GTLH 1VQAA 3I2ZA 2WP8J 3S24A 2MO0A 1YI2A 4B3MQ 1L2FA 2Q2HA 1A8VA 1X55A 4LF9L 5M3FG 4YWLA 4ALPA 2HQLA 1GM5A 1TXYA 3K0XA 4X65Q 4GLAC 1Q7YC 1WJJA 4JI4Q 4JI4L 3KLWA 3HOXH 1XJVA 2UU9Q 5JJKA 2BH2A 3CCVA 1LM0A 1TWAH 5JEAJ 2DUDA 5ELOA 3W1GA 5M3MG 4LNQA 2JA7H 3M4QA 3S1RH 3PV0A 1N32Q 1MJEA 1NMFA 1L1OB 1VS0A 4NXNL 3RN5A 4OWXB 3PF5A 1G51A 2L15A 3KOJA 4H02A 1KRTA 4DV0L 1XMOL 4R4QA 4DV3L 4OWWB 4JI7Q 2JA6H 1BVSA 1AE3A 1N8RC 1VQLA 2UXDQ 3A5ZB 4GOPB 4BA1I 4R4OA 1X9NA 2B63G 3PF4A 2KCTA 3LGJA 1AE2A 4B3RQ 4AYBE 1N36L 1CKOA 2NZHA 3H3VI 5GAEC 2WB1G 1XPOA 2ZJRA 2K50A 3H0GG 1NBWA 4A3IG 1E24A 5IE8A 2FXQA 4HJ8A 1K83H 4AH6A 4B3TL 2H5XA 1HNXQ 1J6QA 4AQYL 1XPUA 4L5SA 1KQSA 1NE3A 1FVIA 1Y1VH 1XNRL 4UPAA 2ATWA 1SE8A 5LMNL 1T9HA 2JJQA 3PO3G 1OXTA 1TWCH 5C44H 3SGIA 1SLJA 3HOUG 1YVCA 4L5TA 4GLXA 1W2BA 3UDGA 4LF8Q 1VQJA 1WOCA 1X56A 2KHIA 3HKZG 5IYCG 4JI6Q 1K8AC 5HGQA 4JI3Q 2PI2E 2YV5A 4TQUS 3UE0A 1FL0A 5C0XG 1J5EQ 3F2DA 2IHFA 4LFCL 4X66L 2R92G 4DUZQ 3A0JA 5IY0A 3GO5A 1XMOQ 2WAQG 5JEAG 1IXRA 1WI5A 3E9HA 3PSIA 3TS0A 2F4VL 2IX1A 2JQOA 3M85A 4A3BH 1YITA 4IPDA 4XIGS 3I4MH 2UUAL 1E22A 1CKMA 4LF6L 4C3HH 3ERSX 4DNIA 3H0GH 5DLQE 2F52A 2D62A 2ZTEA 3F1ZA 3T1YQ 4YWMA 2B63H 2K5VA 3K7AH 4DAMA 4DR5Q 1S72A 4OXPA 3ULJA 4EQ5A 3I4MG 1EQQA 3S1NH 2LXJA 1VQBA 1PYSB 3PIPA 3F2CA 4BBRH 4LF6Q 1CKNA 2E2HH 1IBLL 4QIWE 5BR8Q 3PO2G 3AYHB 4DUZL 3I55A 1PHJA 3S2HH 2IHEA 2NZOA 3J80i 3VDYA 4OONA 3AFQA 2N49A 2BH8A 2HHHQ 2A8VA 4JI3L 1Q46A 1C0AA 1QVFA 4JI6L 1HNZQ 1VQIA 1YHQA 3CC4A 1BBUA 2ZM6L 3U4VA 1PH8A 3HOUH 3RNUA 5C44G 2RF4A 5BR8L 3ULLA 3CCQA 3CCEA 2JA8H 1JJCB 3PO3H 1CSPA 4B3SQ 4LF4L 2YTYA 3S15H 4YHHQ 1S3OA 1Z47A 2VUMH 4KHZA 4KI0A 3NEMA 1UWVA 3U4ZA 4LF7Q 3GTPH 1E3PA 1SROA 1A63A 3L0OA 1R9TH 1YJ9A 1VQNA 1XNRQ 2UXBQ 3EBEA 4GNXA 4RMFA 3U50C 4DK6C 4QY7A 3CC2A 5JJLA 1EIFA 5GQOA 4JYAQ 2AWOA 2WB1E 1KAWA 2VQFQ 1VQFA 2V1CC 3TQYA 1AH9A 3CCUA 2VZAA 3K81C 1KD1C 3STBC 1V43A 2ES2A 2HHHL 3EN2A 5LMNW 4JI1Q 2C35B 1WYDA 4POGA 4B3RL 4HIOA 1PH3A 1N33Q 2MFIA 2PNHA 4PZ8A 1JJ2A 5LMUL 2JK8A 4DR7Q 3TEHB 1WCMG 5LMUQ 3J81i 4DUYL 1XNQL 1ASZA 2RHSB 3HOVH 4O2DA 4DV6Q 1HR0Q 2VQEL 1D7QA 1LUZA 2E2JH 3W5OA 5M5WH 4KHPQ 1OXUA 2CQOA 4Y7NH 3M7NA 3BU2A 5IWAL 1Q1EA 1YBYA 2WFWA 5M3FH 1KXLA 4L5QA 4X65L 3AQQA 1KL9A 4OWTB 4HJAA 3HKSA 2CWPA 1I94Q 2CWAA 4BY7H 1YIJA 1XPRA 1HZBA 1HR0W 3FP9A 4X6AH 5ELNA 5FLXc 1VQOA 3PUVA 4OO1I 1TWHH 3RLOA 2IX0A 4A3CG 3CP0A 2PQAB 2I5MX 4Y52H 1DGSA 3HOWH 1UEBA 3BZCA 4IPGA 4YWKA 2ID0A 4A93H 3L7ZC 4JBMA 1LTLA 2QA4A 4JI2L 2OWOA 2RHQB 1M90C 3HFZB 1NTGA 4QQBX 4P74A 2ZJQA 5IYBH 5C3EH 2F3IA 4JOIC 1HJPA 1IBLQ 4MZ9A 4BBSH 1Z9FA 2Z0SA 4LFAL 3GTGH 1JMCA 1U0LA 2HIVA 4JI5Q 2I5LX 4A3KG 4KLKA 1I94L 5C4XG 5J3BA 4R4TA 4LF7L 4LUZA 2EXDA 1PVOA 2JA5H 1SR3A 3PUYA 2GVAA 4QGUA 4LF9Q 3CCSA 4P72A 3ICEA 1VQ7A 1IBML 4J15A 1VQMA 2PQAA 2R6GA 4P71A 1Q1BA 4HIMA 3RN2A 4DV7Q 4DR4L 4JI8Q 2YYZA 4X64L 1HR0L 2YTXA 1OXVA 3CCJA 3I4OA 3NBHB 4GLVB 4NB3A 3RLFA 5C0XI 5C4XH 3ULPA 3GD7A 4DR7L 4R4CA 2Y0SE 1P8LA 4DV1L 4BBSG 2KCMA 2Y0SG 4A3EH 4A3DH 1VQGA 5C3EG 1X6OA 4GS3A 4JI8L 4DR6L 3I56A 1VQ9A 1Q86C 2MO1A 2VQFL 2R93G 2LSSA 3E0EA 2EQSA 4JC0A 1MIUA 4DV5L 1X3FA 4DK3C 3KF6A 4DR3L 3GTMH 2KBNA 4OX9Q 1UE7A 3OTOL 4C3JH 4JI0Q 1XTDA 4ME3A 4HIKA 1W3SA 2GN5A 3JC66 5HY6A 4X62L 4LWCA 2IY5B 3CMEA 3FKIG 1QUQA 4P73A 3PGZA 4AQYQ 1VCIA 4JI5L 4JBJA 4YHHL 4B3TQ 4KHPL 2ZTDA 4FDBA 1I6HH 2R7FA 2Z6KC 4A75A 4GN5A 2JA8G 4DUYQ 4A76A 1XNQQ 1X65A 4K0KQ 5IYDH 4IOAA 2K14A 2OTJA 2UUCL 1EOVA 2AKWB 2BA1A 2K5NA 4EX5A 3UDXA 2Q2IA 4LW1A 4YY3Q 4LFBL 3S14H 2R7ZH 1B8AA 4HJ7A 4A3LG 3D31A 1VQKA 3CAMA 2E5LQ 2ZTCA 2RCNA 4WJ3M 2N3SA 1CSQA 2HIXA 4GKJL 3D0FA 4GN3B 4K0KL 1RIPA 3HOVG 4C2MH 4R1JA 4OO1G 2CFMA 3RZDH 3ZJYC 4HJ9A 1WCMH 3CF5A 1JT8A 1XMQL 3WWVA 4BBRG 3S1MH 1YNXA 3J81c 2UU9L 3M3YH 1KHIA 3T1HL 3UE1A 4OX9L 4IJLA 4UP8A 3F2BA 4GNXB 4DV5Q 4JI0L 4DKAC 4IOCA 4AYBG 5IWAQ 3GTKH 3KDFA 5IP7G 1TWGH 1CKNB 3MEFA 3E9IA 1YEZA 4HJ5A 2CCZA 1E7ZA 1LYLA 2K5HA 4DAYB 3KJOA 1ASYA 2VUMG 2NVYH 1N33L 4A3BG 5JJIA 4DV1Q 4LF5L 1FJGQ 4JI1L 4X66Q 4MTNA 2N8NA 1H95A 3Q8DA 2R92H 3B6YA 1BKBA 4JBWA 5E7NA 2VS1A 2XGTA 5FJ8H 5M5YH 4DV7L 2K4KA 4X64Q 4PG3A 2A19A 3BZKA 1C7YA 2NVQH 3HKZE 5EAYA 3GTJH 4LF8L 1YZ6A 5IYCH 1A62A 4DR5L 2OTLA 3NELA 3RLNA 4GOPC 1YJWA 2CKZB 3PUWA 3A74A 3NENA 1IYJB 5IT9c 1NJIC 3I7FA 3TREA 1HZCA 5FJ8G 1K73C 4IPCA 1YJNA 3CXCA 3PO2H 3KDFB 3S1QH 1QZHA 4DV2L 1XMQQ 1HNXL 2UUAQ 2OQ0A 1VQ8A 1PH2A 3M4PA 3J81j 4AIMA 2GVBA 2XTIA 1QVGA 1HNZL 4A3IH 1OTCA 5IP7H 3UDFA 3KYHC 5AJ3Q 2ZJPA 4GNXC 4DR2L 1VQPA 1PH1A 1BBWA 1HH2P 1JB7A 4YCUA 2UXDL 2UXCQ 1D8LA 2B3GA 3CMAA 3AFPA 3GTOH
chains in the Genus database with same CATH superfamily
5EKIA 1MJCA 2PZTA 1EQRA 1SXTA 2JE6I 3R93A 3Q22A 3U9OA 1CFMA 3D6CA 3GTGB 4POFA 3OIQA 4DV2Q 1GUSA 2C9OA 4LUOA 1SRUA 5IIFA 4LK1C 3T1HQ 1STNA 2IWHA 3KJPA 4C3IH 4JV5L 4CDCC 2QEXA 5EQ0A 1L1OA 1BUVT 1I50H 3J7A5 2MQHA 3DWAA 2F4VQ 3PIOA 3N6RA 1HZ9A 2N78A 2B2YC 3UDIA 4XT1B 1IL2A 1MSHA 3KF8A 2RBMA 5CV8A 2OXPA 4GKKL 3S2DH 1VQEA 3BJUA 1GKHA 5C3EB 4X3TA 3NK9A 4IFDI 1IBKL 4IUVA 1K3RA 4A3IB 2UXBL 3KP9A 3E6ZX 5IP9G 1G291 5G3LF 4A4IA 3MXNB 4I7ZC 3J80E 1V9PA 1S5CD 4C3IB 4XXEA 2JA7G 4RGMA 5GADC 5ISRA 3A56A 2MUYA 3STBD 3K80C 1SE3A 1K9MC 1H9RA 3ER0A 3HOXG 1OXXK 3DM3A 4A3LH 2ZM6Q 1Q8KA 1TS3A 4IJHA 3T4AC 2A73B 3DM1A 3KF8B 4JOIA 3CW2C 1PA6A 1JJGA 5IYDG 4Z7GA 4DR2Q 4YY3L 1B3QA 1PFNA 1E2WA 1X54A 4RH6A 1PH4A 4R4IA 1HUMA 2FMMA 1EEID 1PZID 4A3KH 2QEJC 4ZYSA 5JPNC 4HCSA 5H1SE 3HOYG 3KF6B 2A69C 3GTQH 1PH5A 3GTJB 2RDGA 3E5SA 3T1YL 2KA7A 2AUJD 2I0QA 5FO9B 4A3GG 3GTOB 2K03A 2D5DA 1TQOA 2F0MA 1RKNA 3MVVA 5COYA 4CKEA 3HOZB 5BN3A 1TDPA 2VNUD 4HN7A 3K58A 3T13A 4A3MH 4F8MA 2UUBL 3FRPB 1E2VA 1GVPA 2OEOA 3M4OB 1AW7A 4ABNA 1IBMQ 4C56C 1STBA 1DCZA 4BY1G 1XWEA 3TS2A 1BCPD 2IJ0A 2CHBD 1HNWQ 1JE5A 1F9PA 1EY9A 3J7ZC 4DA2A 5EKKA 2B39A 3S2HB 1OXSC 1XX8A 2BA0A 5E1FA 4NXMQ 5KRUA 4TRDA 2NN6H 4B3SL 4QF4A 1TWGB 1NR2A 3S17H 1NCVA 1FD7D 1H9JA 1UE5A 1X3GA 1SBBB 3H0GB 2NTTA 4EQPA 4L8JA 4NW2A 1Q3LA 2PW7A 4GKKQ 4BXXG 3VR3A 5I2YA 2J4XA 4ILWA 3HZXA 4I1TA 1HUNA 5C44B 4DPGA 2YU9B 3C1EA 1X3EA 4KV6A 4C1NI 2K33A 2R7DA 3FKIB 1O7ZA 1UE1A 3GTLH 1FYCA 2MO0A 4AS3A 4B3MQ 4YWLA 2D9UA 3GTMH 2M00A 2RLDA 1Q7YC 2K19A 4FYDA 1ENAA 1WJJA 3AU7A 3GV3A 3MXUA 1TWAH 2L1BA 2DUDA 2DN8A 3IFTA 2JA7H 2F0VA 4YZCA 4J1MA 2JXMB 1N32Q 3I9V1 3EFXD 5JVH3 2LKVA 4FO2A 3PF5A 1YO7A 5NUCA 5HGTA 4JI7Q 2XVSA 1LABA 2L9HA 4GOPB 2B63G 2KCTA 3SK5A 1CKOA 3H3VI 2WB1G 4KY5A 1XPOA 3H0GG 3QWNA 1AP0A 4A3IG 5IE8A 1JOQA 1W6JA 1TR5A 4AH6A 4B3TL 4J8QA 2I46A 1I4QA 5JOBA 1K3BC 3MXPA 3GP7A 1Y1VH 1CHQD 4FF1A 2NB0A 3PO3G 2KECA 1NAPA 4L63B 1OXTA 1TWCH 3SGIA 3HOUG 1ML0D 2KKMA 3HKZG 1KLUD 3S1MB 1NSNS 1FNVA 2VB3X 3SK6A 3F2DA 2A6HC 4X66L 5KNCA 2A69D 4K14A 3GO5A 3GTKB 1IXRA 3PSIA 3TS0A 4A3BH 2JQOA 5ELDA 4G4KA 4N9TA 3D3RA 3TZDA 4C3HH 5G3LD 2YFAA 2K5WA 3H0GH 2F3VA 2F52A 2Z9HA 1I4XA 3QG1A 2D62A 2ZTEA 2JA6B 3VYRA 4YWMA 1O78A 1Z7TA 3I90A 2R3ZA 3F2CA 4XYQA 5BR8Q 2EVBA 4EQOA 2G9DA 4DUZL 2NZOA 2Z4HA 2N49A 2BH8A 4JI3L 5LL6X 3QOLA 4C3JB 3RNUA 5C44G 2Z1CA 2AQ3B 2JA8H 1K8MA 3BYYB 3GTPH 2IL8A 2Q8IB 1IHZA 1A63A 1VQNA 4CKBA 2KEDA 3EBEA 3X3NA 3U50C 3CC2A 5GQOA 2WB1E 1VQFA 3BZDB 1TWAB 3K81C 3STBC 3OOCA 2HHHL 3K5OA 5IGDA 2MPMA 1PH3A 1N33Q 2XTRA 1PTOC 4AYBB 1JJ2A 1Y1VB 3TEHB 1XXGA 1Y1WB 4DV6Q 2OT2A 1QNKA 1WCMB 5E4XA 1HR0Q 1QWYA 3W5OA 2EY2A 2RSOA 2P22B 2CQOA 2SDFA 4Y7NH 3M7NA 2Z6BA 3BU2A 3T56B 4OGQC 5IWAL 4BBSB 1JB3A 5M3FH 1F9SA 2MGSA 4RGNA 1X3QA 2AQ1B 4OWTB 2XWBB 1IKMA 1YIJA 4ZUJA 3E0JA 5ELNA 4OL7A 4OIKA 4EVOA 3K5LA 1BBXC 4OO1I 4A3CG 3SK4A 1DGSA 1MD2D 2F0HA 2CVRA 3HKZB 3AJFA 1TS2A 1TU2B 2ID0A 2PZUA 1SMYC 1O80A 1M90C 4P74A 5IYBH 3FMCA 4RHSA 5C3EH 1GUNA 1AN8A 2E75C 4MZ9A 5A35A 1SJHD 1Z9FA 4FVMA 5M3FB 3T53B 3TP7A 5J3BA 3HRZC 2XRSD 1TWCB 1SR3A 5C3WA 3HOVB 4RKLA 1PTOF 2PQAA 1SYCA 2NVTB 2HCIA 4DV7Q 4DR4L 2YYZA 5J22A 5DAUA 4GLVB 2B63B 3RLFA 5I6WA 4DR7L 4DV1L 1LACA 2KCCA 4A3EH 1TS5A 1X6OA 4DR6L 1Y69U 4A3KB 1PYWD 2EY5A 1SJED 2PCFB 1X3FA 3KF6A 3CQZB 4DR3L 2KBNA 1XTDA 4ME3A 4YIJA 4NKLA 3H91A 3CMEA 1EY8A 4DAVA 4EGVA 3DO9A 5CV9A 1LT6D 4JI5L 4YHHL 2XRQD 3K57A 2Z6KC 4X3SA 4A75A 1ILQA 4A76A 2JA8G 1X65A 5I9OA 1K83B 3IL8A 4C3IG 4YY3Q 2Q8RE 3J7AF 4H7BA 4HJ7A 3D31A 3IAS1 1LT4D 2E5LQ 4WJ3M 2MHVA 2N3SA 1CSQA 3FVVA 2F0SA 1BOSA 3BG3A 4ZCKA 5CMDA 5I2XA 5IGCA 3W2DA 1KNAA 1Q90A 4K6LA 4HJ9A 3WWVA 2RDHA 1ET9A 4PMBA 3UE1A 3IKJA 1HRJA 4DV5Q 3IAYA 4BY1B 2X6LA 5IP7G 1HQMC 1CM9A 1TWGH 1SYGA 2A74C 3C46A 5I4DA 4HJ5A 2E2DC 1E7ZA 1DOKA 4DFAA 4A3BG 1K0SA 2VB2X 5CBAE 1H95A 3NQIA 5M5YH 5FJ8H 4HMIA 2VS1A 4R9WA 3NSWA 4PG3A 3BZKA 3GTLB 4LF8L 5IYCH 4F7XA 2OTLA 3OIPA 4GOPC 3TP6A 2DNCA 1CI3M 1F9QA 1K73C 4IPCA 4XT3B 3CXCA 2NTSA 1EZ8A 1QZHA 4V0BA 2QILA 1VQ8A 1CZGA 3M4PA 4OEMB 4DAYA 4B9XA 2ICEC 1WD1A 4A3IH 1OTCA 5LHY1 2UXDL 1D8LA 2B3GA 4IPHA 4DV4L 4DR1L 1K0RA 5FOBB 4R8IA 1IZ6A 4XTCS 2K05A 4G76A 4OO1H 4X62Q 4PL5A 4PZ6A 1DXMA 1I4HA 2QGQA 2LY7A 4CGYB 4K5VA 2D0PA 2PPBC 1B1ZA 4O0AA 4JBKA 2KHSA 1EU4A 4H44C 2CAZB 1AEXA 2A1AA 2B2VA 1V1QA 1ESFA 4JI7L 3NQTA 4LF5Q 2ETDA 5JAVA 4RKBA 2B2VC 1GHJA 4CHTB 4BXXH 1PZKD 1R4PB 1ILPA 2DJFC 2L55A 1SN8A 2FJ2A 2IX3A 5ELEA 4CDDC 3G4SA 4NMZA 1PH9A 3JAME 2NN6G 3KK7A 1B2TA 1WTWA 2KCNA 3CU7A 4A3DG 2NVXH 4N8FA 4LFAQ 4HEDA 3M4OH 1TKWB 2HUGA 1EIYB 2ASBA 4HSVA 1A3VA 4F88A 4GKJQ 2ALYB 5J1ZA 4BY1H 3VA7A 2UUBQ 