2E8GA

The structure of protein from p. horikoshii at 1.7 angstrom resolution
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
240
structure length
240
Chain Sequence
MWDTSKDYRLLVAEKSVELFIRTIEGAKFRGQWDKKRSIQLAKEMIPDIQALRYSYIDPEELVDTPQMKDLKEKAKGIIEALGGEDWHHKFLSQASREDREKVEEQVARIKFFLNTILNLDRRLKLGKINDPVIAVDIVVGEVMSVGKHPSADRLLVTNVNIGERAVTVVTNDLTVKEGNRVAVALLPPRNFFGIVSEGMFLGAGEGVLKNVKGEIGGLPKGIPLEALNETRNAVEAFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein PH0536
publication title Structure of protein PH0536 from Pyrococcus horikoshii at 1.7 A resolution reveals a novel assembly of an oligonucleotide/oligosaccharide-binding fold and an alpha-helical bundle
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Rna binding protein
total genus 81
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
A PF18489 Alpha_Helical Alpha helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.150 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 2e8gA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e8gA02
5JJLA 1VCIA 4DV7L 4JI2Q 1VQNA 1X3GA 1VQ9A 2K5VA 3RLOA 1SLJA 3S2HH 4JI0Q 2CWPA 3JAMi 4NXMQ 5JEAJ 2UXDQ 1WOCA 2JA9A 1OXVA 1QUQB 1FL0A 2ID0A 2V1CC 3CPFA 3HKZE 4X62Q 4DUYQ 1K9MC 2VZAA 3CF5A 4B3MQ 1FJGL 4BBSG 1G6PA 5LMNQ 1IBMQ 3J80i 1L2FA 1I5FA 2AMCB 1V43A 1CSQA 3TQYA 3TEHB 5GROA 4DV3L 1Q46A 4IOCA 1M90C 1PVOA 1KC8C 4PG3A 1PH1A 4BY1H 4A3JH 1S3OA 1JJGA 3T1YL 1K83H 2I5LX 2L15A 3GTJH 1VS0A 3HKZG 1XTDA 2VY3A 3UDIA 1GD7A 3AQQA 3GDEA 4C3IH 3TS0A 1PH6A 4NXNQ 1K73C 2VUMG 4JI6Q 3S1NH 4BA2I 2DUDA 5FLMH 4C2MH 4C3HH 1OXUA 2OCEA 2Y0SG 4LW1A 3PGZA 4YY3Q 4AQYQ 5FLXc 1OXTA 1YHBA 1XJVA 2JA8H 1BBWA 5M5XH 3PIOA 3RZOH 3CCLA 5FJ8G 4DR3Q 1HZAA 4AIMA 4LF7L 4DR6Q 3KDFA 1X9NA 1GVPA 1FGUA 2OQ0A 2PQAA 5ELNA 3K8AA 4DR4Q 3CCRA 5IP7G 1V1QA 1VQ8A 1SMXA 5IYBG 1CKNA 2IX1A 2JEBI 4A3FH 4L5QA 4LF5Q 2AWOA 3W5OA 4A3GH 1GO3E 2IY5B 2R7DA 1X55A 1VQCA 2HIXA 1VQAA 4R4IA 1WFQA 5IWAQ 1N34Q 1HR0W 2UUCL 2PI2E 5HY6A 1VQKA 1H95A 5IP9G 5H1SE 5BR8L 3WWVA 2CFMA 4DV0L 4A3IH 4X64Q 4A3CG 2E2JH 2MO0A 3EBEA 3FKIG 2EXDA 1W3SA 1XMQL 3A5ZB 3KF8B 5C3EH 2E8GA 3CCVA 4YHHQ 4KI0A 4B3SL 2K5HA 1UE1A 1S72A 1D8LA 1N36Q 1X65A 2I0QA 1E7ZA 3H3VI 3HOXH 3HOUG 1SN8A 4C3JH 2UXCQ 1QVFA 1TWGH 3PO2H 5M3FG 2A19A 4JI1Q 2N78A 1WYDA 4BXXG 3I56A 4DV1L 1Q12A 3KF6B 4NPSA 5LMUQ 1LYLA 2ES2A 2R93H 1TXYA 1PH2A 3TRZA 4HIOA 4DNIA 3M9BA 1DGSA 2NVTH 3PUYA 5JJKA 4A3MG 3CC2A 2YTYA 3ULJA 4JYAL 4A93H 4P75A 2KHJA 3U4ZA 1Q1BA 1W2BA 1GM5A 4LF4Q 2NVQH 4A3LG 1IBKL 4DUZQ 2UU9Q 2QA4A 2JJQA 1EIYB 2NZHA 4DV2L 4B3RQ 5DLQE 1WCMH 3STBD 5C4XG 4L5TA 4X65Q 3S1MH 2ZJPA 2UUBQ 1I50H 1IBLQ 1BKBA 4IPDA 4DV4Q 2ALYB 2ZJQA 2JQOA 2JA7H 3F1ZA 4UP8A 3VDYA 1JJCB 2IT1A 1MIUA 3CCMA 2WAQE 5HGQA 2Q2IA 1YJNA 1CKOA 1UEBA 4JI4L 3G71A 2VQFQ 4PZ6A 1LUZA 1Q8KA 4BY7G 5K36G 1HNXQ 2Q2TA 3K0XA 3T1HL 4UY8C 3HOZG 4BBSH 2F52A 5C44G 2ZJRA 3J81c 1QVGA 1D7QA 4DV5Q 4LFAL 2WP8J 3S14H 2ZM6Q 2NVXH 1IL2A 5JJIA 2Q2HA 2WAQG 1SE8A 3ICEA 1E24A 1JMCA 4YCVA 1KAWA 2CWAA 2VL6A 1I94Q 1EUJA 2CCZA 1J5EL 3KDFB 1WJJA 4DR2Q 1OXSC 2GVBA 4LF9L 2PQAB 1XNRQ 4EQ5A 2H5XA 4GN5A 1R9TH 4LWCA 3ULLA 4DR7Q 1CKNB 3NELA 1Q82C 3M4QA 1UE7A 1PH9A 4RMFA 4GLXA 1NMFA 5IYDH 3RR5A 3G6EA 1QZHA 4IPGA 4JI2L 2RF4A 3PCOB 1KRTA 4OWWB 3L0OA 1LM0A 3TREA 3CXCA 4JI0L 5FJ8H 4JI5L 4NXML 1YVCA 1KXLA 2QGQA 3W1GA 4X62L 4DUYL 4B3ML 1N33Q 5LMNL 5IP7H 1IBML 3HOWG 1XMOL 2MO1A 2IHEA 5AJ3Q 1Q86C 3CMAA 3AEVA 4A3EG 3M7NA 1GKHA 4JCVE 3HKSA 2CQOA 4OWXB 4ME3A 2Z6KC 3AYHB 3OYYA 3I4MH 4Y52H 2R7ZH 4B3TQ 4UP9A 4GNXA 5IP9H 5IYCH 3OW2A 4MZ9A 3U58A 4A3CH 1P8LA 2ZTCA 4A4IA 1VQGA 2LSSA 4YY3L 4AQYL 4GN3B 4JBWA 1JE5A 2A1AA 2XGTA 3BZKA 2VQEQ 2HQLA 2WB1E 4P72A 1HH2P 4XIGS 3K81C 2JK8A 3KJOA 4KHPQ 1YJ9A 3H0GG 4KHZA 4IOAA 4DR6L 2KBNA 4A3BG 