3CCMA 4UDUC 3HP3A 4ZKBB 2K52A 5I9PA 4GXTA 4YCWA 3KBGA 4A3MG 1MKHA 3KFUA 1HZAA 4PZ7A 1UNSA 2XWJB 4XDXA 1UE6A 2RKSA 1KNEA 2N88A 1TS4A 1SNOA 3CPFA 5FO8B 4FF4A 1SYDA 3PIP3 3HOZG 2YU9H 4Z7HA 1HTPA 1EYGA 5T1GA 4L5RC 3HOYH 4WRDA 4DV6L 1TIID 2K7VA 4ZRZA 1W6KA 1PH6A 2E5LL 4A3JH 3N52A 4FF2A 2UXCL 1LLRD 4CDFC 5K36G 3M9BA 4BY7G 1RODA 2CH4A 2R92B 3AEVA 1CQFA 2OQKA 1H9MA 1TT2A 5IOCA 2JB2A 2PI2A 2JB1A 4JYAL 4DWLA 3U58A 3I4NH 1I50B 4N8X1 4DK0A 5KIXA 3NWSA 1UEAB 3A7LA 5CR3A 3FPUB 2FMCA 1KAAA 1L0WA 5IYBG 1I4RA 2WAQE 1OO9B 2OCEA 4YZDA 1JOKA 3VA5A 1HCZA 4DN4M 2K5DA 3G6EA 4WJ4A 2JBWA 3RR5A 1PH7A 2PMZE 3CCLA 2E8GA 1PFSA 2KENA 4MNOA 2I5HA 3OW7A 3Q6SA 4JCVE 4HIDA 3GV6A 2I07B 4DV0Q 3LJ1A 3S9WA 4CDEC 2AQ2B 4P75A 1LTRD 1CT1D 2WP8J 3S24A 3S2DB 3MXGA 1X55A 4LF9L 4V190 1GM5A 1B9NA 4GLAC 1LO5D 1YNJC 5C4JB 2F66B 1LTSD 2XMXA 5ELOA 5M3MG 5LL6S 3M4QA 2JAEA 1DJRD 1SAPA 1NMFA 1L1OB 4OWXB 4DV0L 1NR4A 1X3PA 4R4QA 4U68A 2JA6H 2UXDQ 1VQLA 4QMGA 3DWPA 3SEBA 1IW7D 1AE2A 1N36L 3DEOA 1K8OA 1NBWA 3TN2A 4HJ8A 1K83H 2A68D 4DU9A 1STEA 2H5XA 1HNXQ 1J6QA 4AQYL 1XPUA 4L5SA 1FVIA 1XNRL 4UPAA 5LMNL 1U9RA 2A6HD 2F3WA 2F0GA 1YVCA 5CV4A 4LAAA 2E76C 4L5TA 3UDGA 1I6HB 4QB4A 2Q8TA 4JI3Q 3UE0A 1FL0A 4OIJA 1SNPA 1E2ZA 1TY2A 1XYIA 2R92G 1RCVD 1ONLA 1XMOQ 1DYQA 2ZRRA 3E9HA 3DWQA 3M85A 4RGTA 1YITA 4XIGS 2B2YA 2UUAL 1E22A 4FXDA 1YNNC 1PRTC 3KLSX 1JOOA 5IGGA 3HOWB 1D2BA 2EZVA 4DNIA 3K59A 2PQEA 2EXZA 5DLQE 4O1OA 4A93B 1MI2A 4ZK9B 1D1KA 2HCCA 2F0LA 3K7AH 2QDBA 2B2TC 4EQ5A 4XQNA 1SNDA 1VQBA 3VYTA 2SNSA 4QIWE 1U4LA 5JVG3 4DK1A 1L0XB 1UAPA 2KOLA 1AZPA 4KD4A 1LT3D 3J80i 3VDYA 3AFQA 4RHRA 2XSCA 1Q46A 3RMHA 5I6YA 3CC4A 2A2CA 1UUPA 2RF4A 2NVQB 1FGBD 4C1NK 3PO3H 4B3SQ 5D14A 2YTYA 3I4NB 4YHHQ 1V8QA 1UWVA 3L0OA 1O7YA 5L37A 1YJ9A 3NXWA 1XNRQ 5IGBA 4ID6A 4QY7A 1WTVA 1EY7A 4C3JG 1PTOH 3S17B 3MAQA 2VQFQ 2V1CC 3TQYA 3W3AA 3ND9A 1KD1C 2K32A 1V43A 3EN2A 2B8GA 3NTKA 2C35B 5LMNW 4RFBA 3K0YA 2PNHA 4PZ8A 1TVXA 4DNRB 4DR7Q 2JK8A 3SVMA 5DEHA 3G7LA 1ASZA 3KLRA 2RHSB 2FHTA 1D7QA 1EY5A 2VQEL 2KVMA 2X6GA 2E2JH 2F0IA 5M5WH 2F0QA 1LV9A 2F0TA 4DAPA 3M3YB 4IURA 4KMUC 1Q1EA 2IPKD 4PMCA 4L5QA 4X65L 2RADA 2PO4A 1EZ6A 1I94Q 4IUNA 1SYFA 1HR0W 1J8IA 4X6AH 5FLXc 5KGUA 4A3GB 1LTID 4P2CB 2A2DA 1CTMA 4UAIA 1TWHH 2IX0A 3CP0A 4BS9A 2VXWA 2PQAB 4Y52H 3HOWH 3CRLC 2L1LB 2O4XA 5FLXL 4IPGA 2EJGC 4QUFA 2NWGA 3BDOA 4LJZC 1I4PA 1LTLA 2QA4A 4JI2L 2MP1A 4NV5A 2TSSA 1MGSA 4RAUC 1NTGA 1SSOA 4QQBX 3U9SA 1HJPA 3EQLC 1IBLQ 1B9MA 2EYJA 2Z0SA 3FEWX 1HFGA 4KKSA 1JMCA 1U0LA 2HIVA 4JI5Q 2I5LX 4X3KA 4R4TA 1F2LA 4LF7L 1CQVA 2EOTA 4K2KA 4J6HA 1PVOA 1E0BA 3H3VC 1B50A 4QGUA 1IBML 1VQMA 2R6GA 4P71A 4OAVB 5C5MA 1DOLA 3A55A 4HIMA 3RN2A 4NDXA 4YZ9A 3D8GA 4JI8Q 4X64L 5D3IB 5T1IA 2HD3A 5DM63 3BVGA 5FO7B 1STYA 1P8LA 2KCMA 2Y0SG 4A3DH 4A3BB 1VQGA 2B2UC 1RTNA 4GS3A 1VQ9A 4L6TB 4O1PA 5HURA 2LSSA 2EQSA 4DV5L 3QR8A 5D3DA 4C3JH 4HIKA 1BNZA 3PO3B 2GSCA 3JC66 2GN5A 1PRTB 5HY6A 3HOUB 1QUQA 4P73A 1EFID 1KABA 4IUTA 4JBJA 4KHPL 3TSSA 4MHEA 1VDZA 5IYDH 4IOAA 1EOVA 2K5NA 4Q0FA 2F0NA 3TP5A 3BDLA 4ZAIA 3UDXA 3S14H 1B8AA 3CAMA 5C4ZA 4K0KL 4R8NA 1XTCD 3HOVG 1LTAD 3NHHA 3ZJYC 3VA9A 2R93B 1WCMH 2E2JB 3CF5A 4FXKC 1JT8A 3LJ2A 3V05A 1H9SA 1YNXA 4HAEA 4S3SA 1L0YB 5C4XB 4EQNA 3SDJA 2R61A 4OX9L 4IJLA 4GNXB 4JI0L 4DKAC 4IOCA 4MTKA 3T16A 3KDFA 1WTPA 4BBRB 2EYPA 1BDOA 1RTOA 3MEFA 4KTAA 3E9IA 3NE5B 4FF3A 1LYLA 4DAYB 4LF5L 5LNK1 3MZ5A 3Q8DA 5E7NA 3C2PA 2XGTA 3OSOA 2DY8A 4Y7NB 1YZ6A 3NELA 1GXDC 3PUWA 2CKZB 3A74A 3BDCA 5IT9c 2EYMA 5FJ8G 2K5QA 2GA4B 3PO2H 4Q5VA 1CA6A 1QJOA 1XMQQ 3SE0A 3URYA 1Y8PB 5FLXE 3FVQA 3J81j 1ZYRD 4QUCA 2RSNA 5JPMC 2RVLA 1QVGA 4JPBW 5IP7H 2ZJPA 3KYHC 1PH1A 1HH2P 1BBWA 2EY1A 3V96A 4YCUA 3DA3A 1B44D 5C4HA 1BCPC 3OHXC 3CMAA 3AFPA 3RZOH 1YNND 1JQYD 5EKLA 4A3EB 5K5PA 5EPJA 5C3XA 4GN4B 5HGIA 4UP9A 1KIXA 4HTHA 2RA4A 1WD0A 1A0IA 4UHVA 5GROA 5KNDA 5M3MH 3H15A 3CCRA 4F87A 1Q12A 1VQCA 3OTOQ 2F0KA 1VMPA 2BE5C 4H0LC 3CC7A 2NVTH 1S5DD 1VQ5A 5TSSA 2QSBA 4UP7A 2VY3A 3RD4A 1Y1VG 3NWTA 1AFPA 1Y1WG 4N9PA 4AS2A 2DGYA 5GAHC 4IFDJ 4BA2I 3MFYA 3C1FA 4NPSA 1EIGA 1VF5C 4KN4C 1QILA 3EROA 3CQZH 1IW7C 3F8TA 4PL4A 2R7ZB 2EYOA 2R93H 4TVAB 3W1BA 2NBFA 2D0OA 2CH4W 3H09A 3D6WA 4A3EG 4XQJA 2F6MB 2LXKA 5C0XJ 1I5FA 3LNNA 4CKCA 1B7YB 4LF4Q 1WTRA 2A6ED 5M9OA 4DV4Q 4DR1Q 1GUWA 2R7ZG 1N36Q 1CK1A 2MJFB 2KHJA 2FU2A 2D2CC 1BQQT 4QCLA 4LFBQ 2QKIC 3JAML 4A3FH 1DZ1A 2F0PA 3S16H 2F0DA 4RCOA 3TZUA 1VQ6A 1STHA 3VR2A 4JV5Q 3MC0B 3OW2A 3I3CA 2AHOB 2ZW3A 1EFWA 1NY4A 4RG1A 1N9WA 3RZOB 1C9OA 5A2QL 1G8ZD 2B29A 2Z8LA 3PCOB 5F2DA 2CW0D 3HG9A 4DR6Q 1PLFA 1P16A 3OYYA 3GDEA 2BE5D 3KBXA 3MHBA 2L12A 4JI2Q 3M7GA 1WTHA 4PMWA 3JAMc 1N34Q 4TSSA 4LFCQ 1J5EL 5AJ3L 2UUCQ 4DR4Q 3RZDB 3H3VH 3SXHA 2JA5G 4NXML 1PV4A 1I3QH 3S15B 2FFKB 1JR0D 1EWIA 2YTVA 3K8AA 5LMNQ 4KD3A 2HT1A 3K7UC 5C4JH 2JA9A 1Q82C 2QF7A 2WIIB 4A3GH 4IFDG 2Q2TA 4PV1C 3NTIA 3GTQB 2JA8B 1TWFH 2VL6A 1G6ZA 2FEFA 1CUKA 2LFNA 1Q81C 1B70B 4DV3Q 4NXNQ 1S40A 3J7AV 5CV7A 5D65A 3EIVA 4WFN3 2QW7A 4LMQD 2M2LA 1NMGA 4GOPA 4DGZA 4B08A 1LTBD 2VUMB 4G57A 1YI2A 1A8VA 3LX0A 2HQLA 4JI4Q 1TXYA 4X65Q 4JI4L 4A3MB 5E4WC 2NVYB 5EPLA 3HOXH 2UU9Q 4BY7B 3OMGA 4KN7C 1LM0A 4LNQA 3Q0AA 3PV0A 1MJEA 4NXNL 3NBHA 1DD2A 1G51A 2L15A 3KOJA 4H02A 2R93G 2CQAA 1XMOL 2NVXB 1AE3A 4HEA1 2NZHA 5GAEC 3S1QB 2DJGC 2K50A 4M1UB 1E24A 2FXQA 4C3HG 1PMRA 2OF1A 1F2YA 1KQSA 1NE3A 1SMYD 4A3JB 4G7OC 3AMUA 1T9HA 2JJQA 1FR3A 4DXGA 5CBEE 1SLJA 3MEHA 2K01A 4KJOA 3WDNA 4GLXA 5EBCA 3EJIA 4LF8Q 1VQJA 1WOCA 5IYCG 1ET6A 2YV5A 3H94A 5C0XG 1J5EQ 5A2QE 2XIWA 5CV5A 5IT9E 3A0JA 5IY0A 1EEFD 2WAQG 1WI5A 2F4VL 2IX1A 3Q24A 1D5MC 3P75A 3B55A 3I4MH 3A54A 3ERSX 1H9SB 2B63H 1G2TA 2K5VA 1S72A 5M5YB 4DR5Q 3ULJA 3FDTA 2EYHA 3PIPA 2EJMA 4BBRH 4LF6Q 2HDMA 1CKNA 4G75A 3PO2G 1PTOB 3AYHB 1JICA 4E6IA 3I55A 1PHJA 3S2HH 1SE2A 1BO0A 4OONA 2A8VA 1HXYD 4JI6L 1HNZQ 1YHQA 3HOXB 1BBUA 4IUPA 1S5BD 3U4VA 3QB3A 3ULLA 3CCEA 3CCQA 1JJCB 3S15H 1S3OA 2PW5A 2VUMH 4KI0A 1NUCA 3U4ZA 4LF7Q 1SROA 1C4QA 4G7ZC 2HGKA 3JSBA 2WACA 4GNXA 4RMFA 2QZGA 4JYAQ 2AWOA 2TMPA 4Z9CB 1D5XC 2EE1A 2N55A 2V6EA 4ZLTF 2ES2A 4O42A 4JI1Q 1WYDA 1D6EC 3K5NA 4HIOA 1QB5D 1C48A 1WCMG 1SJ8A 4DUYL 3HOVH 4IUUA 1CHPD 2ZXPA 1EYDA 5C5LA 1A3TA 2B2WC 2WFWA 2NYZD 3AQQA 4HJAA 5M5XB 3VR4A 3H6MA 3MTSA 2CWAA 3FP9A 1EY0A 3DA4A 1PFBA 3PUVA 4WORA 3P20A 4XYOA 1WVLA 4K6DA 5CYUA 2I5MX 5KYLA 1A2TA 4B9WA 3BZCA 4YWKA 3IAM1 4A93H 4PQXA 3L7ZC 5ELFA 2A68C 4WJWA 2OWOA 5IODA 3HFZB 1GUOA 2F3IA 2IW3A 1RF2D 2JSOA 4CJ1B 4LFAL 3QO2A 5C4XG 4A3KG 1I94L 2XN9C 4IUQA 4A3FB 2EXDA 1A15A 3X3MA 1NNXA 5DNFA 1EIHA 2GVAA 3I72A 1VQ7A 3A8KE 2JA7B 4IN3A 4OAUC 3NBIA 1HR0L 2YTXA 1EYCA 4NB3A 5C0XI 2Y0SE 4BBSG 3DMUA 1QG7A 1II3A 1STAA 2L5TA 3LWUA 2E2IB 3I56A 1EWHA 3S16B 1MHWC 2LS01 3OPOA 4JC0A 1MIUA 4DF7A 4OX9Q 1IYVA 3O13A 1UE7A 4JI0Q 2XNAC 1MSGA 4LWCA 2IY5B 2ZXRA 1M8AA 3F4MA 3PGZA 4FDBA 4K5XA 2B2UA 4DUYQ 2K14A 2AKWB 4LFBL 4RGOS 2H4OA 3I91A 3SHLA 4C2MH 3HEJA 1C8CA 3K6OA 1I3QB 1XMQL 4BBRG 1JC7A 3S1MH 3J81c 2UU9L 3M3YH 1KHIA 2DNEA 3QIAA 5M5WB 3D4WA 4UP8A 3F2BA 4ZKCB 3G6JB 3GTKH 3E3XA 2E2HB 2QCPX 1WTQA 1YEZA 1RJTA 4C3HB 2K5HA 1S5ED 4ULLA 4JI1L 2AUKA 2N8NA 4MTNA 3SDZA 1EY6A 3GQBA 1Z6HA 3V2TA 4DV7L 1SNQA 1V1PA 5C0XH 1PDQA 3CRKC 1RD9D 3HKZE 2EJFC 2K6AA 5EAYA 3GTJH 1A62A 1YJWA 3TBIB 3PQIA 1IYJB 3M4YA 4RCNA 3I7FA 1NJIC 1SYBA 1F77A 3DXJC 3S1QH 2M9VA 2UUAQ 2OQ0A 3R2TA 1S4ZA 1TWHB 4AIMA 1ICWA 2GVBA 1H9KA 1KLGD 2K1BA 2XTIA 1BCPB 4GNXC 3ZYYX 1JB7A 3C3LA 3GTPB 1L2FA 1GD7A 2EYFA 4CJ0B 5J39A 1L1OC 2RCFA 1VQHA 1YHAA 3FBVA 2QGMA 3DEPA 2E2IH 4APVA 1FGUA 4QJFA 3SK8A 2Z6KA 2WV6D 1I4GA 1SNCA 1FNWA 1HNWL 2K75A 2BOSA 4G7HC 4DR3Q 2EYLA 2QDLA 2PNRC 5EJWA 3RUZA 1HPCA 4UY8C 3L2PA 4ODGA 2PZWA 4TKOB 4B3ML 1RL2A 3PUXA 4HMJA 4K2LA 4JK1C 4OHJA 2VW9A 4ZQ3A 3FPPA 3NUCA 2VQEQ 2F03A 1HHVA 3CPWA 1FJGL 3FKIH 1VQ4A 1HTLD 1LT5D 1N32L 2IT1A 3PUZA 2ZT9C 4HFVA 1F2MA 1J9OA 4DNTB 4QL5A 1WFQA 1U5KA 3VR6A 1IL8A 2HDLA 5BN4A 2JA6G 1SMXA 2NN6I 1Y14B 2MNAA 2F0EA 1O7IA 1V1OA 3KUPA 3MA2B 2F0WA 1JWUD 5GAGC 2F4IA 2KQ3A 5CORA 1EL0A 1RDPD 1JCKB 3LWEA 1GO3E 1GOZA 3EA6A 3PMFA 4BWGB 3IRBA 4I7AA 2A6EC 2F0OA 1HQRD 2BDOA 2AWNA 2KEEA 3JAMi 3J80c 2XTQA 3Q23A 1ENFA 1K28A 4KY6A 3J81E 2JA5B 3SR1A 1QVCA 2Q2UA 4GZYC 1QZGA 1SFOH 1EQTA 2SNMA 1V1PB 5FLMH 2O5JC 1HA5A 3G48A 1T5EA 1G6PA 3ITPA 2MJ8A 2ICIA 4LUVA 1E1TA 2G5DA 3A5UA 3I4LA 1EUJA 3DHQA 1Y8OB 2EIFA 1IBKQ 1PYBA 1QUQB 3OWFA 4YCVA 4JG2A 1K8GA 2BDNA 3HOWG 1VQDA 3A7AB 4U673 2JEAI 3BVZA 1KC8C 1STGA 1MBYA 5M5XH 3I4NG 3G71A 4A3FG 4IO9A 4MN3A 1AZQA 4CJ2C 1DONA 2V4DA 1PRTD 1E1OA 4I65A 1YHBA 5K36H 5KEEA 4A3JG 2B2TA 1M1KC 3OMCA 3TRZA 3L9AX 4XQQA 2JEBI 3T51B 2AMCB 5IP9H 1DM0B 1LTTD 1QNUA 1QE6A 4KJNA 3HOZH 1ZYRC 4A93G 3FHWA 1DOMA 1N34L 3J7YW 2WAQB 3DLLA 1KRSA 5FLMG 4A3CH 4O1NA 2O5IC 1EQVA 2FUG1 1Y1WH 1SNMA 3A8IE 3CD6A 1VQAA 2L11A 3I2ZA 3TDQA 3VYUA 3WOEA 4ME5A 2Q2HA 3QOJA 4NP5A 3L3OC 5M3FG 4ALPA 5JJLA 1GHKA 3K0XA 3R2IA 2IP6A 3KLWA 1X32A 1XJVA 1PFMA 3P1HA 5JJKA 3HS0C 3CCVA 2BH2A 1VF7A 2J0TD 5JEAJ 4JW0A 2Y0SB 2NZ1D 3W1GA 3S1RH 3MFGA 4MIUA 1VS0A 3UI2A 4K8IA 3RN5A 5EPKA 1KRTA 4DXFA 1GUTA 4OWWB 4DV3L 1BVSA 1N8RC 1HFNA 3A5ZB 5KYIA 3I70A 2SEBD 2F0UA 4R4OA 3TMEA 4BA1I 1KDAA 3LGJA 1X9NA 3PF4A 1CZWA 4AYBE 4B3RQ 4A3DB 2ZJRA 2E74C 2EDGA 3BYTB 1R4QB 1ICFB 3WOFA 3TP8A 5E3FA 2ATWA 1SE8A 2KUMA 5JEAH 1ESRA 5C44H 1KTKA 5FKAC 1W2BA 1JWSD 2B8FA 2KHIA 1X56A 4JI6Q 4K8JA 5HGQA 1K8AC 2PI2E 4K5WA 4TQUS 1ZKOA 2IHFA 5FK9C 1B53A 4LFCL 2B2WA 2PMZB 4DUZQ 1SDFA 3EVQA 3CKIB 5JEAG 1VMCA 4FNFA 4IPDA 1SYEA 1CKMA 4C2MB 4LF6L 2BL8A 4RA8A 1SEBD 2KJXA 2G9HD 2A5HA 2JP1A 2ENBA 1PTOD 3L0IA 2FINB 3F1ZA 2SOBA 3MXNA 2Z4IA 1QCBD 3T1YQ 4DAMA 5ELCA 4OXPA 3I4MG 1EQQA 3S1NH 2LXJA 1PYSB 2E2HH 1B4OA 2JB3A 1IBLL 1LTGD 5ELBA 3R3OA 4KY7A 3OWEB 1G91A 1PZJD 1EOTA 1JWMD 4PNYA 2IHEA 2HHHQ 1C0AA 1QVFA 3J80L 1T5XD 1VQIA 2ZM6L 1PH8A 3HOUH 5BR8L 1O7LA 4M8AA 1CSPA 4LF4L 2P5ZX 4KKTA 1RHPA 1Z47A 2RDFA 4KHZA 3NEMA 1U4RA 1E3PA 1U4PA 1R9TH 2UXBQ 4DK6C 1EIFA 3S14B 2RIOA 4NV2A 2PYKA 1KAWA 1ZXTA 2H1EA 1GJXA 1AH9A 3CCUA 2VZAA 1BR9A 3CHBD 2WINB 4B3RL 4POGA 2MFIA 5LMUL 5LMUQ 3J81i 3QJYA 1XNQL 2C5CA 5IGFA 4O2DA 1KDBA 1LUZA 2LMCB 2F0JA 1U4MA 4KHPQ 1OXUA 2F1MA 1KDCA 5BN5A 2F0FA 3PIO3 1Q8IA 1YBYA 1KXLA 5IT9L 1KL9A 2EY6A 3HKSA 2CWPA 2JN4A 4BY7H 1XPRA 1HZBA 1VQOA 5CV6A 3S1RB 5IGEA 3R8BA 3LJ0A 2CW0C 5EBDA 3RLOA 2J7ZA 3I73A 3K5MA 1JQOA 1BCPF 1UEBA 1M4VA 4JBMA 4IFDH 1F2ZA 3ONAB 2RHQB 4QIWB 3PO2B 1A6XA 2ZJQA 4HR7B 2HQEA 4JOIC 4IALA 2NUCA 4BBSH 2L4NA 4KHVA 3GTGH 4KLKA 3ERQA 1IYUA 4LUZA 1ZEQX 1EWCA 4ZUIA 2RQXA 2JA5H 3I4MB 3D4RA 1PXUA 3PUYA 4LF9Q 3CCSA 4P72A 3VYSA 3ICEA 1BXTA 4J15A 5EGTA 1Q1BA 1BF4A 2L0CA 4H13C 3NP8A 2WB1B 1OXVA 3CCJA 3I4OA 3NBHB 1GUGA 3UITA 5C4XH 3ULPA 3GD7A 4R4CA 4X3UA 5CGKA 3GTMB 5M3MB 1TY0A 2EPBA 5C3EG 4JI8L 2X69A 1Q86C 2MO1A 2DY7A 2VQFL 1SFOB 4PL3A 3E0EA 4DK3C 3FNBA 3OTOL 1EY4A 1PRTF 4KKUA 4KK7A 1W3SA 3DUZA 4X62L 3NTHA 2JYOA 1EU3A 1SE4A 3FKIG 1WTOA 3S1NB 4AQYQ 1VCIA 1HA6A 4JVZA 1R9TB 4B3TQ 2ZTDA 1I6HH 3IFDA 2YFBA 1QOHA 2R7FA 1CA5A 4FP5D 4GN5A 4K0KQ 1XNQQ 1A3UA 2OTJA 2UUCL 2BA1A 4EX5A 3F2UA 2Q2IA 4HCEA 4LW1A 5JJZA 2R7ZH 1IKLA 4A3LG 1D5ZC 1VQKA 2ZTCA 2RCNA 1F9RA 4GKJL 2HIXA 2WKDA 4GN3B 3D0FA 3J81L 1RIPA 4CBVA 1B3AA 3ND8A 4R1JA 4OO1G 2CFMA 3RZDH 5C6AA 1TWFB 5DM73 1I6VC 3T1HL 4FXGC 3I8ZA 1JORA 2BCOA 5AFWA 4AYBG 5IWAQ 5KNBA 3AB9A 4RWSC 1CKNB 2K28A 2O2LD 3P23A 3A8JE 4HSPA 1YNJD 1JE4A 2K04A 3MWYW 2CCZA 2VUMG 3KJOA 1ASYA 2NVYH 1N33L 5JJIA 4DV1Q 1FJGQ 4IZ8A 1ENCA 3BVMA 4X66Q 1G2SA 2R92H 3B6YA 1BKBA 3K7AB 4JBWA 2WKCA 2K4KA 4X64Q 2A19A 1C7YA 2NVQH 5CC4A 4DR5L 3RLNA 1EYAA 3NENA 3HOYB 4IQZA 3TREA 1HZCA 1YJNA 3KDFB 3D4DA 3BS1A 1S5FD 4DV2L 1HNXL 1D1IA 1PH2A 4U6RA 3VR5A 1FNUA 3KLSA 2BL7A 1HNZL 1A2UA 4Q9VA 3NPPA 3UDFA 4DR2L 2ZXOA 5AJ3Q 1VQPA 1WTXA 3P7JA 1Y8NB 3HGBA 4OELB 2UXCQ 3GTOH
chains in the Genus database with same CATH topology
1GD7A 1MJCA 4IPHA 4DV4L 4DR1L 1L1OC 1VQHA 1EQRA 1K0RA 1YHAA 2JE6I 3FBVA 1IZ6A 4GN4B 5HGIA 4XTCS 2E2IH 4UP9A 4APVA 1KIXA 4POFA 1FGUA 4G76A 4QJFA 4DV2Q 1A0IA 2Z6KA 5GROA 5M3MH 4X62Q 4PL5A 4PZ6A 2QGQA 3H15A 4LUOA 1SRUA 3CCRA 1HNWL 2K75A 1Q12A 1VQCA 4DR3Q 3T1HQ 2D0PA 4O0AA 3OTOQ 4UY8C 3L2PA 4JBKA 3KJPA 4C3IH 3CC7A 2NVTH 4JV5L 4B3ML 1VQ5A 1RL2A 2QEXA 3PUXA 4UP7A 2VW9A 2CAZB 1L1OA 2A1AA 2VY3A 1I50H 1V1QA 2MQHA 1Y1VG 2VQEQ 2F4VQ 3J7A5 3PIOA 4JI7L 1HZ9A 2N78A 3UDIA 3CPWA 1Y1WG 4LF5Q 1FJGL 1IL2A 3FKIH 1VQ4A 4AS2A 2IT1A 3PUZA 2DGYA 5GAHC 4GKKL 4BA2I 4IFDJ 1N32L 4BXXH 4HFVA 3S2DH 1VQEA 3BJUA 1GKHA 4NPSA 1SN8A 4QL5A 1PH9A 1WFQA 3G4SA 4IFDI 1IBKL 3CQZH 1U5KA 3F8TA 2JA6G 1K3RA 1SMXA 4PL4A 2UXBL 3KP9A 2NN6G 5IP9G 2NN6I 2R93H 1G291 1Y14B 4TVAB 2MNAA 4A4IA 3W1BA 3MXNB 1O7IA 2D0OA 4A3DG 1V9PA 4A3EG 4LFAQ 2NVXH 5GAGC 2F6MB 2LXKA 5C0XJ 2JA7G 1I5FA 5GADC 3M4OH 3STBD 1EIYB 2ASBA 1B7YB 1GO3E 3K80C 4LF4Q 1K9MC 3IRBA 3ER0A 4DV4Q 3HOXG 1OXXK 2ALYB 3DM3A 4DR1Q 4GKJQ 2ZM6Q 2R7ZG 4A3LH 1N36Q 1Q8KA 4BY1H 4IJHA 2MJFB 2KHJA 2AWNA 2UUBQ 3CCMA 3KF8B 4JOIA 3CW2C 3JAMi 1PA6A 3J80c 2K52A 1JJGA 5IYDG 2XTQA 4Z7GA 4DR2Q 4YY3L 4LFBQ 4GXTA 4A3FH 4YCWA 1X54A 4A3MG 1PH4A 1MKHA 4R4IA 1QVCA 1HZAA 4PZ7A 3KFUA 2Q2UA 4A3KH 3S16H 1QZGA 1SFOH 1UE6A 5FLMH 1VQ6A 3G48A 5H1SE 3HOYG 4JV5Q 3KF6B 3GTQH 1G6PA 3OW2A 1PH5A 3CPFA 4LUVA 1E1TA 3A5UA 1EUJA 3T1YL 2AHOB 2EIFA 2I0QA 2YU9H 3HOZG 1IBKQ 1PYBA 4Z7HA 1QUQB 1NY4A 1EFWA 4RG1A 1N9WA 1EYGA 4A3GG 4YCVA 4JG2A 1C9OA 4L5RC 2B29A 3PCOB 1K8GA 3HOWG 3HOYH 4DR6Q 1VQDA 4DV6L 1P16A 2JEAI 3OYYA 3GDEA 1KC8C 1PH6A 2E5LL 5M5XH 4A3JH 4JI2Q 3I4NG 2UXCL 2VNUD 4PMWA 3G71A 4A3MH 3JAMc 5K36G 3M9BA 1N34Q 4BY7G 2UUBL 4LFCQ 4A3FG 3AEVA 1J5EL 5AJ3L 1GVPA 2OQKA 4IO9A 2UUCQ 2JB2A 2PI2A 4DR4Q 1IBMQ 3H3VH 1E1OA 2JB1A 2JA5G 4BY1G 4NXML 1YHBA 4DWLA 1PV4A 3TS2A 4JYAL 1I3QH 3U58A 4A3JG 3I4NH 1HNWQ 1M1KC 1JE5A 3J7ZC 1EWIA 2YTVA 3K8AA 5LMNQ 3TRZA 1OXSC 2BA0A 2JEBI 2HT1A 1L0WA 5IYBG 2AMCB 2WAQE 4NXMQ 3K7UC 2OCEA 5C4JH 4YZDA 5IP9H 4B3SL 2JA9A 1Q82C 4A3GH 3S17H 4IFDG 2Q2TA 3HOZH 3G6EA 4A93G 4WJ4A 1UE5A 1X3GA 3FHWA 1N34L 4GKKQ 3RR5A 1TWFH 2VL6A 1PH7A 4BXXG 2PMZE 3CCLA 2E8GA 1PFSA 2KENA 4MNOA 1KRSA 1CUKA 2I5HA 3DLLA 5FLMG 1Q81C 4I1TA 1B70B 4DV3Q 4NXNQ 4DPGA 1S40A 3RZOH 4JCVE 4HIDA 3EIVA 1X3EA 2FUG1 4DV0Q 1Y1WH 3LJ1A 1NMGA 4GOPA 2R7DA 1UE1A 4P75A 3CD6A 3GTLH 1VQAA 3I2ZA 2WP8J 3S24A 2MO0A 1YI2A 4AS3A 4B3MQ 1L2FA 2Q2HA 1A8VA 1X55A 4LF9L 5M3FG 4YWLA 4ALPA 2HQLA 1GM5A 1TXYA 3K0XA 2K19A 4GLAC 4X65Q 1WJJA 1Q7YC 4JI4L 4JI4Q 2IP6A 3KLWA 3HOXH 1XJVA 2UU9Q 5JJKA 2F66B 3CCVA 2BH2A 2XMXA 1LM0A 1TWAH 2DUDA 5ELOA 5JEAJ 3W1GA 5M3MG 4LNQA 2JA7H 4YZCA 3M4QA 3S1RH 2JAEA 3PV0A 1N32Q 1MJEA 3I9V1 1NMFA 1L1OB 1VS0A 4NXNL 3RN5A 4A3CH 4OWXB 3PF5A 1G51A 2L15A 3KOJA 4H02A 1KRTA 4DV0L 1YO7A 4R4QA 4DV3L 1XMOL 4JI7Q 4OWWB 2JA6H 1AE3A 4HEA1 1BVSA 1N8RC 1VQLA 2UXDQ 3A5ZB 4GOPB 4BA1I 4R4OA 1X9NA 2B63G 3PF4A 2KCTA 3LGJA 1AE2A 4B3RQ 4AYBE 1N36L 1CKOA 2NZHA 3H3VI 5GAEC 2WB1G 1XPOA 2ZJRA 2K50A 3H0GG 1NBWA 4A3IG 1E24A 5IE8A 2FXQA 4HJ8A 1K83H 4AH6A 4B3TL 2H5XA 1HNXQ 1J6QA 4AQYL 1XPUA 4L5SA 1KQSA 1NE3A 1FVIA 1Y1VH 1XNRL 4UPAA 2ATWA 1SE8A 5LMNL 1T9HA 2JJQA 3PO3G 1OXTA 1TWCH 5C44H 3SGIA 1SLJA 3HOUG 1YVCA 4L5TA 4GLXA 1W2BA 2KKMA 3UDGA 4LF8Q 1VQJA 1WOCA 1X56A 2KHIA 3HKZG 5IYCG 4JI6Q 1K8AC 5HGQA 4JI3Q 2PI2E 2YV5A 4TQUS 3UE0A 1FL0A 5C0XG 1J5EQ 3F2DA 2IHFA 4LFCL 4X66L 2R92G 4DUZQ 3A0JA 5IY0A 3GO5A 1XMOQ 2WAQG 5JEAG 1IXRA 2ZRRA 1WI5A 3E9HA 3PSIA 3TS0A 2F4VL 2JQOA 3M85A 2IX1A 1YITA 4IPDA 4A3BH 4XIGS 3I4MH 2UUAL 1E22A 1CKMA 4LF6L 4C3HH 3ERSX 2YFAA 4DNIA 3H0GH 5DLQE 2F52A 3L0IA 4O1OA 2D62A 2ZTEA 3F1ZA 3T1YQ 4YWMA 2B63H 2K5VA 3K7AH 4DAMA 4DR5Q 1S72A 4OXPA 3ULJA 4EQ5A 3I4MG 1EQQA 3S1NH 2LXJA 1VQBA 1PYSB 3PIPA 3F2CA 4BBRH 4LF6Q 1CKNA 4G75A 2E2HH 1IBLL 2JB3A 4QIWE 5BR8Q 3PO2G 3AYHB 4DUZL 3I55A 1PHJA 3S2HH 2IHEA 2NZOA 3J80i 3VDYA 4OONA 3AFQA 2N49A 2BH8A 2HHHQ 2A8VA 4JI3L 1Q46A 1C0AA 1QVFA 4JI6L 1HNZQ 1VQIA 1YHQA 3CC4A 1BBUA 2ZM6L 2A2CA 3U4VA 1PH8A 3HOUH 3RNUA 5C44G 2RF4A 5BR8L 3ULLA 3CCQA 3CCEA 2JA8H 1JJCB 3PO3H 1CSPA 4B3SQ 4LF4L 2YTYA 3S15H 4YHHQ 1S3OA 1Z47A 2VUMH 4KHZA 4KI0A 3NEMA 1UWVA 3U4ZA 4LF7Q 3GTPH 1E3PA 1SROA 1A63A 3L0OA 1R9TH 1YJ9A 1VQNA 1XNRQ 2UXBQ 3JSBA 3EBEA 4GNXA 4RMFA 3U50C 4DK6C 4QY7A 3CC2A 5JJLA 1EIFA 5GQOA 2RIOA 4NV2A 4JYAQ 2AWOA 2WB1E 1KAWA 2VQFQ 2V1CC 1VQFA 3TQYA 1AH9A 3CCUA 2VZAA 3K81C 1KD1C 2V6EA 3STBC 1V43A 2ES2A 2HHHL 3EN2A 5LMNW 4JI1Q 2C35B 1WYDA 4POGA 4B3RL 4HIOA 1PH3A 1N33Q 2XTRA 2MFIA 2PNHA 4PZ8A 5LMUL 2JK8A 1JJ2A 4DR7Q 3TEHB 1WCMG 5LMUQ 1SJ8A 3J81i 4DUYL 1XNQL 1ASZA 2RHSB 3HOVH 4O2DA 4DV6Q 1HR0Q 2VQEL 1D7QA 1LUZA 2E2JH 3W5OA 5M5WH 4KHPQ 1OXUA 2P22B 2CQOA 4Y7NH 3M7NA 3BU2A 5IWAL 1Q1EA 1YBYA 2WFWA 5M3FH 1KXLA 4L5QA 4X65L 3AQQA 1KL9A 4OWTB 4HJAA 3HKSA 2CWPA 1I94Q 2CWAA 4BY7H 1YIJA 1XPRA 1HZBA 1HR0W 3FP9A 4X6AH 5ELNA 5FLXc 1VQOA 3DA4A 2A2DA 3PUVA 4OO1I 3LJ0A 1TWHH 3RLOA 2IX0A 4A3CG 3CP0A 2PQAB 2I5MX 4Y52H 1DGSA 3HOWH 2L1LB 1UEBA 3BZCA 4IPGA 4YWKA 3IAM1 3AJFA 2ID0A 4A93H 3L7ZC 4JBMA 1LTLA 2QA4A 4JI2L 2OWOA 4NV5A 2RHQB 1M90C 3HFZB 1NTGA 4QQBX 4P74A 2ZJQA 5IYBH 5C3EH 2F3IA 4JOIC 1HJPA 1IBLQ 4MZ9A 4BBSH 1Z9FA 2Z0SA 4LFAL 3GTGH 1JMCA 1U0LA 2HIVA 4JI5Q 2I5LX 4A3KG 4KLKA 1I94L 5C4XG 5J3BA 4R4TA 4LF7L 4LUZA 2EXDA 1PVOA 2JA5H 1SR3A 3PUYA 2GVAA 4QGUA 4LF9Q 3CCSA 4P72A 3ICEA 1VQ7A 1IBML 4J15A 1VQMA 2PQAA 2R6GA 4P71A 4OAVB 4OAUC 1Q1BA 4HIMA 3RN2A 4DV7Q 4YZ9A 4DR4L 4JI8Q 2YYZA 4X64L 1HR0L 2YTXA 1OXVA 3CCJA 3I4OA 3NBHB 4GLVB 4NB3A 3RLFA 3UITA 5C0XI 5C4XH 3ULPA 3GD7A 4DR7L 4R4CA 2Y0SE 1P8LA 4DV1L 4BBSG 2KCMA 2Y0SG 4A3EH 4A3DH 1VQGA 5C3EG 1X6OA 4GS3A 4JI8L 4DR6L 3I56A 1VQ9A 1Q86C 2MO1A 4O1PA 2VQFL 2R93G 2LSSA 4PL3A 3E0EA 2EQSA 4JC0A 1MIUA 4DV5L 1X3FA 4DK3C 3KF6A 4DR3L 3GTMH 2KBNA 4OX9Q 1UE7A 3OTOL 4C3JH 4JI0Q 1XTDA 4ME3A 4HIKA 1W3SA 2GN5A 3JC66 5HY6A 4X62L 4LWCA 2IY5B 3CMEA 3FKIG 1QUQA 4P73A 3F4MA 3PGZA 4AQYQ 3DO9A 1VCIA 4JBJA 4JI5L 4YHHL 4B3TQ 4KHPL 2ZTDA 4FDBA 1I6HH 2YFBA 2R7FA 2Z6KC 4A75A 4GN5A 2JA8G 4DUYQ 4A76A 1XNQQ 1X65A 4K0KQ 5IYDH 4IOAA 2K14A 2OTJA 2UUCL 1EOVA 2AKWB 2BA1A 2K5NA 4EX5A 3UDXA 2Q2IA 4LW1A 4YY3Q 4LFBL 3S14H 2R7ZH 1B8AA 4HJ7A 4A3LG 3D31A 3IAS1 1VQKA 3CAMA 2E5LQ 2ZTCA 2RCNA 4WJ3M 2N3SA 1CSQA 2HIXA 4GKJL 3D0FA 4GN3B 4K0KL 1RIPA 3HOVG 4C2MH 4R1JA 4OO1G 2CFMA 3RZDH 3ZJYC 3VA9A 4HJ9A 1WCMH 3CF5A 1JT8A 3LJ2A 1XMQL 3WWVA 4BBRG 3S1MH 1YNXA 3J81c 2UU9L 3M3YH 1KHIA 3T1HL 3UE1A 3SDJA 4OX9L 4IJLA 4UP8A 3F2BA 4GNXB 4DV5Q 4JI0L 4DKAC 4IOCA 4AYBG 5IWAQ 3GTKH 3KDFA 5IP7G 1TWGH 1CKNB 3P23A 3MEFA 3E9IA 1YEZA 4HJ5A 2CCZA 1E7ZA 1LYLA 2K5HA 4DAYB 3KJOA 1ASYA 2VUMG 2NVYH 1N33L 4A3BG 5JJIA 4DV1Q 4LF5L 5LNK1 4JI1L 1FJGQ 4X66Q 4MTNA 2N8NA 1H95A 3Q8DA 2R92H 3B6YA 1BKBA 4JBWA 5E7NA 2VS1A 2XGTA 5FJ8H 5M5YH 