3HOUH 3E0EA 4POFA 2R92H 1VQJA 4DAYB 1JT8A 3I4OA 2JA6G 4GKJQ 3STBC 5M3FH 1PHJA 3KJPA 1VQIA 4BXXH 4GN4B 1E22A 4HIDA 4LF5L 2Z6KA 2EQSA 1C9OA 1KIXA 1IYJB 2B63G 1FVIA 3CD6A 1SFOH 1N34L 5IWAL 3I55A 1N32Q 4DK3C 2K75A 3OTOQ 1AE2A 4A75A 3UE0A 4HJ7A 3GTMH 3CCEA 4A3MH 1S40A 4JV5Q 4WJ4A 3RZDH 4RG1A 4X64L 5ELOA 4TQUS 4IFDG 2RHSB 4DR1Q 2HHHQ 1XNQQ 1AE3A 3JAMc 1HZCA 1NBWA 3GTOH 3S2DH 2B3GA 4OO1I 3G4SA 5C4XH 2JE6I 4YHHL 2MFIA 4LUZA 1N36L 2CKZB 5C0XI 2UUAQ 1MKHA 2HIVA 2YTXA 2D0PA 4BY1G 4QIWE 2E5LQ 3J80c 4LFBQ 3NENA 1HNZL 1YHQA 3LGJA 2HT1A 2UXCL 1P16A 3CCQA 2VS1A 1CSPA 3UDFA 4P74A 4YWKA 4APVA 4DV0Q 4JI1L 1MJEA 4GS3A 5FLMG 3RN5A 4LF6Q 3HOYG 2LXJA 3HOZH 4JI8Q 5LMUL 1Y1WH 4NB3A 1XMQQ 2RHQB 1NE3A 3FP9A 3EIVA 4JBKA 5LMNW 4P73A 1E1OA 1KHIA 4DR5L 1PH5A 5M3MH 3KFUA 4GOPA 4JC0A 4OWTB 2IX0A 3PO3H 1M1KC 3CC4A 3JC66 4LF4L 4HIKA 1HNWL 3I4NH 4KLKA 1AH9A 2OWOA 1L1OA 1TWFH 2LXKA 5E7NA 3H15A 4DUZL 3I7FA 4LNQA 4BBRH 5M5YH 4A3DH 1JJ2A 4B3RL 5J3BA 3Q8DA 4HJAA 2JA5G 4X66Q 3PF4A 1YJWA 4X65L 4O2DA 2UUBL 4A3GG 4K0KQ 1XPOA 4DV4L 3H3VH 2ZTEA 1XPUA 3CCJA 4GKKQ 1I6HH 3J81j 2KCTA 3CP0A 4Y7NH 1X3EA 3L7ZC 3NEMA 3CC7A 3S16H 2I5HA 1TWAH 4YWLA 4FDBA 4JYAQ 4A3IG 4HJ8A 4MNOA 3ER0A 4GNXB 2VQFL 2BH8A 1Q1EA 2YV5A 2F4VL 1OXXK 3EN2A 3A5UA 4DV2Q 1B70B 1TWCH 3PV0A 1G291 2N3SA 4PZ8A 4DKAC 3PIPA 1C7YA 4J15A 5EAYA 2ZM6L 1VQMA 2KCMA 1I3QH 4TVAB 5C4JH 4JG2A 3J7A5 2PNHA 4DV6Q 4OX9Q 2UXBQ 3HOXG 1VQ6A 1HZ9A 3NBHB 2VUMH 1QZGA 1KL9A 4OONA 4DR2L 3MEFA 1K0RA 2BH2A 4OO1G 1IXRA 3DLLA 4QGUA 1JB7A 1XNRL 3HFZB 3A74A 3GO5A 4O0AA 4GNXC 2AWNA 4A3KG 2R7FA 5C0XG 3M4PA 4AYBE 2OQKA 4L5SA 1OTCA 4ALPA 4IFDI 1EFWA 1V9PA 1VQEA 2YU9H 3D31A 1HZBA 1C0AA 2UXDL 1VQDA 1NY4A 3M85A 3H0GH 3PF5A 3DM3A 4POGA 4IFDJ 4R4OA 3CPWA 1Y1VG 4JI7Q 4GLVB 4A3BH 1ASZA 1PFSA 4PZ7A 2K52A 1EWIA 1N33L 3S15H 3K80C 4LF8Q 1VQBA 1KRSA 2XTIA 5IYBH 1A63A 1Q7YC 5AJ3L 4JI3Q 4LFCQ 4WJ3M 2OTJA 1Y14B 3RLNA 3E9HA 1X6OA 4XTCS 4DV7Q 2K4KA 3D0FA 2K50A 2NZOA 3GD7A 2JA7G 1U5KA 5GAHC 1Z9FA 3HOWH 3HOVG 4IJHA 1ASYA 2ASBA 4NXNL 1EOVA 3UDXA 4B3TL 2WFWA 4JI5Q 5IT9c 4JI6L 1N8RC 3W1BA 1EIFA 1FJGQ 2KHIA 4QL5A 3CW2C 3UDGA 5IE8A 1EQRA 3FKIH 3CCUA 2E2HH 1UWVA 2DGYA 4HIMA 2VQEL 1O7IA 2OTLA 5GQOA 1XMOQ 3K7UC 2NVYH 4DV3Q 2YYZA 2C35B 2Y0SE 4KHPL 3J7ZC 4DR3L 1EYGA 1PH7A 3CQZH 3F2DA 1PYBA 3T1YQ 1VQLA 1RL2A 1K8GA 1T9HA 3RLFA 4GOPB 4DR4L 3PUZA 1B7YB 4UP7A 4GKJL 1L1OB 3F8TA 4UPAA 2WB1G 2AHOB 1X56A 3L2PA 1YHAA 3GTPH 3GTQH 3HOYH 2N49A 1K3RA 2KENA 3PSIA 3AFQA 3S17H 5IYDG 1PV4A 1TWHH 4QJFA 1XPRA 2PI2A 1N32L 3OTOL 1YIJA 4LF7Q 2PMZE 3FHWA 4DPGA 4JV5L 2IHFA 1A0IA 2YTVA 4A3LH 1VQ4A 2K14A 1MJCA 3G48A 4GOPC 3S1RH 1PA6A 2RCNA 4DR1L 2HHHL 1XNQL 2JA5H 1L1OC 4YWMA 1EQQA 2ATWA 3GTKH 1BVSA 3F2CA 1LTLA 3A0JA 2UUAL 1G51A 3M3YH 1SRUA 4A3JG 1YITA 2E5LL 1VQPA 2UUCQ 1PYSB 2Q2UA 1CKMA 4LFBL 5C0XJ 1YI2A 3KLWA 5GADC 1YEZA 3TS2A 1QUQA 3I4MG 5GAEC 5BR8Q 3J81i 2R7ZG 5IYCG 2JEAI 4JBMA 4H02A 4BY7H 1WI5A 4OXPA 3U4VA 4LF6L 3MXNB 5C44H 5JEAG 3CMEA 4JI8L 1Z47A 2JA8G 4DAMA 4IPCA 1A8VA 4IO9A 1HR0Q 4QQBX 4B3SQ 1UE6A 1VQ5A 1YBYA 2NN6I 4R4QA 4HJ9A 4A76A 1KD1C 2MQHA 3BJUA 1VQ7A 4L5RC 2D0OA 4IJLA 3PUXA 4LUVA 1HNZQ 2E2IH 3GTLH 2UU9L 1X3FA 2R92G 4YCWA 4R1JA 2F3IA 4HJ5A 1VQFA 3E9IA 4X66L 4A3KH 2AKWB 4P71A 4DV1Q 1IZ6A 3UE1A 1B8AA 4JBJA 4A3FG 1Q81C 1IBLL 2BA1A 4K0KL 4IPHA 1SR3A 3S24A 3KOJA 4GKKL 4JOIC 3GTGH 2GVAA 2BA0A 4PMWA 1PH8A 4QY7A 1NJIC 4DR5Q 1Y1VH 1A62A 2Z0SA 1CUKA 2EIFA 4R4CA 1UE5A 1HNWQ 4X6AH 1NMGA 1IBKQ 2QEXA 1HNXL 3PUVA 3SGIA 1BBUA 1QVCA 3ULPA 1N9WA 4GLAC 5C3EG 3F2BA 2B29A 4DV5L 4A3EH 2FXQA 4YCUA 4BA1I 3IRBA 1VQHA 1YNXA 1J6QA 5GAGC 3CCSA 4DV6L 1U0LA 4OX9L 1L0WA 3HOVH 1I94L 1K8AC 3CAMA 4EX5A 3ZJYC 2UXBL 2K5NA 3PO2G 1PH3A 2A8VA 4R4TA 4JI4Q 3BU2A 1RIPA 1PH4A 1HR0L 3AFPA 4DR7L 3M4OH 2D62A 2N8NA 3T1HQ 4JOIA 3BZCA 2I5MX 2F4VQ 3K7AH 1KQSA 4DK6C 1Y1WG 2R93G 4LFAQ 5IY0A 3U50C 2GN5A 3ERSX 2R6GA 3S1QH 1VQOA 1SROA 1X54A 1HJPA 5M3MG 1YZ6A 3KYHC 2MNAA 4JI7L 3RNUA 4A93G 3PO3G 4LUOA 1J5EQ 2JA6H 1NTGA 4AYBG 3I4NG 3RN2A 4LF9Q 4MTNA 3B6YA 4A3DG 4LF8L 4BBRG 2VW9A 1E1TA 1WCMG 3KF6A 4AH6A 5M5WH 2NN6G 2ZTDA 3PUWA 4LFCL 4JI3L 2VNUD 1E3PA 2B63H 3I2ZA
chains in the Genus database with same CATH superfamily
3HOYB 5JJLA 1VCIA 4JI2Q 4DNTB 1HTPA 1VQ9A 4F87A 3JAMi 5JEAJ 2PYKA 1FL0A 2ID0A 3HKZE 2K28A 2VZAA 4BBSG 3WOEA 2XIWA 1I5FA 3TQYA 1DCZA 1EFID 2EY5A 5GROA 1H9MA 1Q46A 4IOCA 4F88A 4BY1H 5DAUA 5IGGA 4A3JH 2L1LB 3T1YL 1K83H 1JJGA 3GTJH 4OIJA 1PH6A 4MTKA 2VUMG 2A74C 4HAEA 4DK1A 5FLMH 2Y0SG 1YHBA 3NPPA 1H9JA 1I4HA 2KECA 4DF7A 1V8QA 3MVVA 4DR3Q 1D5MC 5CV4A 4DR4Q 2A69C 3EFXD 1KDCA 5IYBG 2IX1A 2AWOA 1EQVA 4JW0A 5FK9C 2IY5B 2R7DA 1VQCA 4R4IA 1HR0W 5IWAQ 1EU4A 2L9HA 1H95A 4OHJA 4A3IH 4DV0L 4X3SA 3EBEA 2BDNA 1NNXA 2F0JA 4WJWA 2NUCA 2LY7A 3CCVA 2B2VC 2K5HA 1S72A 1N36Q 1D8LA 1X65A 4B9WA 1S4ZA 5ISRA 1CI3M 3H3VI 4C3JH 3HOVB 1QNUA 4IUNA 4PL4A 3DWQA 4JI1Q 1EY5A 4G7HC 5C0XH 3Q6SA 4DV1L 1Q12A 5LMUQ 1STYA 1B44D 3I72A 3M4OB 4TKOB 1TXYA 3SHLA 1WTHA 2BE5D 3H09A 3BDOA 4KK7A 1DGSA 3ULJA 1CZWA 3S1QB 3KLSX 2NTSA 4LF4Q 1J8IA 2RA4A 2JJQA 3A8JE 1EIYB 4DV2L 2Z8LA 3R2IA 4RGMA 1JC7A 2NN6H 2B2WA 3P20A 2ALYB 1EWHA 2ZJQA 5T1IA 2JQOA 1B9MA 2IT1A 3CCMA 2WAQE 2Q2IA 1CKOA 4UHVA 1QJOA 1STAA 1HXYD 1XX8A 4XXEA 1Q8KA 2O5JC 1HNXQ 2Q2TA 4UY8C 3HOZG 3SXHA 2ZJRA 1SDFA 4MN3A 2WP8J 3DWAA 2RSOA 2NBFA 2CWAA 1I94Q 2CCZA 3D8GA 1OXSC 2GVBA 4EVOA 4YIJA 3C3LA 3VR5A 2IP6A 2H5XA 2OF1A 4GN5A 3ULLA 1F77A 3M4QA 3K5NA 2K5WA 5IYDH 3RR5A 1E2ZA 1KRTA 1F9PA 2JA8B 3MFGA 3TREA 4NXML 3T13A 4OAVB 3RZOB 4X62L 1DOLA 1SJ8A 2C5CA 5LMNL 4KJOA 4IALA 1KABA 2TSSA 4A3FB 2GA4B 2F0UA 2F0GA 2Z6KC 2XTRA 4K5WA 3I4MH 1Z7TA 2R7ZH 4B3TQ 5IT9L 5IYCH 4IZ8A 2A5HA 1ONLA 3I8ZA 1EEFD 3NK9A 4A4IA 2LS01 5J39A 2LSSA 4DFAA 2XGTA 1JQOA 2HQLA 2WB1E 3KJOA 4AS2A 1U9RA 1STGA 4HSPA 3QG1A 3HOUH 1PXUA 3E0EA 4POFA 2R92H 4OL7A 2LMCB 4Q0FA 4GKJQ 5M3FH 3CU7A 3V96A 3SK5A 4CGYB 1I4GA 1VQIA 2V4DA 1QB5D 5LL6S 4GN4B 4LF5L 4HIDA 2EQSA 1ENCA 3Q22A 4OGQC 3T51B 1N34L 1SXTA 3I55A 1N32Q 2R93B 1AE2A 3UE0A 1GOZA 4RG1A 1KLUD 3FDTA 4TQUS 4A93B 4IFDG 2RHSB 1HZCA 1HTLD 1NBWA 3I4NB 2B3GA 3QOLA 5C4XH 2JE6I 4YHHL 1WCMB 2QDLA 2CKZB 5C0XI 3S1MB 1YNJD 4U673 5ELFA 3AB9A 4WFN3 1S5DD 3CCQA 1CSPA 2D5DA 1NUCA 1MJEA 1AW7A 1PDQA 4GS3A 4C3HG 2J7ZA 4RAUC 4H7BA 5JOBA 1XMQQ 1HA6A 4BBSB 2L55A 3FP9A 5JVG3 1T5XD 1LV9A 2CQAA 2F0NA 4DR5L 2IX0A 3PO3H 1T5EA 2PQEA 3HP3A 1HNWL 5AFWA 4CBVA 1AH9A 3MTSA 1WD1A 2XNAC 2JA5G 4X66Q 3PF4A 2VUMB 4CKEA 4HCEA 1KNAA 2Y0SB 1XPUA 3J81j 3M4YA 4Y7NH 1X3EA 1CT1D 3BDCA 4ODGA 3K5LA 2YU9B 4YWLA 1SE3A 3L3OC 3ER0A 2BH8A 2YV5A 2EYMA 3I70A 1H9SA 4PZ8A 1G291 2N3SA 1G91A 3QJYA 4J15A 1I3QH 4JG2A 3SEBA 3R8BA 2QILA 2BH2A 1HUMA 2TMPA 4QGUA 5I2XA 4HN7A 4GNXC 2R7FA 4XYQA 1S5CD 3FMCA 4IFDI 2HDMA 1EFWA 2A6HD 1VQEA 2E2HB 1HZBA 3O13A 5ELDA 4IFDJ 3H0GH 4CJ0B 3CPWA 2MGSA 1SEBD 3DWPA 3NP8A 4PL3A 2K32A 4PZ7A 1SMYD 3HEJA 2IWHA 3S15H 2EE1A 1VQBA 1KRSA 5KNDA 4PNYA 4LK1C 1Q7YC 4JI3Q 5D65A 1U4RA 1X6OA 1Z9FA 4IJHA 2F0DA 3EROA 1G8ZD 3UDXA 4JI5Q 1N8RC 1EIFA 1IYUA 1X3PA 1EQRA 3RZDB 2ZT9C 4IUUA 2DGYA 2F0FA 1H9KA 1O7IA 4HIMA 5GQOA 4FYDA 2NVYH 3S2DB 5LNK1 1FR3A 2KQ3A 3J7ZC 4DR3L 2B2UA 5F2DA 1PH7A 3ND9A 1PYBA 3T1YQ 1I4PA 4DR4L 2P5ZX 3PUZA 1F9SA 2FINB 4RCOA 3NQTA 4KY6A 3HOYH 2K19A 5FLXL 2KENA 3PSIA 1STEA 3S17H 3HOZB 4K2LA 1Y1WB 4QJFA 1EWCA 2PMZE 4DPGA 4G76A 5DM73 3OMCA 3H91A 3S1RH 2RCNA 5IGDA 3FEWX 2HHHL 2E2IB 1RDPD 1H9SB 3D4WA 2G9HD 2UUAL 3MC0B 1SRUA 1F9QA 1PYSB 2Q2UA 3K5MA 2CHBD 2EYOA 5GADC 3TS2A 5GAEC 4NW2A 1FNWA 1LTAD 2JEAI 1B9NA 4JBMA 1PTOC 4YZ9A 2HCIA 5C44H 2CAZB 1RODA 3DEOA 4JI8L 5JPMC 