4DV7L 2K4KA 4X64Q 4PG3A 2A19A 3BZKA 1C7YA 2NVQH 3HKZE 5EAYA 3GTJH 4LF8L 1YZ6A 5IYCH 1A62A 4DR5L 2OTLA 3NELA 3RLNA 4GOPC 1YJWA 2CKZB 3PUWA 3A74A 3NENA 1IYJB 5IT9c 1NJIC 3I7FA 3TREA 1HZCA 5FJ8G 1K73C 4IPCA 1YJNA 3CXCA 3PO2H 3KDFB 3S1QH 1QZHA 4DV2L 1XMQQ 1HNXL 2UUAQ 2OQ0A 1VQ8A 1PH2A 4U6RA 3M4PA 3J81j 4AIMA 2GVBA 2XTIA 1QVGA 1HNZL 4A3IH 1OTCA 4Q9VA 5IP7H 3UDFA 3KYHC 5AJ3Q 2ZJPA 4GNXC 4DR2L 1VQPA 1PH1A 1BBWA 1HH2P 1JB7A 4YCUA 3DA3A 2UXDL 2UXCQ 1D8LA 2B3GA 3CMAA 3AFPA 3GTOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD7 A;  1MJC A;  4IPH A;  4DV4 L;  4DR1 L;  1L1O C;  1VQH A;  1EQR A;  1K0R A;  1YHA A;  2JE6 I;  1IZ6 A;  4GN4 B;  4XTC S;  2E2I H;  4UP9 A;  4APV A;  1KIX A;  4POF A;  1FGU A;  4QJF A;  4DV2 Q;  1A0I A;  2Z6K A;  5GRO A;  5M3M H;  4X62 Q;  4PZ6 A;  2QGQ A;  3H15 A;  4LUO A;  1SRU A;  3CCR A;  1HNW L;  2K75 A;  1Q12 A;  1VQC A;  4DR3 Q;  3T1H Q;  2D0P A;  4O0A A;  3OTO Q;  4UY8 C;  3L2P A;  4JBK A;  3KJP A;  4C3I H;  3CC7 A;  2NVT H;  4JV5 L;  4B3M L;  1VQ5 A;  1RL2 A;  2QEX A;  3PUX A;  4UP7 A;  2VW9 A;  1L1O A;  2VY3 A;  2A1A A;  1I50 H;  1V1Q A;  1Y1V G;  2MQH A;  2VQE Q;  2F4V Q;  3J7A 5;  3PIO A;  4JI7 L;  1HZ9 A;  2N78 A;  3UDI A;  3CPW A;  1Y1W G;  4LF5 Q;  1FJG L;  1IL2 A;  3FKI H;  1VQ4 A;  1N32 L;  2IT1 A;  3PUZ A;  2DGY A;  5GAH C;  4GKK L;  4BA2 I;  4IFD J;  4BXX H;  3S2D H;  1VQE A;  3BJU A;  1GKH A;  4NPS A;  1SN8 A;  4QL5 A;  1PH9 A;  1WFQ A;  3G4S A;  4IFD I;  1IBK L;  3CQZ H;  1U5K A;  3F8T A;  2JA6 G;  1K3R A;  1SMX A;  2UXB L;  2NN6 G;  5IP9 G;  2NN6 I;  2R93 H;  1G29 1;  1Y14 B;  4TVA B;  2MNA A;  4A4I A;  3W1B A;  3MXN B;  1O7I A;  2D0O A;  4A3D G;  1V9P A;  4A3E G;  4LFA Q;  2NVX H;  5GAG C;  2LXK A;  5C0X J;  2JA7 G;  1I5F A;  5GAD C;  3M4O H;  3STB D;  1EIY B;  2ASB A;  1B7Y B;  1GO3 E;  3K80 C;  4LF4 Q;  1K9M C;  3IRB A;  3ER0 A;  4DV4 Q;  3HOX G;  1OXX K;  2ALY B;  3DM3 A;  4DR1 Q;  4GKJ Q;  2ZM6 Q;  2R7Z G;  4A3L H;  1N36 Q;  1Q8K A;  4BY1 H;  4IJH A;  2KHJ A;  2AWN A;  2UUB Q;  3CCM A;  3KF8 B;  4JOI A;  3CW2 C;  3JAM i;  1PA6 A;  3J80 c;  2K52 A;  1JJG A;  5IYD G;  4DR2 Q;  4YY3 L;  4LFB Q;  4A3F H;  4YCW A;  1X54 A;  4A3M G;  1PH4 A;  1MKH A;  4R4I A;  1QVC A;  1HZA A;  4PZ7 A;  3KFU A;  2Q2U A;  4A3K H;  3S16 H;  1QZG A;  1SFO H;  1UE6 A;  5FLM H;  1VQ6 A;  3G48 A;  5H1S E;  3HOY G;  4JV5 Q;  3KF6 B;  3GTQ H;  1G6P A;  3OW2 A;  1PH5 A;  3CPF A;  4LUV A;  1E1T A;  3A5U A;  1EUJ A;  3T1Y L;  2AHO B;  2EIF A;  2I0Q A;  2YU9 H;  3HOZ G;  1IBK Q;  1PYB A;  1QUQ B;  1EFW A;  1NY4 A;  4A3G G;  4RG1 A;  1N9W A;  1EYG A;  4YCV A;  4JG2 A;  1C9O A;  4L5R C;  2B29 A;  3PCO B;  1K8G A;  3HOW G;  3HOY H;  4DR6 Q;  1VQD A;  4DV6 L;  1P16 A;  2JEA I;  3OYY A;  3GDE A;  1KC8 C;  1PH6 A;  2E5L L;  5M5X H;  4A3J H;  4JI2 Q;  3I4N G;  2UXC L;  2VNU D;  4PMW A;  3G71 A;  4A3M H;  3JAM c;  5K36 G;  3M9B A;  1N34 Q;  4BY7 G;  2UUB L;  4LFC Q;  4A3F G;  3AEV A;  1J5E L;  5AJ3 L;  1GVP A;  2OQK A;  4IO9 A;  2UUC Q;  2PI2 A;  4DR4 Q;  1IBM Q;  3H3V H;  1E1O A;  2JA5 G;  4BY1 G;  4NXM L;  1YHB A;  3TS2 A;  1PV4 A;  4JYA L;  1I3Q H;  3U58 A;  4A3J G;  3I4N H;  1HNW Q;  1M1K C;  1JE5 A;  3J7Z C;  1EWI A;  2YTV A;  3K8A A;  5LMN Q;  3TRZ A;  1OXS C;  2BA0 A;  2JEB I;  2HT1 A;  1L0W A;  5IYB G;  2AMC B;  2WAQ E;  4NXM Q;  3K7U C;  2OCE A;  5C4J H;  5IP9 H;  4B3S L;  2JA9 A;  1Q82 C;  4A3G H;  3S17 H;  4IFD G;  2Q2T A;  3HOZ H;  3G6E A;  4A93 G;  4WJ4 A;  1UE5 A;  1X3G A;  3FHW A;  1N34 L;  4GKK Q;  3RR5 A;  1TWF H;  2VL6 A;  1PH7 A;  4BXX G;  2PMZ E;  3CCL A;  2E8G A;  1PFS A;  2KEN A;  4MNO A;  1KRS A;  1CUK A;  2I5H A;  3DLL A;  5FLM G;  1Q81 C;  3RZO H;  1B70 B;  4DV3 Q;  4NXN Q;  4DPG A;  1S40 A;  4A3C H;  4JCV E;  4HID A;  3EIV A;  1X3E A;  4DV0 Q;  1Y1W H;  1NMG A;  4GOP A;  2R7D A;  1UE1 A;  4P75 A;  3CD6 A;  3GTL H;  1VQA A;  3I2Z A;  2WP8 J;  3S24 A;  2MO0 A;  1YI2 A;  4B3M Q;  1L2F A;  2Q2H A;  1A8V A;  1X55 A;  4LF9 L;  5M3F G;  4YWL A;  4ALP A;  2HQL A;  1GM5 A;  1TXY A;  3K0X A;  4X65 Q;  4GLA C;  1Q7Y C;  1WJJ A;  4JI4 Q;  4JI4 L;  3KLW A;  3HOX H;  1XJV A;  2UU9 Q;  5JJK A;  2BH2 A;  3CCV A;  1LM0 A;  1TWA H;  5JEA J;  2DUD A;  5ELO A;  3W1G A;  5M3M G;  4LNQ A;  2JA7 H;  3M4Q A;  3S1R H;  3PV0 A;  1N32 Q;  1MJE A;  1NMF A;  1L1O B;  1VS0 A;  4NXN L;  3RN5 A;  4OWX B;  3PF5 A;  1G51 A;  2L15 A;  3KOJ A;  4H02 A;  1KRT A;  4DV0 L;  1XMO L;  4R4Q A;  4DV3 L;  4OWW B;  4JI7 Q;  2JA6 H;  1BVS A;  1AE3 A;  1N8R C;  1VQL A;  2UXD Q;  3A5Z B;  4GOP B;  4BA1 I;  4R4O A;  1X9N A;  2B63 G;  3PF4 A;  2KCT A;  3LGJ A;  1AE2 A;  4B3R Q;  4AYB E;  1N36 L;  1CKO A;  2NZH A;  3H3V I;  5GAE C;  2WB1 G;  1XPO A;  2ZJR A;  2K50 A;  3H0G G;  1NBW A;  4A3I G;  1E24 A;  5IE8 A;  2FXQ A;  4HJ8 A;  1K83 H;  4AH6 A;  4B3T L;  2H5X A;  1HNX Q;  1J6Q A;  4AQY L;  1XPU A;  4L5S A;  1KQS A;  1NE3 A;  1FVI A;  1Y1V H;  1XNR L;  4UPA A;  2ATW A;  1SE8 A;  5LMN L;  1T9H A;  2JJQ A;  3PO3 G;  1OXT A;  1TWC H;  5C44 H;  3SGI A;  1SLJ A;  3HOU G;  1YVC A;  4L5T A;  4GLX A;  1W2B A;  3UDG A;  4LF8 Q;  1VQJ A;  1WOC A;  1X56 A;  2KHI A;  3HKZ G;  5IYC G;  4JI6 Q;  1K8A C;  5HGQ A;  4JI3 Q;  2PI2 E;  2YV5 A;  4TQU S;  3UE0 A;  1FL0 A;  5C0X G;  1J5E Q;  3F2D A;  2IHF A;  4LFC L;  4X66 L;  2R92 G;  4DUZ Q;  3A0J A;  5IY0 A;  3GO5 A;  1XMO Q;  2WAQ G;  5JEA G;  1IXR A;  1WI5 A;  3E9H A;  3PSI A;  3TS0 A;  2F4V L;  2IX1 A;  2JQO A;  3M85 A;  4A3B H;  1YIT A;  4IPD A;  4XIG S;  3I4M H;  2UUA L;  1E22 A;  1CKM A;  4LF6 L;  4C3H H;  3ERS X;  4DNI A;  3H0G H;  5DLQ E;  2F52 A;  2D62 A;  2ZTE A;  3F1Z A;  3T1Y Q;  4YWM A;  2B63 H;  2K5V A;  3K7A H;  4DAM A;  4DR5 Q;  1S72 A;  4OXP A;  3ULJ A;  4EQ5 A;  3I4M G;  1EQQ A;  3S1N H;  2LXJ A;  1VQB A;  1PYS B;  3PIP A;  3F2C A;  4BBR H;  4LF6 Q;  1CKN A;  2E2H H;  1IBL L;  4QIW E;  5BR8 Q;  3PO2 G;  3AYH B;  4DUZ L;  3I55 A;  1PHJ A;  3S2H H;  2IHE A;  2NZO A;  3J80 i;  3VDY A;  4OON A;  3AFQ A;  2N49 A;  2BH8 A;  2HHH Q;  2A8V A;  4JI3 L;  1Q46 A;  1C0A A;  1QVF A;  4JI6 L;  1HNZ Q;  1VQI A;  1YHQ A;  3CC4 A;  1BBU A;  2ZM6 L;  3U4V A;  1PH8 A;  3HOU H;  3RNU A;  5C44 G;  2RF4 A;  5BR8 L;  3ULL A;  3CCQ A;  3CCE A;  2JA8 H;  1JJC B;  3PO3 H;  1CSP A;  4B3S Q;  4LF4 L;  2YTY A;  3S15 H;  4YHH Q;  1S3O A;  1Z47 A;  2VUM H;  4KHZ A;  4KI0 A;  3NEM A;  1UWV A;  3U4Z A;  4LF7 Q;  3GTP H;  1E3P A;  1SRO A;  1A63 A;  3L0O A;  1R9T H;  1YJ9 A;  1VQN A;  1XNR Q;  2UXB Q;  3EBE A;  4GNX A;  4RMF A;  3U50 C;  4DK6 C;  4QY7 A;  3CC2 A;  5JJL A;  1EIF A;  5GQO A;  4JYA Q;  2AWO A;  2WB1 E;  1KAW A;  2VQF Q;  1VQF A;  2V1C C;  3TQY A;  1AH9 A;  3CCU A;  2VZA A;  3K81 C;  1KD1 C;  3STB C;  1V43 A;  2ES2 A;  2HHH L;  3EN2 A;  5LMN W;  4JI1 Q;  2C35 B;  1WYD A;  4POG A;  4B3R L;  4HIO A;  1PH3 A;  1N33 Q;  2MFI A;  2PNH A;  4PZ8 A;  1JJ2 A;  5LMU L;  2JK8 A;  4DR7 Q;  3TEH B;  1WCM G;  5LMU Q;  3J81 i;  4DUY L;  1XNQ L;  1ASZ A;  2RHS B;  3HOV H;  4O2D A;  4DV6 Q;  1HR0 Q;  2VQE L;  1D7Q A;  1LUZ A;  2E2J H;  3W5O A;  5M5W H;  4KHP Q;  1OXU A;  2CQO A;  4Y7N H;  3M7N A;  3BU2 A;  5IWA L;  1Q1E A;  1YBY A;  2WFW A;  5M3F H;  1KXL A;  4L5Q A;  4X65 L;  3AQQ A;  1KL9 A;  4OWT B;  4HJA A;  3HKS A;  2CWP A;  1I94 Q;  2CWA A;  4BY7 H;  1YIJ A;  1XPR A;  1HZB A;  1HR0 W;  3FP9 A;  4X6A H;  5ELN A;  5FLX c;  1VQO A;  3PUV A;  4OO1 I;  1TWH H;  3RLO A;  2IX0 A;  4A3C G;  3CP0 A;  2PQA B;  2I5M X;  4Y52 H;  1DGS A;  3HOW H;  1UEB A;  3BZC A;  4IPG A;  4YWK A;  2ID0 A;  4A93 H;  3L7Z C;  4JBM A;  1LTL A;  2QA4 A;  4JI2 L;  2OWO A;  2RHQ B;  1M90 C;  3HFZ B;  1NTG A;  4QQB X;  4P74 A;  2ZJQ A;  5IYB H;  5C3E H;  2F3I A;  4JOI C;  1HJP A;  1IBL Q;  4MZ9 A;  4BBS H;  1Z9F A;  2Z0S A;  4LFA L;  3GTG H;  1JMC A;  1U0L A;  2HIV A;  4JI5 Q;  2I5L X;  4A3K G;  4KLK A;  1I94 L;  5C4X G;  5J3B A;  4R4T A;  4LF7 L;  4LUZ A;  2EXD A;  1PVO A;  2JA5 H;  1SR3 A;  3PUY A;  2GVA A;  4QGU A;  4LF9 Q;  3CCS A;  4P72 A;  3ICE A;  1VQ7 A;  1IBM L;  4J15 A;  1VQM A;  2PQA A;  2R6G A;  4P71 A;  1Q1B A;  4HIM A;  3RN2 A;  4DV7 Q;  4DR4 L;  4JI8 Q;  2YYZ A;  4X64 L;  1HR0 L;  2YTX A;  1OXV A;  3CCJ A;  3I4O A;  3NBH B;  4GLV B;  4NB3 A;  3RLF A;  5C0X I;  5C4X H;  3ULP A;  3GD7 A;  4DR7 L;  4R4C A;  2Y0S E;  1P8L A;  4DV1 L;  4BBS G;  2KCM A;  2Y0S G;  4A3E H;  4A3D H;  1VQG A;  5C3E G;  1X6O A;  4GS3 A;  4JI8 L;  4DR6 L;  3I56 A;  1VQ9 A;  1Q86 C;  2MO1 A;  2VQF L;  2R93 G;  2LSS A;  3E0E A;  2EQS A;  4JC0 A;  1MIU A;  4DV5 L;  1X3F A;  4DK3 C;  3KF6 A;  4DR3 L;  3GTM H;  2KBN A;  4OX9 Q;  1UE7 A;  3OTO L;  4C3J H;  4JI0 Q;  1XTD A;  4ME3 A;  4HIK A;  1W3S A;  2GN5 A;  3JC6 6;  5HY6 A;  4X62 L;  4LWC A;  2IY5 B;  3CME A;  3FKI G;  1QUQ A;  4P73 A;  3PGZ A;  4AQY Q;  1VCI A;  4JI5 L;  4JBJ A;  4YHH L;  4B3T Q;  4KHP L;  2ZTD A;  4FDB A;  1I6H H;  2R7F A;  2Z6K C;  4A75 A;  4GN5 A;  2JA8 G;  4DUY Q;  4A76 A;  1XNQ Q;  1X65 A;  4K0K Q;  5IYD H;  4IOA A;  2K14 A;  2OTJ A;  2UUC L;  1EOV A;  2AKW B;  2BA1 A;  2K5N A;  4EX5 A;  3UDX A;  2Q2I A;  4LW1 A;  4YY3 Q;  4LFB L;  3S14 H;  2R7Z H;  1B8A A;  4HJ7 A;  4A3L G;  3D31 A;  1VQK A;  3CAM A;  2E5L Q;  2ZTC A;  2RCN A;  