3JAML 1A8VA 3K58A 3DM1A 1UE6A 1PTOH 4WORA 2AUKA 2VB3X 1Y69U 1LTBD 4R1JA 2F3IA 1Y8PB 2AKWB 4DV1Q 1SR3A 3NE5B 3KOJA 2G9DA 3GTGH 2K33A 1G2SA 3OOCA 1NJIC 1XYIA 4YZDA 1HHVA 1UE5A 1NMGA 3GV6A 1HNXL 2ZW3A 4MIUA 2F3VA 4ULLA 2A69D 2B29A 2MP1A 1VQHA 5M5WB 4DV6L 4OX9L 3BG3A 1GUOA 1I94L 3SK8A 3HOVH 1EOTA 1GUNA 2AQ3B 4G75A 2K5NA 3VR2A 3KK7A 2IPKD 3M4OH 3LWEA 3L0IA 3FRPB 2I5MX 4JOIA 1IHZA 3QWNA 4S3SA 4FF4A 5IY0A 3U50C 2GN5A 3ERSX 2R6GA 3S1QH 5CV9A 1SROA 5M3MG 3KYHC 4JI7L 2Q8RE 3CQZB 1NTGA 2EYJA 4AYBG 2OT2A 3LNNA 4L63B 4A3DG 4BBRG 2VW9A 1OO9B 3PUWA 4LFCL 2VNUD 1R4QB 3I2ZA 4PV1C 4O1NA 5IGFA 4C3HB 1MSGA 3T53B 2MPMA 4HTHA 1BCPB 1X3GA 1W6KA 2UXDQ 3KUPA 4NXMQ 3PMFA 1STNA 1WOCA 3SVMA 2V1CC 4X62Q 4ZLTF 3CF5A 4F7XA 5LMNQ 4DAPA 4FP5D 1ZYRD 3J7YW 3D4DA 3ND8A 3C46A 1D2BA 3TMEA 2JA5B 1Q90A 2EZVA 1DZ1A 3GTKB 2K05A 3HKZG 3JAME 4BA2I 4JI6Q 5L37A 2PZUA 1MSHA 2AQ1B 4ID6A 1SNDA 2K7VA 5EKKA 1OXTA 1XJVA 2JA8H 3F2UA 4E6IA 5M5XH 3PIOA 4R8NA 5CBEE 3RZOH 1CA6A 3CCLA 4RHSA 1E2VA 5FJ8G 1ILPA 4AIMA 4CKBA 1GVPA 1FGUA 1GUTA 1HQMC 3CCRA 5LL6X 1FNUA 5IP7G 1CKNA 4RHRA 4A3FH 4RGNA 4L5QA 4LF5Q 4A3GH 3NWSA 3A56A 1N34Q 1VQAA 1WFQA 5IP9G 2CFMA 1PZID 2L5TA 5IGEA 1W3SA 2KEEA 1XMQL 3A5ZB 3BVZA 2NVQB 2E8GA 1LTTD 4YHHQ 5EPJA 1F2MA 5KRUA 1UE1A 3CRLC 4HSVA 5M9OA 2FEFA 2BDOA 2NZ1D 2QF7A 1QVFA 1TWGH 3DHQA 1TT2A 3I90A 2A19A 5C4HA 5KYLA 4RFBA 2N78A 1WYDA 1PRTC 3I56A 1PTOF 1B50A 4O1PA 4K14A 5I6WA 2ES2A 2R93H 3C1FA 1PH2A 3TRZA 2RADA 4A93H 1YO7A 1X32A 1GM5A 2KHJA 1W2BA 2I46A 1BR9A 4A3LG 1RCVD 1PYWD 2NZHA 5DLQE 1WCMH 4KV6A 1B2TA 3S1MH 3URYA 2ZJPA 2I07B 1H9RA 1IBLQ 1BKBA 1GHJA 2JA7H 3NSWA 5CR3A 3BZDB 3TP5A 5CC4A 1MIUA 3IL8A 3R2TA 1C8CA 1DM0B 3OMGA 3A55A 1VMPA 1LUZA 5K36G 4BBSH 3T1HL 2F52A 3MXGA 3J81c 1C48A 4O1OA 5JJIA 3S9WA 2WAQG 3OSOA 2NTTA 1KDAA 4YCVA 1KAWA 2DJFC 2QZGA 1QOHA 1DD2A 1I6VC 2SDFA 1HA5A 2VXWA 3IAS1 1DYQA 1CKNB 3NELA 2AUJD 5HURA 1DOKA 4DNRB 3PCOB 4ZRZA 3TZDA 4JI5L 1KAAA 2B2TA 1KXLA 5D3DA 4DUYL 1IKMA 5CV6A 5HGTA 4B3ML 4DAVA 1IBML 2BL8A 3MXPA 3R93A 5DEHA 3DXJC 3BYTB 2WV6D 3QIAA 3AEVA 4A3EG 2K6AA 1GKHA 4OAUC 1GUSA 1UUPA 3HKSA 4KTAA 4OWXB 2FUG1 2A2CA 3AYHB 4Y52H 4UP9A 2EJMA 2GSCA 3OW2A 5BN3A 4PMBA 1RTNA 4NV2A 1VQGA 4AQYL 1C4QA 4GN3B 1JE5A 1L0YB 2A1AA 2WKCA 3BZKA 1ICFB 3K81C 2KA7A 4IOAA 1UEAB 4DR6L 2PW7A 4HMIA 2F0TA 2HDLA 1VQJA 5CYUA 4LJZC 2JA6G 3HOXB 4HR7B 1QNKA 1E22A 1KIXA 1FYCA 1F2YA 4ZK9B 2B63G 1FVIA 2L11A 4FF1A 5IOCA 1SYDA 2EYPA 1NCVA 3CCEA 3RZDH 4X64L 4X3UA 5ELOA 5M3MB 2HHHQ 1AE3A 4AYBB 3S2DH 4OO1I 1LACA 4IQZA 3G4SA 4X3TA 4A3DB 3AJFA 4BBRB 2B39A 2B2YA 2HD3A 2MFIA 4LUZA 2UUAQ 2HIVA 2D0PA 2MJFB 4BY1G 1MHWC 5C5LA 4CDFC 3J80c 2HT1A 1TDPA 3UI2A 2UXCL 5JJZA 2F0EA 1P16A 1E0BA 4YWKA 4I1TA 3GP7A 1G2TA 3S16B 5FLMG 1EY8A 1TWAB 3RN5A 3HOZH 4JI8Q 1F2LA 1Y1WH 5C3WA 3WDNA 1B3QA 2K03A 3C1EA 1TWCB 1HCZA 1WTOA 2RVLA 2ZXRA 1ZYRC 2F0WA 2LXKA 5E7NA 3HKZB 5TSSA 5M5YH 3Q8DA 4X65L 1MI2A 1PRTF 4O2DA 1K0SA 2UUBL 1R9TB 4DV4L 3CCJA 1B3AA 1KNEA 4RA8A 2I5HA 3I91A 4A3IG 4MNOA 1LLRD 2VQFL 4GZYC 1EZ8A 1OXXK 3EN2A 1B70B 3PIPA 4CKCA 1C7YA 3J7AV 1MD2D 1V1OA 5K5PA 1SSOA 3TDQA 4DV6Q 4OX9Q 2DJGC 1HZ9A 5ELCA 4C3JG 2BL7A 4DR2L 2J4XA 3MEFA 1IXRA 1A3VA 5HGIA 3HFZB 3A74A 3GO5A 4O0AA 5C0XG 1PTOD 3GV3A 2NB0A 4NMZA 2UXDL 1VQDA 1NY4A 5JAVA 2M2LA 4JI7Q 5EPLA 1JCKB 4AS3A 1EWIA 5EQ0A 4QF4A 1JORA 1A63A 4LFCQ 4N8FA 4F8MA 3RLNA 1A2TA 5C3XA 2K50A 2NZOA 3M7GA 1U5KA 1EOVA 4JI6L 5IT9c 4ILWA 2H1EA 3GTMB 5IE8A 3FKIH 3CCUA 2JB3A 2OTLA 1XMOQ 3K7UC 3GTOB 2C35B 2Y0SE 3IKJA 4KHPL 1ICWA 1EYGA 2YFBA 3CQZH 3RLFA 1B7YB 4KJNA 3F8TA 4UPAA 2AHOB 1YHAA 2N49A 1AFPA 3J80E 5IYDG 1PV4A 2EOTA 3E3XA 1XPRA 2P22B 2PI2A 4FVMA 4KN7C 1EYAA 3OTOL 1YIJA 2XN9C 5IGCA 3FHWA 3SE0A 2WAQB 2IHFA 2YTVA 2EPBA 2K14A 1ET9A 4GOPC 1GHKA 4DR1L 1XNQL 2JA5H 1L1OC 1CZGA 1EQQA 2ATWA 1B1ZA 3GTKH 1BVSA 3A0JA 3M3YH 1YITA 4LFBL 1CKMA 2E76C 5C0XJ 5FO8B 2SNMA 3I4MG 2R7ZG 3J81i 2N88A 5IYCG 1UAPA 4BY7H 3TP7A 3U4VA 3VR4A 4LF6L 1NAPA 1Z47A 4IPCA 2HQEA 4Z7GA 1VQ5A 1EIHA 5J22A 3P1HA 2NN6I 4A76A 2MQHA 1U4MA 5C4JB 1HNZQ 1DJRD 2NYZD 3VYRA 4YCWA 2R92G 5D3IB 4HJ5A 4J1MA 4P71A 3UE1A 1B8AA 1IBLL 1I4XA 2BA1A 4FNFA 4QB4A 3I4LA 1TS4A 2LKVA 4GKKL 4JOIC 2F0PA 2E2DC 2BA0A 3X3MA 1HFGA 2K04A 1PH8A 2FU2A 4DN4M 2EIFA 4FXGC 4R4CA 4X6AH 2F0VA 2QEXA 3V05A 1A3UA 3KBGA 3SGIA 2B2VA 1JWSD 1N9WA 4GLAC 5C3EG 3F2BA 2JA6B 1XTCD 2RBMA 4YCUA 4BA1I 1JOKA 3IRBA 1SYEA 1YNXA 2SNSA 1L0WA 1CQVA 1JE4A 2B63B 2WKDA 4EX5A 3ZJYC 2UXBL 3PO2G 1RF2D 1WTRA 2MUYA 3BU2A 3W3AA 1HR0L 1SYBA 2KHSA 2D62A 1SE4A 2N8NA 3T1HQ 4UDUC 1DXMA 1ZXTA 2PO4A 1BNZA 1PFBA 1YZ6A 3PO3G 4BY1B 2RDHA 5T1GA 1K83B 5ELEA 4MTNA 4N9TA 2ZTDA 2L12A 3PIO3 4XQNA 1PRTD 3GTQB 4DV7L 4CDEC 3MXUA 1VQNA 2PCFB 3W2DA 1JICA 2K5VA 3S2HH 2CWPA 1GJXA 2IX3A 1K9MC 1FJGL 4DUYQ 4B3MQ 1IBMQ 3J80i 1L2FA 2AMCB 1V43A 5BN4A 4DV3L 3Q23A 4PG3A 5C6AA 1S3OA 2SOBA 2SEBD 2YFAA 2I5LX 1VS0A 4V0BA 4XDXA 1GD7A 1D6EC 3AQQA 4C3IH 3TS0A 4NXNQ 3S1NH 1K73C 2B8GA 1ET6A 1Z6HA 3EJIA 4A3IB 4AQYQ 3UITA 5FO9B 3A7AB 5FLXc 1ZEQX 1WTPA 3MEHA 1HZAA 4DR6Q 1L0XB 2K5DA 5ELNA 3FBVA 2C9OA 3D6WA 5KNCA 2MJ8A 3GTLB 1V1QA 4C3JB 1SMXA 5EGTA 4FXDA 3LJ1A 3W5OA 1GO3E 1YNNC 4R8IA 2CH4A 2DNEA 2HIXA 5HY6A 5H1SE 1HPCA 2B8FA 4WRDA 3WWVA 3GQBA 1VF5C 4I65A 4X64Q 4A3CG 1TVXA 4UAIA 4LAAA 2EXDA 3L9AX 2WACA 4DGZA 5C4ZA 2RSNA 4QUCA 1F2ZA 5COYA 2EY2A 1Y8OB 1E7ZA 2Z4IA 3HOXH 1SN8A 2UXCQ 3K59A 4EQOA 1TY2A 1IW7C 1QILA 2EJFC 1D5ZC 4BXXG 5FOBB 1G6ZA 4NPSA 1ENAA 1SJED 1LYLA 2QGMA 3M9BA 3TBIB 2JSOA 5JJKA 4A3MG 3K6OA 2YTYA 4P75A 3U4ZA 1V1PA 1IBKL 2ICIA 3E0JA 2EYFA 2D9UA 4L5TA 4X65Q 4BS9A 2UUBQ 3CRKC 4FO2A 4IPDA 4DV4Q 3IFTA 4NDXA 3P23A 3F1ZA 1B4OA 3VDYA 1JJCB 1TR5A 1E2WA 4H0LC 2RDFA 5FO7B 3NTKA 5HGQA 1YJNA 1SNQA 1UEBA 1TU2B 1KTKA 2KJXA 4DXFA 3G71A 2VQFQ 1A3TA 2AQ2B 1M8AA 1TS5A 4DXGA 5I2YA 5C44G 1SBBB 3MHBA 1D7QA 1LTRD 4LFAL 2JBWA 1IL2A 2Q8TA 1EY9A 2Q2HA 3TN2A 2PPBC 1SE8A 4R9WA 3ICEA 4HMJA 1E24A 1K28A 4B08A 1JMCA 5A2QE 1WD0A 2PMZB 4DR2Q 3OPOA 3I4MB 1R9TH 2R7ZB 5CORA 4C2MB 2F0SA 1UE7A 4RMFA 3VR6A 4GLXA 5I9PA 1QZHA 3C2PA 2RF4A 4QIWB 2DY8A 4JI0L 3CXCA 4FF2A 4L8JA 5FJ8H 1EU3A 1CFMA 2QGQA 2G5DA 3NBIA 5IP7H 4K6DA 1R4PB 3HOWG 1XMOL 2R92B 4NKLA 1SJHD 2MO1A 2IHEA 4C1NK 1Q86C 1LT6D 5KNBA 3CMAA 5C5MA 1LTGD 3A8IE 4JCVE 3N6RA 4ME3A 4PQXA 2FHTA 1QG7A 3OYYA 4GNXA 5IP9H 4MZ9A 3KLSA 3MFYA 1P8LA 4OELB 4ZKCB 2A68C 5JEAH 4YY3L 2E2JB 3NTIA 1HH2P 2QKIC 4P72A 4XIGS 2JK8A 1S5ED 4KHPQ 3SDJA 5C3EB 2KBNA 3NBHA 4A3BG 2B2YC 5I9OA 1JT8A 3I4OA 3STBC 1V1PB 1BDOA 4EQNA 1PHJA 3PO2B 3KJPA 1JQYD 4Q9VA 4ZUIA 1O80A 2QEJC 3CD6A 2IW3A 2XWJB 1O78A 3OTOQ 3R3OA 3NUCA 4HJ7A 4ABNA 3GTMH 3E5SA 4WJ4A 2Z1CA 2NVTB 1QWYA 4DR1Q 3B55A 1XNQQ 3PO3B 3SK6A 3GTOH 4KKSA 4ZCKA 2A6EC 1JWMD 1MKHA 2YTXA 1I50B 1RD9D 2B2WC 3H6MA 3NENA 1HNZL 4LFBQ 1YHQA 4K6LA 2XVSA 2VS1A 1SNOA 4P74A 3UDFA 3K57A 4LF6Q 2LXJA 3HG9A 3NHHA 1B53A 1MBYA 2RHQB 1ZKOA 2FMCA 2X69A 4JBKA 2BCOA 2HCCA 4P73A 3BVMA 1KHIA 5LMNW 1EY7A 3FPPA 3S14B 2NVXB 5LHY1 3QR8A 1M1KC 1I3QB 3I4NH 1D1IA 2OWOA 2LFNA 3KFUA 4DUZL 3H3VC 1LT4D 4B3RL 5DNFA 3OIPA 1JJ2A 5J3BA 4HJAA 1RJTA 3HRZC 5CV5A 1YJWA 1RTOA 4L6TB 4A3GG 1EIGA 1XPOA 3H3VH 2ZTEA 4GKKQ 3CP0A 5IODA 1WTQA 3CC7A 1SYFA 4JYAQ 1NR2A 4HJ8A 4GNXB 1Q1EA 4DKAC 3PV0A 1LO5D 4Z9CB 2DNCA 2ZM6L 1VQMA 4TVAB 5C4JH 3J7A5 2PNHA 1BOSA 2Z4HA 3HZXA 2UXBQ 1AZPA 1D1KA 3NBHB 3OWEB 2VUMH 1EQTA 1KL9A 1QZGA 4OO1G 1K0RA 2K1BA 1RKNA 3DLLA 1XNRL 1HR0Q 4A3KG 4KKTA 4AYBE 4L5SA 1OTCA 4ALPA 1O7LA 5EKLA 3SK4A 3HGBA 1V9PA 3J81L 2YU9H 1C0AA 3N52A 2DY7A 1PMRA 4C1NI 3PF5A 3BDLA 4G4KA 2JB1A 3DM3A 1PZKD 4KD4A 4R4OA 1Y1VG 4GLVB 2QW7A 1ASZA 1PFSA 