4WJ3 M;  2N3S A;  1CSQ A;  2HIX A;  4GKJ L;  3D0F A;  4GN3 B;  4K0K L;  1RIP A;  3HOV G;  4C2M H;  4R1J A;  4OO1 G;  2CFM A;  3RZD H;  3ZJY C;  4HJ9 A;  1WCM H;  3CF5 A;  1JT8 A;  1XMQ L;  3WWV A;  4BBR G;  3S1M H;  1YNX A;  3J81 c;  2UU9 L;  3M3Y H;  1KHI A;  3T1H L;  3UE1 A;  4OX9 L;  4IJL A;  4UP8 A;  3F2B A;  4GNX B;  4DV5 Q;  4JI0 L;  4DKA C;  4IOC A;  4AYB G;  5IWA Q;  3GTK H;  3KDF A;  5IP7 G;  1TWG H;  1CKN B;  3MEF A;  3E9I A;  1YEZ A;  4HJ5 A;  2CCZ A;  1E7Z A;  1LYL A;  2K5H A;  4DAY B;  3KJO A;  1ASY A;  2VUM G;  2NVY H;  1N33 L;  4A3B G;  5JJI A;  4DV1 Q;  4LF5 L;  1FJG Q;  4JI1 L;  4X66 Q;  4MTN A;  2N8N A;  1H95 A;  3Q8D A;  2R92 H;  3B6Y A;  1BKB A;  4JBW A;  5E7N A;  2VS1 A;  2XGT A;  5FJ8 H;  5M5Y H;  4DV7 L;  2K4K A;  4X64 Q;  4PG3 A;  2A19 A;  3BZK A;  1C7Y A;  2NVQ H;  3HKZ E;  5EAY A;  3GTJ H;  4LF8 L;  1YZ6 A;  5IYC H;  1A62 A;  4DR5 L;  2OTL A;  3NEL A;  3RLN A;  4GOP C;  1YJW A;  2CKZ B;  3PUW A;  3A74 A;  3NEN A;  1IYJ B;  5IT9 c;  1NJI C;  3I7F A;  3TRE A;  1HZC A;  5FJ8 G;  1K73 C;  4IPC A;  1YJN A;  3CXC A;  3PO2 H;  3KDF B;  3S1Q H;  1QZH A;  4DV2 L;  1XMQ Q;  1HNX L;  2UUA Q;  2OQ0 A;  1VQ8 A;  1PH2 A;  3M4P A;  3J81 j;  4AIM A;  2GVB A;  2XTI A;  1QVG A;  1HNZ L;  4A3I H;  1OTC A;  5IP7 H;  3UDF A;  3KYH C;  5AJ3 Q;  2ZJP A;  4GNX C;  4DR2 L;  1VQP A;  1PH1 A;  1BBW A;  1HH2 P;  1JB7 A;  4YCU A;  2UXD L;  2UXC Q;  1D8L A;  2B3G A;  3CMA A;  3AFP A;  3GTO H; 
#chains in the Genus database with same CATH topology
 5EKI A;  1MJC A;  2PZT A;  1EQR A;  1SXT A;  2JE6 I;  3R93 A;  3Q22 A;  3U9O A;  1CFM A;  3D6C A;  3GTG B;  4POF A;  3OIQ A;  4DV2 Q;  1GUS A;  2C9O A;  4LUO A;  1SRU A;  5IIF A;  4LK1 C;  3T1H Q;  1STN A;  2IWH A;  3KJP A;  4C3I H;  4JV5 L;  4CDC C;  2QEX A;  5EQ0 A;  1L1O A;  1BUV T;  1I50 H;  3J7A 5;  2MQH A;  3DWA A;  2F4V Q;  3PIO A;  3N6R A;  1HZ9 A;  2N78 A;  2B2Y C;  3UDI A;  4XT1 B;  1IL2 A;  1MSH A;  3KF8 A;  2RBM A;  5CV8 A;  2OXP A;  4GKK L;  3S2D H;  1VQE A;  3BJU A;  1GKH A;  5C3E B;  4X3T A;  3NK9 A;  4IFD I;  1IBK L;  4IUV A;  1K3R A;  4A3I B;  2UXB L;  3KP9 A;  3E6Z X;  5IP9 G;  1G29 1;  5G3L F;  4A4I A;  3MXN B;  4I7Z C;  3J80 E;  1V9P A;  1S5C D;  4C3I B;  4XXE A;  2JA7 G;  4RGM A;  5GAD C;  5ISR A;  3A56 A;  2MUY A;  3STB D;  3K80 C;  1SE3 A;  1K9M C;  1H9R A;  3ER0 A;  3HOX G;  1OXX K;  3DM3 A;  4A3L H;  2ZM6 Q;  1Q8K A;  1TS3 A;  4IJH A;  3T4A C;  2A73 B;  3DM1 A;  3KF8 B;  4JOI A;  3CW2 C;  1PA6 A;  1JJG A;  5IYD G;  4Z7G A;  4DR2 Q;  4YY3 L;  1B3Q A;  1PFN A;  1E2W A;  1X54 A;  4RH6 A;  1PH4 A;  4R4I A;  1HUM A;  2FMM A;  1EEI D;  1PZI D;  4A3K H;  2QEJ C;  4ZYS A;  5JPN C;  4HCS A;  5H1S E;  3HOY G;  3KF6 B;  2A69 C;  3GTQ H;  1PH5 A;  3GTJ B;  2RDG A;  3E5S A;  3T1Y L;  2KA7 A;  2AUJ D;  2I0Q A;  5FO9 B;  4A3G G;  3GTO B;  2K03 A;  2D5D A;  1TQO A;  2F0M A;  1RKN A;  3MVV A;  5COY A;  4CKE A;  3HOZ B;  5BN3 A;  1TDP A;  2VNU D;  4HN7 A;  3K58 A;  3T13 A;  4A3M H;  4F8M A;  2UUB L;  3FRP B;  1E2V A;  1GVP A;  2OEO A;  3M4O B;  1AW7 A;  4ABN A;  1IBM Q;  4C56 C;  1STB A;  1DCZ A;  4BY1 G;  1XWE A;  3TS2 A;  1BCP D;  2IJ0 A;  2CHB D;  1HNW Q;  1JE5 A;  1F9P A;  1EY9 A;  3J7Z C;  4DA2 A;  5EKK A;  2B39 A;  3S2H B;  1OXS C;  1XX8 A;  2BA0 A;  5E1F A;  4NXM Q;  5KRU A;  4TRD A;  2NN6 H;  4B3S L;  4QF4 A;  1TWG B;  1NR2 A;  3S17 H;  1NCV A;  1FD7 D;  1H9J A;  1UE5 A;  1X3G A;  1SBB B;  3H0G B;  2NTT A;  4EQP A;  4L8J A;  4NW2 A;  1Q3L A;  2PW7 A;  4GKK Q;  4BXX G;  3VR3 A;  5I2Y A;  2J4X A;  4ILW A;  3HZX A;  4I1T A;  1HUN A;  5C44 B;  4DPG A;  2YU9 B;  3C1E A;  1X3E A;  4KV6 A;  4C1N I;  2K33 A;  2R7D A;  3FKI B;  1O7Z A;  1UE1 A;  3GTL H;  1FYC A;  2MO0 A;  4AS3 A;  4B3M Q;  4YWL A;  2D9U A;  3GTM H;  2M00 A;  2RLD A;  1Q7Y C;  2K19 A;  4FYD A;  1ENA A;  1WJJ A;  3AU7 A;  3GV3 A;  3MXU A;  1TWA H;  2L1B A;  2DUD A;  2DN8 A;  3IFT A;  2JA7 H;  2F0V A;  4YZC A;  4J1M A;  2JXM B;  1N32 Q;  3I9V 1;  3EFX D;  5JVH 3;  2LKV A;  4FO2 A;  3PF5 A;  1YO7 A;  5NUC A;  5HGT A;  4JI7 Q;  2XVS A;  1LAB A;  2L9H A;  4GOP B;  2B63 G;  2KCT A;  3SK5 A;  1CKO A;  3H3V I;  2WB1 G;  4KY5 A;  1XPO A;  3H0G G;  3QWN A;  1AP0 A;  4A3I G;  5IE8 A;  1JOQ A;  1W6J A;  1TR5 A;  4AH6 A;  4B3T L;  4J8Q A;  2I46 A;  1I4Q A;  5JOB A;  1K3B C;  3MXP A;  3GP7 A;  1Y1V H;  1CHQ D;  4FF1 A;  2NB0 A;  3PO3 G;  2KEC A;  1NAP A;  4L63 B;  1OXT A;  1TWC H;  3SGI A;  3HOU G;  1ML0 D;  2KKM A;  3HKZ G;  1KLU D;  3S1M B;  1NSN S;  1FNV A;  2VB3 X;  3SK6 A;  3F2D A;  2A6H C;  4X66 L;  5KNC A;  2A69 D;  4K14 A;  3GO5 A;  3GTK B;  1IXR A;  3PSI A;  3TS0 A;  4A3B H;  2JQO A;  5ELD A;  4G4K A;  4N9T A;  3D3R A;  3TZD A;  4C3H H;  5G3L D;  2YFA A;  2K5W A;  3H0G H;  2F3V A;  2F52 A;  2Z9H A;  1I4X A;  3QG1 A;  2D62 A;  2ZTE A;  2JA6 B;  3VYR A;  4YWM A;  1O78 A;  1Z7T A;  3I90 A;  2R3Z A;  3F2C A;  4XYQ A;  5BR8 Q;  2EVB A;  4EQO A;  2G9D A;  4DUZ L;  2NZO A;  2Z4H A;  2N49 A;  2BH8 A;  4JI3 L;  5LL6 X;  3QOL A;  4C3J B;  3RNU A;  5C44 G;  2Z1C A;  2AQ3 B;  2JA8 H;  1K8M A;  3BYY B;  3GTP H;  2IL8 A;  2Q8I B;  1IHZ A;  1A63 A;  1VQN A;  4CKB A;  2KED A;  3EBE A;  3X3N A;  3U50 C;  3CC2 A;  5GQO A;  2WB1 E;  1VQF A;  3BZD B;  1TWA B;  3K81 C;  3STB C;  3OOC A;  2HHH L;  3K5O A;  5IGD A;  2MPM A;  1PH3 A;  1N33 Q;  2XTR A;  1PTO C;  4AYB B;  1JJ2 A;  1Y1V B;  3TEH B;  1XXG A;  1Y1W B;  4DV6 Q;  2OT2 A;  1QNK A;  1WCM B;  5E4X A;  1HR0 Q;  1QWY A;  3W5O A;  2EY2 A;  2RSO A;  2P22 B;  2CQO A;  2SDF A;  4Y7N H;  3M7N A;  2Z6B A;  3BU2 A;  3T56 B;  4OGQ C;  5IWA L;  4BBS B;  1JB3 A;  5M3F H;  1F9S A;  2MGS A;  4RGN A;  1X3Q A;  2AQ1 B;  4OWT B;  2XWB B;  1IKM A;  1YIJ A;  4ZUJ A;  3E0J A;  5ELN A;  4OL7 A;  4OIK A;  4EVO A;  3K5L A;  1BBX C;  4OO1 I;  4A3C G;  3SK4 A;  1DGS A;  1MD2 D;  2F0H A;  2CVR A;  3HKZ B;  3AJF A;  1TS2 A;  1TU2 B;  2ID0 A;  2PZU A;  1SMY C;  1O80 A;  1M90 C;  4P74 A;  5IYB H;  3FMC A;  4RHS A;  5C3E H;  1GUN A;  1AN8 A;  2E75 C;  4MZ9 A;  5A35 A;  1SJH D;  1Z9F A;  4FVM A;  5M3F B;  3T53 B;  3TP7 A;  5J3B A;  3HRZ C;  2XRS D;  1TWC B;  1SR3 A;  5C3W A;  3HOV B;  4RKL A;  1PTO F;  2PQA A;  1SYC A;  2NVT B;  2HCI A;  4DV7 Q;  4DR4 L;  2YYZ A;  5J22 A;  5DAU A;  4GLV B;  2B63 B;  3RLF A;  5I6W A;  4DR7 L;  4DV1 L;  1LAC A;  2KCC A;  4A3E H;  1TS5 A;  1X6O A;  4DR6 L;  1Y69 U;  4A3K B;  1PYW D;  2EY5 A;  1SJE D;  2PCF B;  1X3F A;  3KF6 A;  3CQZ B;  4DR3 L;  2KBN A;  1XTD A;  4ME3 A;  4YIJ A;  4NKL A;  3H91 A;  3CME A;  1EY8 A;  4DAV A;  4EGV A;  3DO9 A;  5CV9 A;  1LT6 D;  4JI5 L;  4YHH L;  2XRQ D;  3K57 A;  2Z6K C;  4X3S A;  4A75 A;  1ILQ A;  4A76 A;  2JA8 G;  1X65 A;  5I9O A;  1K83 B;  3IL8 A;  4C3I G;  4YY3 Q;  2Q8R E;  3J7A F;  4H7B A;  4HJ7 A;  3D31 A;  3IAS 1;  1LT4 D;  2E5L Q;  4WJ3 M;  2MHV A;  2N3S A;  1CSQ A;  3FVV A;  2F0S A;  1BOS A;  3BG3 A;  4ZCK A;  5CMD A;  5I2X A;  5IGC A;  3W2D A;  1KNA A;  1Q90 A;  4K6L A;  4HJ9 A;  3WWV A;  2RDH A;  1ET9 A;  4PMB A;  3UE1 A;  3IKJ A;  1HRJ A;  4DV5 Q;  3IAY A;  4BY1 B;  2X6L A;  5IP7 G;  1HQM C;  1CM9 A;  1TWG H;  1SYG A;  2A74 C;  3C46 A;  5I4D A;  4HJ5 A;  2E2D C;  1E7Z A;  1DOK A;  4DFA A;  4A3B G;  1K0S A;  2VB2 X;  5CBA E;  1H95 A;  3NQI A;  5M5Y H;  5FJ8 H;  4HMI A;  2VS1 A;  4R9W A;  3NSW A;  4PG3 A;  3BZK A;  3GTL B;  4LF8 L;  5IYC H;  4F7X A;  2OTL A;  3OIP A;  4GOP C;  3TP6 A;  2DNC A;  1CI3 M;  1F9Q A;  1K73 C;  4IPC A;  4XT3 B;  3CXC A;  2NTS A;  1EZ8 A;  1QZH A;  4V0B A;  2QIL A;  1VQ8 A;  1CZG A;  3M4P A;  4OEM B;  4DAY A;  4B9X A;  2ICE C;  1WD1 A;  4A3I H;  1OTC A;  5LHY 1;  2UXD L;  1D8L A;  2B3G A;  4IPH A;  4DV4 L;  4DR1 L;  1K0R A;  5FOB B;  4R8I A;  1IZ6 A;  4XTC S;  2K05 A;  4G76 A;  4OO1 H;  4X62 Q;  4PL5 A;  4PZ6 A;  1DXM A;  1I4H A;  2QGQ A;  2LY7 A;  4CGY B;  4K5V A;  2D0P A;  2PPB C;  1B1Z A;  4O0A A;  4JBK A;  2KHS A;  1EU4 A;  4H44 C;  2CAZ B;  1AEX A;  2A1A A;  2B2V A;  1V1Q A;  1ESF A;  4JI7 L;  3NQT A;  4LF5 Q;  2ETD A;  5JAV A;  4RKB A;  2B2V C;  1GHJ A;  4CHT B;  4BXX H;  1PZK D;  1R4P B;  1ILP A;  2DJF C;  2L55 A;  1SN8 A;  2FJ2 A;  2IX3 A;  5ELE A;  4CDD C;  3G4S A;  4NMZ A;  1PH9 A;  3JAM E;  2NN6 G;  3KK7 A;  1B2T A;  1WTW A;  2KCN A;  3CU7 A;  4A3D G;  2NVX H;  4N8F A;  4LFA Q;  4HED A;  3M4O H;  1TKW B;  2HUG A;  1EIY B;  2ASB A;  4HSV A;  1A3V A;  4F88 A;  4GKJ Q;  2ALY B;  5J1Z A;  4BY1 H;  3VA7 A;  2UUB Q;  3CCM A;  4UDU C;  3HP3 A;  4ZKB B;  2K52 A;  5I9P A;  4GXT A;  4YCW A;  3KBG A;  4A3M G;  1MKH A;  3KFU A;  1HZA A;  4PZ7 A;  1UNS A;  2XWJ B;  4XDX A;  1UE6 A;  2RKS A;  1KNE A;  2N88 A;  1TS4 A;  1SNO A;  3CPF A;  5FO8 B;  4FF4 A;  1SYD A;  3PIP 3;  3HOZ G;  2YU9 H;  4Z7H A;  1HTP A;  1EYG A;  5T1G A;  4L5R C;  3HOY H;  4WRD A;  4DV6 L;  1TII D;  2K7V A;  4ZRZ A;  1W6K A;  1PH6 A;  2E5L L;  4A3J H;  3N52 A;  4FF2 A;  2UXC L;  1LLR D;  4CDF C;  5K36 G;  3M9B A;  4BY7 G;  1ROD A;  2CH4 A;  2R92 B;  3AEV A;  1CQF A;  2OQK A;  1H9M A;  1TT2 A;  5IOC A;  2JB2 A;  2PI2 A;  2JB1 A;  4JYA L;  4DWL A;  3U58 A;  3I4N H;  1I50 B;  4N8X 1;  4DK0 A;  5KIX A;  3NWS A;  1UEA B;  3A7L A;  5CR3 A;  3FPU B;  2FMC A;  1KAA A;  1L0W A;  