2K52A 1N33L 4I7AA 3K80C 5IYBH 5AJ3L 2CW0C 2J0TD 1Y14B 5E4WC 4K8IA 2OTJA 3E9HA 2ZRRA 4DV7Q 2JA7G 2F03A 2QCPX 1SFOB 2ASBA 4NXNL 3S17B 1JB3A 5E3FA 1I4QA 3W1BA 3FVQA 1FJGQ 3IFDA 3TSSA 4A3MB 1UNSA 2E2HH 3VR3A 2VQEL 4FF3A 3S1RB 2FMMA 4DV3Q 1I4RA 2YYZA 1XXGA 2ETDA 4RH6A 1T9HA 1PZJD 4UP7A 2WB1G 1X56A 3GTQH 1K3RA 2JYOA 3AU7A 2CH4W 3U9SA 3H94A 5C44B 5EPKA 3K5OA 3BS1A 4JV5L 5CV7A 1PTOB 1A0IA 1CM9A 1VQ4A 5FKAC 1MJCA 3LJ0A 3VA7A 4QCLA 1CHPD 1TWFB 4XT3B 4TRDA 5G3LF 3F2CA 1LTLA 3FVVA 1ESRA 4A3JG 2E5LL 1VQPA 1YI2A 3KLWA 1YEZA 3AMUA 1QUQA 4DK0A 1I6HB 4JVZA 3GTGB 5J1ZA 1BQQT 2Z6BA 1RHPA 3ERQA 5IGBA 2IL8A 3CMEA 2H4OA 4K5XA 4DAMA 4IO9A 4QQBX 2L1BA 1X3QA 3HOWB 4H44C 1YBYA 1QCBD 4R4QA 1TS2A 1KD1C 3BJUA 4L5RC 1EY6A 5E4XA 3J80L 1TKWB 4IJLA 3PUXA 4LUVA 2E2IH 3GTLH 2BOSA 4FXKC 1WTVA 1IKLA 3DA3A 3J81E 3CHBD 1CQFA 1VF7A 1FGBD 1J9OA 3BVGA 4K0KL 1EL0A 4IPHA 2DN8A 1K3BC 4RWSC 4PMWA 3VYUA 4QY7A 3BYYB 1LABA 1A62A 1JR0D 2Z0SA 1CUKA 4ZUJA 1Q3LA 3T4AC 1IBKQ 4A3BB 1BBUA 3D3RA 2O5IC 3ULPA 1W6JA 2F0IA 4U68A 1YNND 1K8AC 1BXTA 2KVMA 3NQIA 3EQLC 2L0CA 1RIPA 3VYTA 3BZCA 3KF8A 3ZYYX 2F4VQ 5KYIA 1SNCA 1Y1WG 2PZTA 4LFAQ 1VQOA 1X54A 1HJPA 3IAYA 4LUOA 2B2UC 2WINB 2QDBA 3VYSA 2O4XA 4LF8L 3QB3A 3KF6A 4PL5A 2M00A 4AH6A 5M5WH 1IW7D 2NN6G 1DONA 1E3PA 4P2CB 3GTPB 1CA5A 2RLDA 3RLOA 1SLJA 4JI0Q 4K5VA 1TWHB 4MHEA 5M5XB 1MGSA 2JA9A 1OXVA 1QUQB 3CPFA 4Z7HA 4IFDH 3KP9A 1G6PA 4J8QA 4QUFA 1A6XA 5EBCA 4HCSA 1CSQA 4IUQA 3TEHB 1GXDC 2F0QA 4ZKBB 1KC8C 1M90C 1PVOA 1PH1A 5EBDA 3U9OA 4A3GB 2L15A 1XTDA 1BCPC 1EY0A 2VY3A 3UDIA 3GDEA 4ZAIA 2CVRA 4XQQA 4KHVA 2DUDA 3J7AF 3OWFA 4C2MH 4C3HH 1OXUA 3I9V1 2OCEA 3FPUB 3PGZA 4LW1A 4YY3Q 1PFMA 1A2UA 4TSSA 1VDZA 1BBWA 2EYHA 1K8MA 1SYCA 3DEPA 4K2KA 4IUVA 4LF7L 4RGTA 5I6YA 3KDFA 5JPNC 1X9NA 2OQ0A 2PQAA 3K8AA 4ZYSA 4HFVA 2XRQD 1VQ8A 1TWGB 4RGOS 5CGKA 2JEBI 4G7ZC 3WOFA 2F0HA 4A3KB 4EGVA 1X55A 4KN4C 2UUCL 3F4MA 2PI2E 1EYCA 1VQKA 3G6JB 1F9RA 5BR8L 2RQXA 1PRTB 2E2JH 1Y1VB 3TP6A 2MO0A 3FKIG 4OEMB 3KF8B 5C3EH 2XTQA 4KI0A 2KCCA 4B3SL 2KKMA 4A3EB 2I0QA 3HOUG 1LT3D 1U4LA 3PO2H 2JA7B 5M3FG 4RKLA 4X3KA 2KCNA 3KF6B 2A68D 3K7AB 1IL8A 1FD7D 2PW5A 2ZXOA 4HIOA 2JP1A 4DNIA 2NVTH 3PUYA 3CC2A 4JYAL 4DAYA 1M4VA 1Q1BA 2NVQH 4DUZQ 3D4RA 2UU9Q 2QA4A 1S5FD 4B3RQ 5D14A 3STBD 4NV5A 2RIOA 1SYGA 3DMUA 3T56B 2A73B 4CJ1B 5C4XG 1I50H 2EJGC 2WB1B 5G3LD 4O42A 4UP8A 4KY7A 3SDZA 2HGKA 1JOOA 4XYOA 3V2TA 4JI4L 5CV8A 4PZ6A 4BY7G 3I73A 3K0XA 5A35A 1AEXA 4XT1B 1EZ6A 4JPBW 3RMHA 1QVGA 2X6GA 4DV5Q 3S14H 2ZM6Q 2NVXH 4KD3A 5IT9E 4CJ2C 2NWGA 2A6ED 4DU9A 2VL6A 1EUJA 4A3JB 1J5EL 3KDFB 1WJJA 3GTJB 4LF9L 2EXZA 2PQAB 1XNRQ 4EQ5A 3A8KE 1JWUD 2KEDA 2KOLA 4LWCA 4DR7Q 1Q82C 2IJ0A 1PH9A 1NMFA 1SAPA 3G6EA 4IPGA 4JI2L 4G57A 2F0OA 3VA9A 1LM0A 3L0OA 4OWWB 1BF4A 1CK1A 1YVCA 2VB2X 1ENFA 3W1GA 1STBA 3DA4A 1N33Q 2L4NA 4QMGA 1LTSD 5ELBA 1ILQA 4NP5A 2EY1A 5AJ3Q 1TY0A 4GXTA 3M7NA 2JB2A 2K01A 2OXPA 1VMCA 2CQOA 3D6CA 1LTID 1STHA 1JOQA 1DOMA 3U58A 4A3CH 2ZTCA 5A2QL 1SNMA 4IUTA 4Q5VA 4JBWA 2VQEQ 2BE5C 1ML0D 2M9VA 4CDCC 1YJ9A 3H0GG 4IURA 1HRJA 4KHZA 4DAYB 3FNBA 1BCPF 1Y8NB 2PZWA 4M1UB 3OW7A 1LT5D 1SNPA 3Q0AA 2JN4A 4YZCA 4I7ZC 4BXXH 3RD4A 2RKSA 2Z6KA 4RKBA 1C9OA 4KMUC 1IYJB 4M8AA 2Z9HA 1SFOH 2A2DA 5IWAL 4KKUA 4DK3C 2K75A 4A75A 4DA2A 4A3MH 1S40A 4JV5Q 5KIXA 2RCFA 3LWUA 3JAMc 3TP8A 1II3A 3KBXA 1D5XC 5M5YB 4K8JA 1N36L 3A7LA 2E5LQ 2CW0D 4QIWE 2O2LD 3LGJA 5NUCA 2EDGA 4C3IG 3DUZA 4APVA 4DV0Q 4JI1L 2JAEA 3HOYG 5LMUL 2F0KA 4RCNA 4NB3A 1ESFA 1NE3A 4HEDA 3EIVA 3QOJA 1WTWA 1E1OA 1PH5A 5M3MH 4GOPA 4JC0A 4OWTB 3CC4A 3JC66 4LF4L 4HIKA 4KLKA 4BWGB 1L1OA 1TWFH 4LNQA 3H15A 4A3DH 3I7FA 4BBRH 1FNVA 1K8OA 2XRSD 4K0KQ 3ITPA 1AP0A 1I6HH 3OIQA 2KCTA 3L7ZC 1O7ZA 3NEMA 4H13C 3S16H 1TWAH 4FDBA 1WVLA 2B2TC 2F4VL 3IAM1 1EY4A 3A5UA 3HOWH 4DV2Q 1TWCH 4CHTB 2KUMA 5EAYA 2KCMA 3NXWA 1CTMA 1AZQA 3HOXG 1BBXC 1VQ6A 2V6EA 1GUGA 4OONA 1JB7A 1TIID 2JXMB 3MXNA 1HUNA 2AWNA 3A54A 5E1FA 3M4PA 2OQKA 4ME5A 1Q8IA 3E6ZX 4N9PA 3FKIB 3D31A 3JSBA 2F3WA 3M85A 1EEID 2EVBA 3MZ5A 1EYDA 3P7JA 4POGA 1IYVA 2QSBA 4A3BH 3MA2B 5FLXE 3HOUB 2WIIB 2XTIA 4LF8Q 5DM63 3TZUA 5M3FB 1U4PA 1YNJC 3QO2A 4IN3A 3SR1A 4WJ3M 5IIFA 3NTHA 4XTCS 2K5QA 2K4KA 3D0FA 3HOVG 1NR4A 3GD7A 3NWTA 5GAHC 1GUWA 2F0MA 1ASYA 4B3TL 2WFWA 2F4IA 4U6RA 2FJ2A 2KHIA 4QL5A 1PLFA 3CW2C 3UDGA 5I4DA 1UWVA 2XWBB 3ONAB 4DWLA 1S5BD 5C4XB 5EKIA 3F2DA 2XSCA 1VQLA 1RL2A 1K8GA 5CMDA 4GOPB 3M3YB 3VA5A 4GKJL 1HQRD 1L1OB 3L2PA 2ICEC 3GTPH 2PNRC 2X6LA 3AFQA 4BY7B 2F6MB 3MWYW 1TWHH 3I3CA 4G7OC 5KGUA 1N32L 4LF7Q 2ZXPA 2D2CC 1WTXA 2F0LA 4A3LH 5KEEA 3G48A 1PA6A 4YWMA 4V190 4C56C 5EJWA 2Q8IB 1G51A 2HUGA 4EQPA 3HS0C 2UUCQ 1A15A 1BUVT 3CKIB 1KDBA 3EVQA 4HEA1 5BR8Q 4Y7NB 2R61A 1PFNA 2F1MA 3PIP3 4H02A 5K36H 4J6HA 1WI5A 4JK1C 4OXPA 3MXNB 5JEAG 2A6HC 2JA8G 1TQOA 4B3SQ 2R3ZA 4HJ9A 1VQ7A 1SMYC 2D0OA 3K0YA 3LX0A 2UU9L 1X3FA 4OO1H 1CHQD 1BCPD 1VQFA 3E9IA 4X66L 4A3KH 4IUPA 4A3FG 1IZ6A 3G7LA 1Q81C 4JBJA 4XQJA 4B9XA 3P75A 3S24A 2GVAA 2F66B 4DR5Q 1Y1VH 3H0GB 1BO0A 1HNWQ 3LJ2A 5BN5A 2FFKB 3PUVA 4KY5A 2E74C 1QVCA 3MAQA 3S15B 4DV5L 4A3EH 2FXQA 1O7YA 4N8X1 1QE6A 1TS3A 2MHVA 1J6QA 5GAGC 3CCSA 1U0LA 3PQIA 3CAMA 2RDGA 2E75C 4CDDC 2EY6A 1PH3A 4LMQD 2A8VA 4R4TA 4JI4Q 1HFNA 3DO9A 3S2HB 1PH4A 5CBAE 3AFPA 4DR7L 1XWEA 2OEOA 3X3NA 2XMXA 3K7AH 1KQSA 4DK6C 5JVH3 2R93G 3RUZA 1KLGD 3OHXC 2NVYB 3Q24A 1NSNS 2MNAA 4A93G 3RNUA 4PMCA 1J5EQ 2N55A 2JA6H 3I4NG 3RN2A 3EA6A 4LF9Q 2EYLA 3B6YA 3T16A 1E1TA 3KLRA 1WCMG 4OIKA 1AN8A 4C3IB 3S1NB 4JI3L 2ENBA 2B63H 1SE2A 4ZQ3A
chains in the Genus database with same CATH topology
5JJLA 1VCIA 4DV7L 4JI2Q 1VQNA 1X3GA 1VQ9A 2K5VA 3RLOA 1SLJA 3S2HH 4JI0Q 2CWPA 3JAMi 4NXMQ 5JEAJ 2UXDQ 1WOCA 2JA9A 1OXVA 2V1CC 1FL0A 1QUQB 2ID0A 4Z7HA 3CPFA 3HKZE 4X62Q 4DUYQ 2VZAA 3CF5A 1K9MC 3KP9A 4B3MQ 4BBSG 1G6PA 5LMNQ 1IBMQ 3J80i 1I5FA 1L2FA 2AMCB 1V43A 1CSQA 3TQYA 3TEHB 5GROA 4DV3L 1Q46A 4IOCA 1M90C 1PVOA 1KC8C 4PG3A 1PH1A 4BY1H 4A3JH 1S3OA 2L1LB 3T1YL 1K83H 1JJGA 2YFAA 2I5LX 2L15A 1VS0A 3HKZG 1XTDA 3GTJH 2VY3A 3UDIA 1GD7A 3AQQA 3GDEA 4C3IH 3TS0A 1PH6A 4NXNQ 1K73C 2VUMG 4JI6Q 3S1NH 4BA2I 2DUDA 5FLMH 4C2MH 4C3HH 1OXUA 3I9V1 2OCEA 2Y0SG 3PGZA 4LW1A 4YY3Q 4AQYQ 3UITA 5FLXc 1OXTA 1YHBA 1XJVA 2JA8H 1BBWA 5M5XH 3PIOA 3RZOH 3CCLA 5FJ8G 4DR3Q 1HZAA 4AIMA 4LF7L 4DR6Q 3KDFA 1X9NA 1GVPA 1FGUA 2OQ0A 2PQAA 3FBVA 3K8AA 5ELNA 4DR4Q 4HFVA 3CCRA 5IP7G 1V1QA 1VQ8A 1SMXA 5IYBG 1CKNA 2IX1A 3LJ1A 2JEBI 4A3FH 4L5QA 4LF5Q 2AWOA 3W5OA 4A3GH 1GO3E 2IY5B 2R7DA 1X55A 1VQCA 2HIXA 1VQAA 4R4IA 1WFQA 5IWAQ 3F4MA 1N34Q 1HR0W 2UUCL 2PI2E 5HY6A 1VQKA 1H95A 5IP9G 5H1SE 5BR8L 3WWVA 2CFMA 4DV0L 4A3IH 4X64Q 4A3CG 2E2JH 2MO0A 3EBEA 3FKIG 2EXDA 1W3SA 1XMQL 3A5ZB 3KF8B 5C3EH 2E8GA 2XTQA 4YHHQ 3CCVA 4KI0A 4B3SL 2KKMA 2K5HA 1UE1A 1S72A 1D8LA 1N36Q 1X65A 2I0QA 1E7ZA 3H3VI 3HOXH 3HOUG 1SN8A 4C3JH 2UXCQ 1QVFA 1TWGH 3PO2H 5M3FG 2A19A 4PL4A 4JI1Q 2N78A 1WYDA 4BXXG 3I56A 4DV1L 1Q12A 4O1PA 3KF6B 4NPSA 5LMUQ 1LYLA 2ES2A 2R93H 1TXYA 1PH2A 3TRZA 4HIOA 4DNIA 3M9BA 1DGSA 2NVTH 3PUYA 5JJKA 4A3MG 3CC2A 2YTYA 3ULJA 4JYAL 4A93H 1YO7A 4P75A 2KHJA 3U4ZA 1Q1BA 1W2BA 1GM5A 4LF4Q 2NVQH 4A3LG 1IBKL 4DUZQ 2UU9Q 2QA4A 2JJQA 1EIYB 2NZHA 4DV2L 4B3RQ 5DLQE 1WCMH 3STBD 4NV5A 2RIOA 5C4XG 4L5TA 4X65Q 3S1MH 2ZJPA 2UUBQ 1I50H 1IBLQ 1BKBA 4IPDA 4DV4Q 2ALYB 2ZJQA 2JQOA 2JA7H 3P23A 3F1ZA 4UP8A 3VDYA 1JJCB 2IT1A 1MIUA 3CCMA 2WAQE 5HGQA 2Q2IA 1YJNA 1CKOA 1UEBA 4JI4L 3G71A 2VQFQ 4PZ6A 1LUZA 1Q8KA 4BY7G 5K36G 1HNXQ 2Q2TA 3K0XA 3T1HL 4UY8C 3HOZG 4BBSH 2F52A 5C44G 2ZJRA 3J81c 1QVGA 1D7QA 4DV5Q 4LFAL 2WP8J 3S14H 4O1OA 2ZM6Q 2NVXH 1IL2A 2Q2HA 5JJIA 