5IYB G;  1I4R A;  2WAQ E;  1OO9 B;  2OCE A;  4YZD A;  1JOK A;  3VA5 A;  1HCZ A;  4DN4 M;  2K5D A;  3G6E A;  4WJ4 A;  2JBW A;  3RR5 A;  1PH7 A;  2PMZ E;  3CCL A;  2E8G A;  1PFS A;  2KEN A;  4MNO A;  2I5H A;  3OW7 A;  3Q6S A;  4JCV E;  4HID A;  3GV6 A;  2I07 B;  4DV0 Q;  3LJ1 A;  3S9W A;  4CDE C;  2AQ2 B;  4P75 A;  1LTR D;  1CT1 D;  2WP8 J;  3S24 A;  3S2D B;  3MXG A;  1X55 A;  4LF9 L;  4V19 0;  1GM5 A;  1B9N A;  4GLA C;  1LO5 D;  1YNJ C;  5C4J B;  2F66 B;  1LTS D;  2XMX A;  5ELO A;  5M3M G;  5LL6 S;  3M4Q A;  2JAE A;  1DJR D;  1SAP A;  1NMF A;  1L1O B;  4OWX B;  4DV0 L;  1NR4 A;  1X3P A;  4R4Q A;  4U68 A;  2JA6 H;  2UXD Q;  1VQL A;  4QMG A;  3DWP A;  3SEB A;  1IW7 D;  1AE2 A;  1N36 L;  3DEO A;  1K8O A;  1NBW A;  3TN2 A;  4HJ8 A;  1K83 H;  2A68 D;  4DU9 A;  1STE A;  2H5X A;  1HNX Q;  1J6Q A;  4AQY L;  1XPU A;  4L5S A;  1FVI A;  1XNR L;  4UPA A;  5LMN L;  1U9R A;  2A6H D;  2F3W A;  2F0G A;  1YVC A;  5CV4 A;  4LAA A;  2E76 C;  4L5T A;  3UDG A;  1I6H B;  4QB4 A;  2Q8T A;  4JI3 Q;  3UE0 A;  1FL0 A;  4OIJ A;  1SNP A;  1E2Z A;  1TY2 A;  1XYI A;  2R92 G;  1RCV D;  1ONL A;  1XMO Q;  1DYQ A;  2ZRR A;  3E9H A;  3DWQ A;  3M85 A;  4RGT A;  1YIT A;  4XIG S;  2B2Y A;  2UUA L;  1E22 A;  4FXD A;  1YNN C;  1PRT C;  3KLS X;  1JOO A;  5IGG A;  3HOW B;  1D2B A;  2EZV A;  4DNI A;  3K59 A;  2PQE A;  2EXZ A;  5DLQ E;  4O1O A;  4A93 B;  1MI2 A;  4ZK9 B;  1D1K A;  2HCC A;  2F0L A;  3K7A H;  2QDB A;  2B2T C;  4EQ5 A;  4XQN A;  1SND A;  1VQB A;  3VYT A;  2SNS A;  4QIW E;  1U4L A;  5JVG 3;  4DK1 A;  1L0X B;  1UAP A;  2KOL A;  1AZP A;  4KD4 A;  1LT3 D;  3J80 i;  3VDY A;  3AFQ A;  4RHR A;  2XSC A;  1Q46 A;  3RMH A;  5I6Y A;  3CC4 A;  2A2C A;  1UUP A;  2RF4 A;  2NVQ B;  1FGB D;  4C1N K;  3PO3 H;  4B3S Q;  5D14 A;  2YTY A;  3I4N B;  4YHH Q;  1V8Q A;  1UWV A;  3L0O A;  1O7Y A;  5L37 A;  1YJ9 A;  3NXW A;  1XNR Q;  5IGB A;  4ID6 A;  4QY7 A;  1WTV A;  1EY7 A;  4C3J G;  1PTO H;  3S17 B;  3MAQ A;  2VQF Q;  2V1C C;  3TQY A;  3W3A A;  3ND9 A;  1KD1 C;  2K32 A;  1V43 A;  3EN2 A;  2B8G A;  3NTK A;  2C35 B;  5LMN W;  4RFB A;  3K0Y A;  2PNH A;  4PZ8 A;  1TVX A;  4DNR B;  4DR7 Q;  2JK8 A;  3SVM A;  5DEH A;  3G7L A;  1ASZ A;  3KLR A;  2RHS B;  2FHT A;  1D7Q A;  1EY5 A;  2VQE L;  2KVM A;  2X6G A;  2E2J H;  2F0I A;  5M5W H;  2F0Q A;  1LV9 A;  2F0T A;  4DAP A;  3M3Y B;  4IUR A;  4KMU C;  1Q1E A;  2IPK D;  4PMC A;  4L5Q A;  4X65 L;  2RAD A;  2PO4 A;  1EZ6 A;  1I94 Q;  4IUN A;  1SYF A;  1HR0 W;  1J8I A;  4X6A H;  5FLX c;  5KGU A;  4A3G B;  1LTI D;  4P2C B;  2A2D A;  1CTM A;  4UAI A;  1TWH H;  2IX0 A;  3CP0 A;  4BS9 A;  2VXW A;  2PQA B;  4Y52 H;  3HOW H;  3CRL C;  2L1L B;  2O4X A;  5FLX L;  4IPG A;  2EJG C;  4QUF A;  2NWG A;  3BDO A;  4LJZ C;  1I4P A;  1LTL A;  2QA4 A;  4JI2 L;  2MP1 A;  4NV5 A;  2TSS A;  1MGS A;  4RAU C;  1NTG A;  1SSO A;  4QQB X;  3U9S A;  1HJP A;  3EQL C;  1IBL Q;  1B9M A;  2EYJ A;  2Z0S A;  3FEW X;  1HFG A;  4KKS A;  1JMC A;  1U0L A;  2HIV A;  4JI5 Q;  2I5L X;  4X3K A;  4R4T A;  1F2L A;  4LF7 L;  1CQV A;  2EOT A;  4K2K A;  4J6H A;  1PVO A;  1E0B A;  3H3V C;  1B50 A;  4QGU A;  1IBM L;  1VQM A;  2R6G A;  4P71 A;  4OAV B;  5C5M A;  1DOL A;  3A55 A;  4HIM A;  3RN2 A;  4NDX A;  4YZ9 A;  3D8G A;  4JI8 Q;  4X64 L;  5D3I B;  5T1I A;  2HD3 A;  5DM6 3;  3BVG A;  5FO7 B;  1STY A;  1P8L A;  2KCM A;  2Y0S G;  4A3D H;  4A3B B;  1VQG A;  2B2U C;  1RTN A;  4GS3 A;  1VQ9 A;  4L6T B;  4O1P A;  5HUR A;  2LSS A;  2EQS A;  4DV5 L;  3QR8 A;  5D3D A;  4C3J H;  4HIK A;  1BNZ A;  3PO3 B;  2GSC A;  3JC6 6;  2GN5 A;  1PRT B;  5HY6 A;  3HOU B;  1QUQ A;  4P73 A;  1EFI D;  1KAB A;  4IUT A;  4JBJ A;  4KHP L;  3TSS A;  4MHE A;  1VDZ A;  5IYD H;  4IOA A;  1EOV A;  2K5N A;  4Q0F A;  2F0N A;  3TP5 A;  3BDL A;  4ZAI A;  3UDX A;  3S14 H;  1B8A A;  3CAM A;  5C4Z A;  4K0K L;  4R8N A;  1XTC D;  3HOV G;  1LTA D;  3NHH A;  3ZJY C;  3VA9 A;  2R93 B;  1WCM H;  2E2J B;  3CF5 A;  4FXK C;  1JT8 A;  3LJ2 A;  3V05 A;  1H9S A;  1YNX A;  4HAE A;  4S3S A;  1L0Y B;  5C4X B;  4EQN A;  3SDJ A;  2R61 A;  4OX9 L;  4IJL A;  4GNX B;  4JI0 L;  4DKA C;  4IOC A;  4MTK A;  3T16 A;  3KDF A;  1WTP A;  4BBR B;  2EYP A;  1BDO A;  1RTO A;  3MEF A;  4KTA A;  3E9I A;  3NE5 B;  4FF3 A;  1LYL A;  4DAY B;  4LF5 L;  5LNK 1;  3MZ5 A;  3Q8D A;  5E7N A;  3C2P A;  2XGT A;  3OSO A;  2DY8 A;  4Y7N B;  1YZ6 A;  3NEL A;  1GXD C;  3PUW A;  2CKZ B;  3A74 A;  3BDC A;  5IT9 c;  2EYM A;  5FJ8 G;  2K5Q A;  2GA4 B;  3PO2 H;  4Q5V A;  1CA6 A;  1QJO A;  1XMQ Q;  3SE0 A;  3URY A;  1Y8P B;  5FLX E;  3FVQ A;  3J81 j;  1ZYR D;  4QUC A;  2RSN A;  5JPM C;  2RVL A;  1QVG A;  4JPB W;  5IP7 H;  2ZJP A;  3KYH C;  1PH1 A;  1HH2 P;  1BBW A;  2EY1 A;  3V96 A;  4YCU A;  3DA3 A;  1B44 D;  5C4H A;  1BCP C;  3OHX C;  3CMA A;  3AFP A;  3RZO H;  1YNN D;  1JQY D;  5EKL A;  4A3E B;  5K5P A;  5EPJ A;  5C3X A;  4GN4 B;  5HGI A;  4UP9 A;  1KIX A;  4HTH A;  2RA4 A;  1WD0 A;  1A0I A;  4UHV A;  5GRO A;  5KND A;  5M3M H;  3H15 A;  3CCR A;  4F87 A;  1Q12 A;  1VQC A;  3OTO Q;  2F0K A;  1VMP A;  2BE5 C;  4H0L C;  3CC7 A;  2NVT H;  1S5D D;  1VQ5 A;  5TSS A;  2QSB A;  4UP7 A;  2VY3 A;  3RD4 A;  1Y1V G;  3NWT A;  1AFP A;  1Y1W G;  4N9P A;  4AS2 A;  2DGY A;  5GAH C;  4IFD J;  4BA2 I;  3MFY A;  3C1F A;  4NPS A;  1EIG A;  1VF5 C;  4KN4 C;  1QIL A;  3ERO A;  3CQZ H;  1IW7 C;  3F8T A;  4PL4 A;  2R7Z B;  2EYO A;  2R93 H;  4TVA B;  3W1B A;  2NBF A;  2D0O A;  2CH4 W;  3H09 A;  3D6W A;  4A3E G;  4XQJ A;  2F6M B;  2LXK A;  5C0X J;  1I5F A;  3LNN A;  4CKC A;  1B7Y B;  4LF4 Q;  1WTR A;  2A6E D;  5M9O A;  4DV4 Q;  4DR1 Q;  1GUW A;  2R7Z G;  1N36 Q;  1CK1 A;  2MJF B;  2KHJ A;  2FU2 A;  2D2C C;  1BQQ T;  4QCL A;  4LFB Q;  2QKI C;  3JAM L;  4A3F H;  1DZ1 A;  2F0P A;  3S16 H;  2F0D A;  4RCO A;  3TZU A;  1VQ6 A;  1STH A;  3VR2 A;  4JV5 Q;  3MC0 B;  3OW2 A;  3I3C A;  2AHO B;  2ZW3 A;  1EFW A;  1NY4 A;  4RG1 A;  1N9W A;  3RZO B;  1C9O A;  5A2Q L;  1G8Z D;  2B29 A;  2Z8L A;  3PCO B;  5F2D A;  2CW0 D;  3HG9 A;  4DR6 Q;  1PLF A;  1P16 A;  3OYY A;  3GDE A;  2BE5 D;  3KBX A;  3MHB A;  2L12 A;  4JI2 Q;  3M7G A;  1WTH A;  4PMW A;  3JAM c;  1N34 Q;  4TSS A;  4LFC Q;  1J5E L;  5AJ3 L;  2UUC Q;  4DR4 Q;  3RZD B;  3H3V H;  3SXH A;  2JA5 G;  4NXM L;  1PV4 A;  1I3Q H;  3S15 B;  2FFK B;  1JR0 D;  1EWI A;  2YTV A;  3K8A A;  5LMN Q;  4KD3 A;  2HT1 A;  3K7U C;  5C4J H;  2JA9 A;  1Q82 C;  2QF7 A;  2WII B;  4A3G H;  4IFD G;  2Q2T A;  4PV1 C;  3NTI A;  3GTQ B;  2JA8 B;  1TWF H;  2VL6 A;  1G6Z A;  2FEF A;  1CUK A;  2LFN A;  1Q81 C;  1B70 B;  4DV3 Q;  4NXN Q;  1S40 A;  3J7A V;  5CV7 A;  5D65 A;  3EIV A;  4WFN 3;  2QW7 A;  4LMQ D;  2M2L A;  1NMG A;  4GOP A;  4DGZ A;  4B08 A;  1LTB D;  2VUM B;  4G57 A;  1YI2 A;  1A8V A;  3LX0 A;  2HQL A;  4JI4 Q;  1TXY A;  4X65 Q;  4JI4 L;  4A3M B;  5E4W C;  2NVY B;  5EPL A;  3HOX H;  2UU9 Q;  4BY7 B;  3OMG A;  4KN7 C;  1LM0 A;  4LNQ A;  3Q0A A;  3PV0 A;  1MJE A;  4NXN L;  3NBH A;  1DD2 A;  1G51 A;  2L15 A;  3KOJ A;  4H02 A;  2R93 G;  2CQA A;  1XMO L;  2NVX B;  1AE3 A;  4HEA 1;  2NZH A;  5GAE C;  3S1Q B;  2DJG C;  2K50 A;  4M1U B;  1E24 A;  2FXQ A;  4C3H G;  1PMR A;  2OF1 A;  1F2Y A;  1KQS A;  1NE3 A;  1SMY D;  4A3J B;  4G7O C;  3AMU A;  1T9H A;  2JJQ A;  1FR3 A;  4DXG A;  5CBE E;  1SLJ A;  3MEH A;  2K01 A;  4KJO A;  3WDN A;  4GLX A;  5EBC A;  3EJI A;  4LF8 Q;  1VQJ A;  1WOC A;  5IYC G;  1ET6 A;  2YV5 A;  3H94 A;  5C0X G;  1J5E Q;  5A2Q E;  2XIW A;  5CV5 A;  5IT9 E;  3A0J A;  5IY0 A;  1EEF D;  2WAQ G;  1WI5 A;  2F4V L;  2IX1 A;  3Q24 A;  1D5M C;  3P75 A;  3B55 A;  3I4M H;  3A54 A;  3ERS X;  1H9S B;  2B63 H;  1G2T A;  2K5V A;  1S72 A;  5M5Y B;  4DR5 Q;  3ULJ A;  3FDT A;  2EYH A;  3PIP A;  2EJM A;  4BBR H;  4LF6 Q;  2HDM A;  1CKN A;  4G75 A;  3PO2 G;  1PTO B;  3AYH B;  1JIC A;  4E6I A;  3I55 A;  1PHJ A;  3S2H H;  1SE2 A;  1BO0 A;  4OON A;  2A8V A;  1HXY D;  4JI6 L;  1HNZ Q;  1YHQ A;  3HOX B;  1BBU A;  4IUP A;  1S5B D;  3U4V A;  3QB3 A;  3ULL A;  3CCE A;  3CCQ A;  1JJC B;  3S15 H;  1S3O A;  2PW5 A;  2VUM H;  4KI0 A;  1NUC A;  3U4Z A;  4LF7 Q;  1SRO A;  1C4Q A;  4G7Z C;  2HGK A;  3JSB A;  2WAC A;  4GNX A;  4RMF A;  2QZG A;  4JYA Q;  2AWO A;  2TMP A;  4Z9C B;  1D5X C;  2EE1 A;  2N55 A;  2V6E A;  4ZLT F;  2ES2 A;  4O42 A;  4JI1 Q;  1WYD A;  1D6E C;  3K5N A;  4HIO A;  1QB5 D;  1C48 A;  1WCM G;  1SJ8 A;  4DUY L;  3HOV H;  4IUU A;  1CHP D;  2ZXP A;  1EYD A;  5C5L A;  1A3T A;  2B2W C;  2WFW A;  2NYZ D;  3AQQ A;  4HJA A;  5M5X B;  3VR4 A;  3H6M A;  3MTS A;  2CWA A;  3FP9 A;  1EY0 A;  3DA4 A;  1PFB A;  3PUV A;  4WOR A;  3P20 A;  4XYO A;  1WVL A;  4K6D A;  5CYU A;  2I5M X;  5KYL A;  1A2T A;  4B9W A;  3BZC A;  4YWK A;  3IAM 1;  4A93 H;  4PQX A;  3L7Z C;  5ELF A;  2A68 C;  4WJW A;  2OWO A;  5IOD A;  3HFZ B;  1GUO A;  2F3I A;  2IW3 A;  1RF2 D;  2JSO A;  4CJ1 B;  4LFA L;  3QO2 A;  5C4X G;  4A3K G;  1I94 L;  2XN9 C;  4IUQ A;  4A3F B;  2EXD A;  1A15 A;  3X3M A;  1NNX A;  5DNF A;  1EIH A;  2GVA A;  3I72 A;  1VQ7 A;  3A8K E;  2JA7 B;  4IN3 A;  4OAU C;  3NBI A;  1HR0 L;  2YTX A;  1EYC A;  4NB3 A;  5C0X I;  2Y0S E;  4BBS G;  3DMU A;  1QG7 A;  1II3 A;  1STA A;  2L5T A;  3LWU A;  2E2I B;  3I56 A;  1EWH A;  3S16 B;  1MHW C;  2LS0 1;  3OPO A;  4JC0 A;  1MIU A;  4DF7 A;  4OX9 Q;  1IYV A;  3O13 A;  1UE7 A;  4JI0 Q;  2XNA C;  1MSG A;  4LWC A;  2IY5 B;  2ZXR A;  1M8A A;  3F4M A;  3PGZ A;  4FDB A;  4K5X A;  2B2U A;  4DUY Q;  2K14 A;  2AKW B;  4LFB L;  4RGO S;  2H4O A;  3I91 A;  3SHL A;  4C2M H;  3HEJ A;  1C8C A;  3K6O A;  1I3Q B;  1XMQ L;  4BBR G;  1JC7 A;  3S1M H;  3J81 c;  2UU9 L;  3M3Y H;  1KHI A;  2DNE A;  3QIA A;  5M5W B;  3D4W A;  4UP8 A;  3F2B A;  4ZKC B;  3G6J B;  3GTK H;  3E3X A;  2E2H B;  2QCP X;  1WTQ A;  1YEZ A;  1RJT A;  4C3H B;  2K5H A;  1S5E D;  4ULL A;  4JI1 L;  2AUK A;  2N8N A;  4MTN A;  3SDZ A;  1EY6 A;  3GQB A;  1Z6H A;  3V2T A;  4DV7 L;  1SNQ A;  1V1P A;  5C0X H;  1PDQ A;  3CRK C;  1RD9 D;  3HKZ E;  2EJF C;  2K6A A;  5EAY A;  3GTJ H;  1A62 A;  1YJW A;  3TBI B;  3PQI A;  1IYJ B;  3M4Y A;  4RCN A;  3I7F A;  1NJI C;  1SYB A;  1F77 A;  3DXJ C;  3S1Q H;  2M9V A;  2UUA Q;  2OQ0 A;  3R2T A;  1S4Z A;  1TWH B;  4AIM A;  1ICW A;  2GVB A;  1H9K A;  1KLG D;  2K1B A;  2XTI A;  1BCP B;  4GNX C;  3ZYY X;  1JB7 A;  3C3L A;  3GTP B;  1L2F A;  1GD7 A;  2EYF A;  4CJ0 B;  5J39 A;  1L1O C;  2RCF A;  1VQH A;  1YHA A;  3FBV A;  2QGM A;  3DEP A;  2E2I H;  4APV A;  1FGU A;  4QJF A;  3SK8 A;  2Z6K A;  2WV6 D;  1I4G A;  1SNC A;  1FNW A;  1HNW L;  2K75 A;  2BOS A;  4G7H C;  4DR3 Q;  2EYL A;  2QDL A;  2PNR C;  5EJW A;  3RUZ A;  1HPC A;  4UY8 C;  3L2P A;  4ODG A;  2PZW A;  4TKO B;  4B3M L;  1RL2 A;  3PUX A;  4HMJ A;  4K2L A;  4JK1 C;  4OHJ A;  2VW9 A;  4ZQ3 A;  3FPP A;  3NUC A;  2VQE Q;  2F03 A;  1HHV A;  3CPW A;  1FJG L;  3FKI H;  1VQ4 A;  1HTL D;  1LT5 D;  1N32 L;  2IT1 A;  3PUZ A;  2ZT9 C;  4HFV A;  1F2M A;  1J9O A;  4DNT B;  4QL5 A;  1WFQ A;  1U5K A;  3VR6 A;  1IL8 A;  2HDL A;  5BN4 A;  2JA6 G;  1SMX A;  2NN6 I;  1Y14 B;  2MNA A;  2F0E A;  1O7I A;  1V1O A;  3KUP A;  3MA2 B;  2F0W A;  1JWU D;  5GAG C;  2F4I A;  2KQ3 A;  5COR A;  1EL0 A;  1RDP D;  1JCK B;  3LWE A;  1GO3 E;  1GOZ A;  3EA6 A;  3PMF A;  4BWG B;  3IRB A;  4I7A A;  2A6E C;  2F0O A;  1HQR D;  2BDO A;  2AWN A;  2KEE A;  3JAM i;  3J80 c;  2XTQ A;  3Q23 A;  1ENF A;  1K28 A;  4KY6 A;  3J81 E;  2JA5 B;  3SR1 A;  1QVC A;  2Q2U A;  4GZY C;  1QZG A;  1SFO H;  1EQT A;  2SNM A;  1V1P B;  5FLM H;  2O5J C;  1HA5 A;  3G48 A;  1T5E A;  1G6P A;  3ITP A;  2MJ8 A;  2ICI A;  4LUV A;  1E1T A;  2G5D A;  3A5U A;  3I4L A;  1EUJ A;  3DHQ A;  1Y8O B;  2EIF A;  1IBK Q;  1PYB A;  1QUQ B;  3OWF A;  4YCV A;  4JG2 A;  1K8G A;  2BDN A;  3HOW G;  1VQD A;  3A7A B;  4U67 3;  2JEA I;  3BVZ A;  1KC8 C;  1STG A;  1MBY A;  5M5X H;  3I4N G;  3G71 A;  4A3F G;  4IO9 A;  4MN3 A;  1AZQ A;  4CJ2 C;  1DON A;  2V4D A;  1PRT D;  1E1O A;  4I65 A;  1YHB A;  5K36 H;  5KEE A;  4A3J G;  2B2T A;  1M1K C;  3OMC A;  3TRZ A;  3L9A X;  4XQQ A;  2JEB I;  3T51 B;  2AMC B;  5IP9 H;  1DM0 B;  1LTT D;  1QNU A;  1QE6 A;  4KJN A;  3HOZ H;  1ZYR C;  4A93 G;  3FHW A;  1DOM A;  1N34 L;  3J7Y W;  2WAQ B;  3DLL A;  1KRS A;  5FLM G;  4A3C H;  4O1N A;  2O5I C;  1EQV A;  2FUG 1;  1Y1W H;  1SNM A;  3A8I E;  3CD6 A;  1VQA A;  2L11 A;  3I2Z A;  3TDQ A;  3VYU A;  3WOE A;  4ME5 A;  2Q2H A;  3QOJ A;  4NP5 A;  3L3O C;  5M3F G;  4ALP A;  5JJL A;  1GHK A;  3K0X A;  3R2I A;  2IP6 A;  3KLW A;  1X32 A;  1XJV A;  1PFM A;  3P1H A;  5JJK A;  3HS0 C;  3CCV A;  2BH2 A;  1VF7 A;  2J0T D;  5JEA J;  4JW0 A;  2Y0S B;  2NZ1 D;  3W1G A;  3S1R H;  3MFG A;  4MIU A;  1VS0 A;  3UI2 A;  4K8I A;  3RN5 A;  5EPK A;  1KRT A;  4DXF A;  1GUT A;  4OWW B;  4DV3 L;  1BVS A;  1N8R C;  1HFN A;  3A5Z B;  5KYI A;  3I70 A;  2SEB D;  2F0U A;  4R4O A;  3TME A;  4BA1 I;  1KDA A;  3LGJ A;  1X9N A;  3PF4 A;  1CZW A;  4AYB E;  4B3R Q;  4A3D B;  2ZJR A;  2E74 C;  2EDG A;  3BYT B;  1R4Q B;  1ICF B;  3WOF A;  3TP8 A;  5E3F A;  2ATW A;  1SE8 A;  2KUM A;  5JEA H;  1ESR A;  5C44 H;  1KTK A;  5FKA C;  1W2B A;  1JWS D;  2B8F A;  2KHI A;  1X56 A;  4JI6 Q;  4K8J A;  5HGQ A;  1K8A C;  2PI2 E;  4K5W A;  4TQU S;  1ZKO A;  2IHF A;  5FK9 C;  1B53 A;  4LFC L;  2B2W A;  2PMZ B;  4DUZ Q;  1SDF A;  3EVQ A;  3CKI B;  5JEA G;  1VMC A;  4FNF A;  4IPD A;  1SYE A;  1CKM A;  4C2M B;  4LF6 L;  2BL8 A;  4RA8 A;  1SEB D;  2KJX A;  2G9H D;  2A5H A;  2JP1 A;  2ENB A;  1PTO D;  3L0I A;  2FIN B;  3F1Z A;  2SOB A;  3MXN A;  2Z4I A;  1QCB D;  3T1Y Q;  4DAM A;  5ELC A;  4OXP A;  3I4M G;  1EQQ A;  3S1N H;  2LXJ A;  1PYS B;  2E2H H;  1B4O A;  2JB3 A;  1IBL L;  1LTG D;  5ELB A;  3R3O A;  4KY7 A;  3OWE B;  1G91 A;  1PZJ D;  1EOT A;  1JWM D;  4PNY A;  2IHE A;  2HHH Q;  1C0A A;  1QVF A;  3J80 L;  1T5X D;  1VQI A;  2ZM6 L;  1PH8 A;  3HOU H;  5BR8 L;  1O7L A;  4M8A A;  1CSP A;  4LF4 L;  2P5Z X;  4KKT A;  1RHP A;  1Z47 A;  2RDF A;  4KHZ A;  3NEM A;  1U4R A;  1E3P A;  1U4P A;  1R9T H;  2UXB Q;  4DK6 C;  1EIF A;  3S14 B;  2RIO A;  4NV2 A;  2PYK A;  1KAW A;  1ZXT A;  2H1E A;  1GJX A;  1AH9 A;  3CCU A;  2VZA A;  1BR9 A;  3CHB D;  2WIN B;  4B3R L;  4POG A;  2MFI A;  5LMU L;  5LMU Q;  3J81 i;  3QJY A;  1XNQ L;  2C5C A;  5IGF A;  4O2D A;  1KDB A;  1LUZ A;  2LMC B;  2F0J A;  1U4M A;  4KHP Q;  1OXU A;  2F1M A;  1KDC A;  5BN5 A;  2F0F A;  3PIO 3;  1Q8I A;  1YBY A;  1KXL A;  5IT9 L;  1KL9 A;  2EY6 A;  3HKS A;  2CWP A;  2JN4 A;  4BY7 H;  1XPR A;  1HZB A;  1VQO A;  5CV6 A;  3S1R B;  5IGE A;  3R8B A;  3LJ0 A;  2CW0 C;  5EBD A;  3RLO A;  2J7Z A;  3I73 A;  3K5M A;  1JQO A;  1BCP F;  1UEB A;  1M4V A;  4JBM A;  4IFD H;  1F2Z A;  3ONA B;  2RHQ B;  4QIW B;  3PO2 B;  1A6X A;  2ZJQ A;  4HR7 B;  2HQE A;  4JOI C;  4IAL A;  2NUC A;  4BBS H;  2L4N A;  4KHV A;  3GTG H;  4KLK A;  3ERQ A;  1IYU A;  4LUZ A;  1ZEQ X;  1EWC A;  4ZUI A;  2RQX A;  2JA5 H;  3I4M B;  3D4R A;  1PXU A;  3PUY A;  4LF9 Q;  3CCS A;  4P72 A;  3VYS A;  3ICE A;  1BXT A;  4J15 A;  5EGT A;  1Q1B A;  1BF4 A;  2L0C A;  4H13 C;  3NP8 A;  2WB1 B;  1OXV A;  3CCJ A;  3I4O A;  3NBH B;  1GUG A;  3UIT A;  5C4X H;  3ULP A;  3GD7 A;  4R4C A;  4X3U A;  5CGK A;  3GTM B;  5M3M B;  1TY0 A;  2EPB A;  5C3E G;  4JI8 L;  2X69 A;  1Q86 C;  2MO1 A;  2DY7 A;  2VQF L;  1SFO B;  4PL3 A;  3E0E A;  4DK3 C;  3FNB A;  3OTO L;  1EY4 A;  1PRT F;  4KKU A;  4KK7 A;  1W3S A;  3DUZ A;  4X62 L;  3NTH A;  2JYO A;  1EU3 A;  1SE4 A;  3FKI G;  1WTO A;  3S1N B;  4AQY Q;  1VCI A;  1HA6 A;  4JVZ A;  1R9T B;  4B3T Q;  2ZTD A;  1I6H H;  3IFD A;  2YFB A;  1QOH A;  2R7F A;  1CA5 A;  4FP5 D;  4GN5 A;  4K0K Q;  1XNQ Q;  1A3U A;  2OTJ A;  2UUC L;  2BA1 A;  4EX5 A;  3F2U A;  2Q2I A;  4HCE A;  4LW1 A;  5JJZ A;  2R7Z H;  1IKL A;  4A3L G;  1D5Z C;  1VQK A;  2ZTC A;  2RCN A;  1F9R A;  4GKJ L;  2HIX A;  2WKD A;  4GN3 B;  3D0F A;  3J81 L;  1RIP A;  4CBV A;  1B3A A;  3ND8 A;  4R1J A;  4OO1 G;  2CFM A;  3RZD H;  5C6A A;  1TWF B;  5DM7 3;  1I6V C;  3T1H L;  4FXG C;  3I8Z A;  1JOR A;  2BCO A;  5AFW A;  4AYB G;  5IWA Q;  5KNB A;  3AB9 A;  4RWS C;  1CKN B;  2K28 A;  2O2L D;  3P23 A;  3A8J E;  4HSP A;  1YNJ D;  1JE4 A;  2K04 A;  3MWY W;  2CCZ A;  2VUM G;  3KJO A;  1ASY A;  2NVY H;  1N33 L;  5JJI A;  4DV1 Q;  1FJG Q;  4IZ8 A;  1ENC A;  3BVM A;  4X66 Q;  1G2S A;  2R92 H;  3B6Y A;  1BKB A;  3K7A B;  4JBW A;  2WKC A;  2K4K A;  4X64 Q;  2A19 A;  1C7Y A;  2NVQ H;  5CC4 A;  4DR5 L;  3RLN A;  1EYA A;  3NEN A;  3HOY B;  4IQZ A;  3TRE A;  1HZC A;  1YJN A;  3KDF B;  3D4D A;  3BS1 A;  1S5F D;  4DV2 L;  1HNX L;  1D1I A;  1PH2 A;  4U6R A;  3VR5 A;  1FNU A;  3KLS A;  2BL7 A;  1HNZ L;  1A2U A;  4Q9V A;  3NPP A;  3UDF A;  4DR2 L;  2ZXO A;  5AJ3 Q;  1VQP A;  1WTX A;  3P7J A;  1Y8N B;  3HGB A;  4OEL B;  2UXC Q;  3GTO H; 
#chains in the Genus database with same CATH homology
 1GD7 A;  1MJC A;  4IPH A;  4DV4 L;  4DR1 L;  1L1O C;  1VQH A;  1EQR A;  1K0R A;  1YHA A;  2JE6 I;  3FBV A;  1IZ6 A;  4GN4 B;  5HGI A;  4XTC S;  2E2I H;  4UP9 A;  4APV A;  1KIX A;  4POF A;  1FGU A;  4G76 A;  4QJF A;  4DV2 Q;  1A0I A;  2Z6K A;  5GRO A;  5M3M H;  4X62 Q;  4PL5 A;  4PZ6 A;  2QGQ A;  3H15 A;  4LUO A;  1SRU A;  3CCR A;  1HNW L;  2K75 A;  1Q12 A;  1VQC A;  4DR3 Q;  3T1H Q;  2D0P A;  4O0A A;  3OTO Q;  4UY8 C;  3L2P A;  4JBK A;  3KJP A;  4C3I H;  3CC7 A;  2NVT H;  4JV5 L;  4B3M L;  1VQ5 A;  1RL2 A;  2QEX A;  3PUX A;  4UP7 A;  2VW9 A;  2CAZ B;  1L1O A;  2A1A A;  2VY3 A;  1I50 H;  1V1Q A;  2MQH A;  1Y1V G;  2VQE Q;  2F4V Q;  3J7A 5;  3PIO A;  4JI7 L;  1HZ9 A;  2N78 A;  3UDI A;  3CPW A;  1Y1W G;  4LF5 Q;  1FJG L;  1IL2 A;  3FKI H;  1VQ4 A;  4AS2 A;  2IT1 A;  3PUZ A;  2DGY A;  5GAH C;  4GKK L;  4BA2 I;  4IFD J;  1N32 L;  4BXX H;  4HFV A;  3S2D H;  1VQE A;  3BJU A;  1GKH A;  4NPS A;  1SN8 A;  4QL5 A;  1PH9 A;  1WFQ A;  3G4S A;  4IFD I;  1IBK L;  3CQZ H;  1U5K A;  3F8T A;  2JA6 G;  1K3R A;  1SMX A;  4PL4 A;  2UXB L;  3KP9 A;  2NN6 G;  5IP9 G;  2NN6 I;  2R93 H;  1G29 1;  1Y14 B;  4TVA B;  2MNA A;  4A4I A;  3W1B A;  3MXN B;  1O7I A;  2D0O A;  4A3D G;  1V9P A;  4A3E G;  4LFA Q;  2NVX H;  5GAG C;  2F6M B;  2LXK A;  5C0X J;  2JA7 G;  1I5F A;  5GAD C;  3M4O H;  3STB D;  1EIY B;  2ASB A;  1B7Y B;  1GO3 E;  3K80 C;  4LF4 Q;  1K9M C;  3IRB A;  3ER0 A;  4DV4 Q;  3HOX G;  1OXX K;  2ALY B;  3DM3 A;  4DR1 Q;  4GKJ Q;  2ZM6 Q;  2R7Z G;  4A3L H;  1N36 Q;  1Q8K A;  4BY1 H;  4IJH A;  2MJF B;  2KHJ A;  2AWN A;  2UUB Q;  3CCM A;  3KF8 B;  4JOI A;  3CW2 C;  3JAM i;  1PA6 A;  3J80 c;  2K52 A;  1JJG A;  5IYD G;  2XTQ A;  4Z7G A;  4DR2 Q;  4YY3 L;  4LFB Q;  4GXT A;  4A3F H;  4YCW A;  1X54 A;  4A3M G;  1PH4 A;  1MKH A;  4R4I A;  1QVC A;  1HZA A;  4PZ7 A;  3KFU A;  2Q2U A;  4A3K H;  3S16 H;  1QZG A;  1SFO H;  1UE6 A;  5FLM H;  1VQ6 A;  3G48 A;  5H1S E;  3HOY G;  4JV5 Q;  3KF6 B;  3GTQ H;  1G6P A;  3OW2 A;  1PH5 A;  3CPF A;  4LUV A;  1E1T A;  3A5U A;  1EUJ A;  3T1Y L;  2AHO B;  2EIF A;  2I0Q A;  2YU9 H;  3HOZ G;  1IBK Q;  1PYB A;  4Z7H A;  1QUQ B;  1NY4 A;  1EFW A;  4RG1 A;  1N9W A;  1EYG A;  4A3G G;  4YCV A;  4JG2 A;  1C9O A;  4L5R C;  2B29 A;  3PCO B;  1K8G A;  3HOW G;  3HOY H;  4DR6 Q;  1VQD A;  4DV6 L;  1P16 A;  2JEA I;  3OYY A;  3GDE A;  1KC8 C;  1PH6 A;  2E5L L;  5M5X H;  4A3J H;  4JI2 Q;  3I4N G;  2UXC L;  2VNU D;  4PMW A;  3G71 A;  4A3M H;  3JAM c;  5K36 G;  3M9B A;  1N34 Q;  4BY7 G;  2UUB L;  4LFC Q;  4A3F G;  3AEV A;  1J5E L;  5AJ3 L;  1GVP A;  2OQK A;  4IO9 A;  2UUC Q;  2JB2 A;  2PI2 A;  4DR4 Q;  1IBM Q;  3H3V H;  1E1O A;  2JB1 A;  2JA5 G;  4BY1 G;  4NXM L;  1YHB A;  4DWL A;  1PV4 A;  3TS2 A;  4JYA L;  1I3Q H;  3U58 A;  4A3J G;  3I4N H;  1HNW Q;  1M1K C;  1JE5 A;  3J7Z C;  1EWI A;  2YTV A;  3K8A A;  5LMN Q;  3TRZ A;  1OXS C;  2BA0 A;  2JEB I;  2HT1 A;  1L0W A;  5IYB G;  2AMC B;  2WAQ E;  4NXM Q;  3K7U C;  2OCE A;  5C4J H;  4YZD A;  5IP9 H;  4B3S L;  2JA9 A;  1Q82 C;  4A3G H;  3S17 H;  4IFD G;  2Q2T A;  3HOZ H;  3G6E A;  4A93 G;  4WJ4 A;  1UE5 A;  1X3G A;  3FHW A;  1N34 L;  4GKK Q;  3RR5 A;  1TWF H;  2VL6 A;  1PH7 A;  4BXX G;  2PMZ E;  3CCL A;  2E8G A;  1PFS A;  2KEN A;  4MNO A;  1KRS A;  1CUK A;  2I5H A;  3DLL A;  5FLM G;  1Q81 C;  4I1T A;  1B70 B;  4DV3 Q;  4NXN Q;  4DPG A;  1S40 A;  3RZO H;  4JCV E;  4HID A;  3EIV A;  1X3E A;  2FUG 1;  4DV0 Q;  1Y1W H;  3LJ1 A;  1NMG A;  4GOP A;  2R7D A;  1UE1 A;  4P75 A;  3CD6 A;  3GTL H;  1VQA A;  3I2Z A;  2WP8 J;  3S24 A;  2MO0 A;  1YI2 A;  4AS3 A;  4B3M Q;  1L2F A;  2Q2H A;  1A8V A;  1X55 A;  4LF9 L;  5M3F G;  4YWL A;  4ALP A;  2HQL A;  1GM5 A;  1TXY A;  3K0X A;  2K19 A;  4GLA C;  4X65 Q;  1WJJ A;  1Q7Y C;  4JI4 L;  4JI4 Q;  2IP6 A;  3KLW A;  3HOX H;  1XJV A;  2UU9 Q;  5JJK A;  2F66 B;  3CCV A;  2BH2 A;  2XMX A;  1LM0 A;  1TWA H;  2DUD A;  5ELO A;  5JEA J;  3W1G A;  5M3M G;  4LNQ A;  2JA7 H;  4YZC A;  3M4Q A;  3S1R H;  2JAE A;  3PV0 A;  1N32 Q;  1MJE A;  3I9V 1;  1NMF A;  1L1O B;  1VS0 A;  4NXN L;  3RN5 A;  4A3C H;  4OWX B;  3PF5 A;  1G51 A;  2L15 A;  3KOJ A;  4H02 A;  1KRT A;  4DV0 L;  1YO7 A;  4R4Q A;  4DV3 L;  1XMO L;  4JI7 Q;  4OWW B;  2JA6 H;  1AE3 A;  4HEA 1;  1BVS A;  1N8R C;  1VQL A;  2UXD Q;  3A5Z B;  4GOP B;  4BA1 I;  4R4O A;  1X9N A;  2B63 G;  3PF4 A;  2KCT A;  3LGJ A;  1AE2 A;  4B3R Q;  4AYB E;  1N36 L;  1CKO A;  2NZH A;  3H3V I;  5GAE C;  2WB1 G;  1XPO A;  2ZJR A;  2K50 A;  3H0G G;  1NBW A;  4A3I G;  1E24 A;  5IE8 A;  2FXQ A;  4HJ8 A;  1K83 H;  4AH6 A;  4B3T L;  2H5X A;  1HNX Q;  1J6Q A;  4AQY L;  1XPU A;  4L5S A;  1KQS A;  1NE3 A;  1FVI A;  1Y1V H;  1XNR L;  4UPA A;  2ATW A;  1SE8 A;  5LMN L;  1T9H A;  2JJQ A;  3PO3 G;  1OXT A;  1TWC H;  5C44 H;  3SGI A;  1SLJ A;  3HOU G;  1YVC A;  4L5T A;  4GLX A;  1W2B A;  2KKM A;  3UDG A;  4LF8 Q;  1VQJ A;  1WOC A;  1X56 A;  2KHI A;  3HKZ G;  5IYC G;  4JI6 Q;  1K8A C;  5HGQ A;  4JI3 Q;  2PI2 E;  2YV5 A;  4TQU S;  3UE0 A;  1FL0 A;  5C0X G;  1J5E Q;  3F2D A;  2IHF A;  4LFC L;  4X66 L;  2R92 G;  4DUZ Q;  3A0J A;  5IY0 A;  3GO5 A;  1XMO Q;  2WAQ G;  5JEA G;  1IXR A;  2ZRR A;  1WI5 A;  3E9H A;  3PSI A;  3TS0 A;  2F4V L;  2JQO A;  3M85 A;  2IX1 A;  1YIT A;  4IPD A;  4A3B H;  4XIG S;  3I4M H;  2UUA L;  1E22 A;  1CKM A;  4LF6 L;  4C3H H;  3ERS X;  2YFA A;  4DNI A;  3H0G H;  5DLQ E;  2F52 A;  3L0I A;  4O1O A;  2D62 A;  2ZTE A;  3F1Z A;  3T1Y Q;  4YWM A;  2B63 H;  2K5V A;  3K7A H;  4DAM A;  4DR5 Q;  1S72 A;  4OXP A;  3ULJ A;  4EQ5 A;  3I4M G;  1EQQ A;  3S1N H;  2LXJ A;  1VQB A;  1PYS B;  3PIP A;  3F2C A;  4BBR H;  4LF6 Q;  1CKN A;  4G75 A;  2E2H H;  1IBL L;  2JB3 A;  4QIW E;  5BR8 Q;  3PO2 G;  3AYH B;  4DUZ L;  3I55 A;  1PHJ A;  3S2H H;  2IHE A;  2NZO A;  3J80 i;  3VDY A;  4OON A;  3AFQ A;  2N49 A;  2BH8 A;  2HHH Q;  2A8V A;  4JI3 L;  1Q46 A;  1C0A A;  1QVF A;  4JI6 L;  1HNZ Q;  1VQI A;  1YHQ A;  3CC4 A;  1BBU A;  2ZM6 L;  2A2C A;  3U4V A;  1PH8 A;  3HOU H;  3RNU A;  5C44 G;  2RF4 A;  5BR8 L;  3ULL A;  3CCQ A;  3CCE A;  2JA8 H;  1JJC B;  3PO3 H;  1CSP A;  4B3S Q;  4LF4 L;  2YTY A;  3S15 H;  4YHH Q;  1S3O A;  1Z47 A;  2VUM H;  4KHZ A;  4KI0 A;  3NEM A;  1UWV A;  3U4Z A;  4LF7 Q;  3GTP H;  1E3P A;  1SRO A;  1A63 A;  3L0O A;  1R9T H;  1YJ9 A;  1VQN A;  1XNR Q;  2UXB Q;  3JSB A;  3EBE A;  4GNX A;  4RMF A;  3U50 C;  4DK6 C;  4QY7 A;  3CC2 A;  5JJL A;  1EIF A;  5GQO A;  2RIO A;  4NV2 A;  4JYA Q;  2AWO A;  2WB1 E;  1KAW A;  2VQF Q;  2V1C C;  1VQF A;  3TQY A;  1AH9 A;  3CCU A;  2VZA A;  3K81 C;  1KD1 C;  2V6E A;  3STB C;  1V43 A;  2ES2 A;  2HHH L;  3EN2 A;  5LMN W;  4JI1 Q;  2C35 B;  1WYD A;  4POG A;  4B3R L;  4HIO A;  1PH3 A;  1N33 Q;  2XTR A;  2MFI A;  2PNH A;  4PZ8 A;  5LMU L;  2JK8 A;  1JJ2 A;  4DR7 Q;  3TEH B;  1WCM G;  5LMU Q;  1SJ8 A;  3J81 i;  4DUY L;  1XNQ L;  1ASZ A;  2RHS B;  3HOV H;  4O2D A;  4DV6 Q;  1HR0 Q;  2VQE L;  1D7Q A;  1LUZ A;  2E2J H;  3W5O A;  5M5W H;  4KHP Q;  1OXU A;  2P22 B;  2CQO A;  4Y7N H;  3M7N A;  3BU2 A;  5IWA L;  1Q1E A;  1YBY A;  2WFW A;  5M3F H;  1KXL A;  4L5Q A;  4X65 L;  3AQQ A;  1KL9 A;  4OWT B;  4HJA A;  3HKS A;  2CWP A;  1I94 Q;  2CWA A;  4BY7 H;  1YIJ A;  1XPR A;  1HZB A;  1HR0 W;  3FP9 A;  4X6A H;  5ELN A;  5FLX c;  1VQO A;  3DA4 A;  2A2D A;  3PUV A;  4OO1 I;  3LJ0 A;  1TWH H;  3RLO A;  2IX0 A;  4A3C G;  3CP0 A;  2PQA B;  2I5M X;  4Y52 H;  1DGS A;  3HOW H;  2L1L B;  1UEB A;  3BZC A;  4IPG A;  4YWK A;  3IAM 1;  3AJF A;  2ID0 A;  4A93 H;  3L7Z C;  4JBM A;  1LTL A;  2QA4 A;  4JI2 L;  2OWO A;  4NV5 A;  2RHQ B;  1M90 C;  3HFZ B;  1NTG A;  4QQB X;  4P74 A;  2ZJQ A;  5IYB H;  5C3E H;  2F3I A;  4JOI C;  1HJP A;  1IBL Q;  4MZ9 A;  4BBS H;  1Z9F A;  2Z0S A;  4LFA L;  3GTG H;  1JMC A;  1U0L A;  2HIV A;  4JI5 Q;  2I5L X;  4A3K G;  4KLK A;  1I94 L;  5C4X G;  5J3B A;  4R4T A;  4LF7 L;  4LUZ A;  2EXD A;  1PVO A;  2JA5 H;  1SR3 A;  3PUY A;  2GVA A;  4QGU A;  4LF9 Q;  3CCS A;  4P72 A;  3ICE A;  1VQ7 A;  1IBM L;  4J15 A;  1VQM A;  2PQA A;  2R6G A;  4P71 A;  4OAV B;  4OAU C;  1Q1B A;  4HIM A;  3RN2 A;  4DV7 Q;  4YZ9 A;  4DR4 L;  4JI8 Q;  2YYZ A;  4X64 L;  1HR0 L;  2YTX A;  1OXV A;  3CCJ A;  3I4O A;  3NBH B;  4GLV B;  4NB3 A;  3RLF A;  3UIT A;  5C0X I;  5C4X H;  3ULP A;  3GD7 A;  4DR7 L;  4R4C A;  2Y0S E;  1P8L A;  4DV1 L;  4BBS G;  2KCM A;  2Y0S G;  4A3E H;  4A3D H;  1VQG A;  5C3E G;  1X6O A;  4GS3 A;  4JI8 L;  4DR6 L;  3I56 A;  1VQ9 A;  1Q86 C;  2MO1 A;  4O1P A;  2VQF L;  2R93 G;  2LSS A;  4PL3 A;  3E0E A;  2EQS A;  4JC0 A;  1MIU A;  4DV5 L;  1X3F A;  4DK3 C;  3KF6 A;  4DR3 L;  3GTM H;  2KBN A;  4OX9 Q;  1UE7 A;  3OTO L;  4C3J H;  4JI0 Q;  1XTD A;  4ME3 A;  4HIK A;  1W3S A;  2GN5 A;  3JC6 6;  5HY6 A;  4X62 L;  4LWC A;  2IY5 B;  3CME A;  3FKI G;  1QUQ A;  4P73 A;  3F4M A;  3PGZ A;  4AQY Q;  3DO9 A;  1VCI A;  4JBJ A;  4JI5 L;  4YHH L;  4B3T Q;  4KHP L;  2ZTD A;  4FDB A;  1I6H H;  2YFB A;  2R7F A;  2Z6K C;  4A75 A;  4GN5 A;  2JA8 G;  4DUY Q;  4A76 A;  1XNQ Q;  1X65 A;  4K0K Q;  5IYD H;  4IOA A;  2K14 A;  2OTJ A;  2UUC L;  1EOV A;  2AKW B;  2BA1 A;  2K5N A;  4EX5 A;  3UDX A;  2Q2I A;  4LW1 A;  4YY3 Q;  4LFB L;  3S14 H;  2R7Z H;  1B8A A;  4HJ7 A;  4A3L G;  3D31 A;  3IAS 1;  1VQK A;  3CAM A;  2E5L Q;  2ZTC A;  2RCN A;  4WJ3 M;  2N3S A;  1CSQ A;  2HIX A;  4GKJ L;  3D0F A;  4GN3 B;  4K0K L;  1RIP A;  3HOV G;  4C2M H;  4R1J A;  4OO1 G;  2CFM A;  3RZD H;  3ZJY C;  3VA9 A;  4HJ9 A;  1WCM H;  3CF5 A;  1JT8 A;  3LJ2 A;  1XMQ L;  3WWV A;  4BBR G;  3S1M H;  1YNX A;  3J81 c;  2UU9 L;  3M3Y H;  1KHI A;  3T1H L;  3UE1 A;  3SDJ A;  4OX9 L;  4IJL A;  4UP8 A;  3F2B A;  4GNX B;  4DV5 Q;  4JI0 L;  4DKA C;  4IOC A;  4AYB G;  5IWA Q;  3GTK H;  3KDF A;  5IP7 G;  1TWG H;  1CKN B;  3P23 A;  3MEF A;  3E9I A;  1YEZ A;  4HJ5 A;  2CCZ A;  1E7Z A;  1LYL A;  2K5H A;  4DAY B;  3KJO A;  1ASY A;  2VUM G;  2NVY H;  1N33 L;  4A3B G;  5JJI A;  4DV1 Q;  4LF5 L;  5LNK 1;  4JI1 L;  1FJG Q;  4X66 Q;  4MTN A;  2N8N A;  1H95 A;  3Q8D A;  2R92 H;  3B6Y A;  1BKB A;  4JBW A;  5E7N A;  2VS1 A;  2XGT A;  5FJ8 H;  5M5Y H;  4DV7 L;  2K4K A;  4X64 Q;  4PG3 A;  2A19 A;  3BZK A;  1C7Y A;  2NVQ H;  3HKZ E;  5EAY A;  3GTJ H;  4LF8 L;  1YZ6 A;  5IYC H;  1A62 A;  4DR5 L;  2OTL A;  3NEL A;  3RLN A;  4GOP C;  1YJW A;  2CKZ B;  3PUW A;  3A74 A;  3NEN A;  1IYJ B;  5IT9 c;  1NJI C;  3I7F A;  3TRE A;  1HZC A;  5FJ8 G;  1K73 C;  4IPC A;  1YJN A;  3CXC A;  3PO2 H;  3KDF B;  3S1Q H;  1QZH A;  4DV2 L;  1XMQ Q;  1HNX L;  2UUA Q;  2OQ0 A;  1VQ8 A;  1PH2 A;  4U6R A;  3M4P A;  3J81 j;  4AIM A;  2GVB A;  2XTI A;  1QVG A;  1HNZ L;  4A3I H;  1OTC A;  4Q9V A;  5IP7 H;  3UDF A;  3KYH C;  5AJ3 Q;  2ZJP A;  4GNX C;  4DR2 L;  1VQP A;  1PH1 A;  1BBW A;  1HH2 P;  1JB7 A;  4YCU A;  3DA3 A;  2UXD L;  2UXC Q;  1D8L A;  2B3G A;  3CMA A;  3AFP A;  3GTO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...