2WAQG 1SE8A 3ICEA 1E24A 1JMCA 4YCVA 1KAWA 2CWAA 2VL6A 1I94Q 1EUJA 2CCZA 1J5EL 3KDFB 1WJJA 4DR2Q 1OXSC 2GVBA 4LF9L 2PQAB 1XNRQ 4EQ5A 2IP6A 2H5XA 4GN5A 3IAS1 1R9TH 4LWCA 3ULLA 4DR7Q 1CKNB 3NELA 1Q82C 3M4QA 1UE7A 1PH9A 4RMFA 4GLXA 1NMFA 5IYDH 3RR5A 3G6EA 1QZHA 4IPGA 4JI2L 2RF4A 3PCOB 1KRTA 4OWWB 3VA9A 1LM0A 3L0OA 3TREA 3CXCA 5FJ8H 4JI5L 4JI0L 4NXML 4OAVB 1YVCA 1KXLA 2QGQA 3W1GA 4X62L 4DUYL 3DA4A 4B3ML 1SJ8A 1N33Q 5LMNL 5IP7H 1IBML 3HOWG 1XMOL 2MO1A 2IHEA 5AJ3Q 1Q86C 4GXTA 3CMAA 2JB2A 4A3EG 3AEVA 3M7NA 1GKHA 4OAUC 4JCVE 3HKSA 2CQOA 4OWXB 4ME3A 2FUG1 2Z6KC 2XTRA 2A2CA 3AYHB 3OYYA 3I4MH 4Y52H 2R7ZH 4B3TQ 4UP9A 4GNXA 5IP9H 5IYCH 3OW2A 4MZ9A 3U58A 4A3CH 1P8LA 2ZTCA 4A4IA 4NV2A 1VQGA 2LSSA 4YY3L 4AQYL 4GN3B 4JBWA 1JE5A 2A1AA 2XGTA 3BZKA 2VQEQ 2HQLA 2WB1E 4P72A 1HH2P 4XIGS 3K81C 2JK8A 3KJOA 4KHPQ 3SDJA 1YJ9A 4AS2A 3H0GG 4KHZA 4IOAA 4DR6L 2KBNA 4A3BG 3HOUH 3E0EA 4POFA 2R92H 1VQJA 4DAYB 1JT8A 3I4OA 2JA6G 4GKJQ 3STBC 5M3FH 1PHJA 3KJPA 4YZCA 1VQIA 4BXXH 4Q9VA 4GN4B 1E22A 4HIDA 4LF5L 2EQSA 2Z6KA 1C9OA 1KIXA 1IYJB 2B63G 1FVIA 3CD6A 1SFOH 2A2DA 1N34L 5IWAL 3I55A 1N32Q 4DK3C 2K75A 3OTOQ 1AE2A 4A75A 3UE0A 4HJ7A 3GTMH 3CCEA 4A3MH 1S40A 4JV5Q 4WJ4A 3RZDH 4RG1A 4X64L 5ELOA 4TQUS 4IFDG 2RHSB 4DR1Q 2HHHQ 1XNQQ 1AE3A 3JAMc 1HZCA 1NBWA 3GTOH 3S2DH 2B3GA 4OO1I 3G4SA 5C4XH 2JE6I 4YHHL 3AJFA 2MFIA 4LUZA 1N36L 2CKZB 5C0XI 2UUAQ 1MKHA 2HIVA 2YTXA 2D0PA 2MJFB 4QIWE 4BY1G 2E5LQ 3J80c 4LFBQ 3NENA 1HNZL 1YHQA 3LGJA 2HT1A 2UXCL 1P16A 3CCQA 2VS1A 1CSPA 3UDFA 4P74A 4YWKA 4APVA 4DV0Q 4JI1L 1MJEA 4I1TA 2JAEA 4GS3A 5FLMG 3RN5A 4LF6Q 3HOYG 2LXJA 3HOZH 4JI8Q 5LMUL 1Y1WH 4NB3A 1XMQQ 2RHQB 1NE3A 3FP9A 3EIVA 4JBKA 5LMNW 4P73A 1E1OA 1KHIA 4DR5L 1PH5A 5M3MH 3KFUA 4GOPA 4JC0A 4OWTB 2IX0A 3PO3H 1M1KC 3CC4A 3JC66 4LF4L 4HIKA 1HNWL 3I4NH 4KLKA 1AH9A 2OWOA 1L1OA 1TWFH 2LXKA 5E7NA 3H15A 4DUZL 3I7FA 4LNQA 4BBRH 5M5YH 4A3DH 1JJ2A 4B3RL 5J3BA 3Q8DA 4HJAA 2JA5G 4X66Q 3PF4A 1YJWA 4X65L 4O2DA 2UUBL 4A3GG 4K0KQ 1XPOA 4DV4L 3H3VH 2ZTEA 1XPUA 3CCJA 4GKKQ 1I6HH 3J81j 2KCTA 3CP0A 4Y7NH 1X3EA 3L7ZC 3NEMA 3CC7A 3S16H 2I5HA 1TWAH 4YWLA 4FDBA 4JYAQ 4A3IG 4HJ8A 4MNOA 3ER0A 4GNXB 2VQFL 2BH8A 1Q1EA 2YV5A 3IAM1 2F4VL 1OXXK 3EN2A 3A5UA 4DV2Q 1B70B 1TWCH 3PV0A 1G291 2N3SA 4PZ8A 4DKAC 3PIPA 1C7YA 4J15A 5EAYA 2ZM6L 1VQMA 2KCMA 1I3QH 4TVAB 5C4JH 4JG2A 3J7A5 2PNHA 4DV6Q 4OX9Q 2UXBQ 3HOXG 1VQ6A 1HZ9A 3NBHB 2V6EA 2VUMH 1QZGA 1KL9A 4OONA 4DR2L 3MEFA 1K0RA 2BH2A 4OO1G 1IXRA 3DLLA 4QGUA 1JB7A 1XNRL 5HGIA 3HFZB 3A74A 3GO5A 4O0AA 4GNXC 2AWNA 4A3KG 2R7FA 5C0XG 3M4PA 4AYBE 2OQKA 4L5SA 1OTCA 4ALPA 4IFDI 1EFWA 1V9PA 1VQEA 2YU9H 3D31A 1HZBA 1C0AA 3JSBA 2UXDL 1VQDA 1NY4A 3M85A 3H0GH 3PF5A 2JB1A 3DM3A 4POGA 4IFDJ 4R4OA 3CPWA 1Y1VG 4JI7Q 4GLVB 4A3BH 1ASZA 4PL3A 1PFSA 4AS3A 4PZ7A 2K52A 1FJGL 1EWIA 1N33L 3S15H 3K80C 4LF8Q 1VQBA 1KRSA 2XTIA 5IYBH 1A63A 1Q7YC 5AJ3L 4JI3Q 4LFCQ 4WJ3M 2OTJA 1Y14B 3RLNA 3E9HA 1X6OA 4XTCS 2ZRRA 4DV7Q 2K4KA 3D0FA 2K50A 2NZOA 3GD7A 2JA7G 1U5KA 5GAHC 1Z9FA 3HOWH 3HOVG 4IJHA 1ASYA 2ASBA 4NXNL 1EOVA 3UDXA 4B3TL 2WFWA 4JI5Q 5IT9c 4U6RA 1N8RC 4JI6L 3W1BA 1EIFA 1FJGQ 2KHIA 4QL5A 3CW2C 3UDGA 5IE8A 1EQRA 3FKIH 3CCUA 2E2HH 1UWVA 2DGYA 4HIMA 2VQEL 2JB3A 1O7IA 5GQOA 1XMOQ 3K7UC 2OTLA 2NVYH 4DV3Q 4DWLA 2YYZA 2C35B 2Y0SE 4KHPL 5LNK1 3J7ZC 4DR3L 1EYGA 2YFBA 1PH7A 3CQZH 3F2DA 1PYBA 3T1YQ 1VQLA 1RL2A 1K8GA 1T9HA 3RLFA 4GOPB 4DR4L 3PUZA 1B7YB 4UP7A 4GKJL 1L1OB 3F8TA 4UPAA 2WB1G 2AHOB 1X56A 3L2PA 1YHAA 3GTPH 3GTQH 3HOYH 2N49A 2K19A 1K3RA 2KENA 3PSIA 3AFQA 3S17H 2F6MB 5IYDG 1PV4A 1TWHH 4QJFA 1XPRA 2P22B 2PI2A 1N32L 3OTOL 1YIJA 4LF7Q 2PMZE 3FHWA 4DPGA 4JV5L 4G76A 1A0IA 2IHFA 2YTVA 4A3LH 1VQ4A 2K14A 1MJCA 3LJ0A 3G48A 4GOPC 3S1RH 1PA6A 2RCNA 4DR1L 2HHHL 1XNQL 2JA5H 1L1OC 4YWMA 1EQQA 2ATWA 3GTKH 1BVSA 3F2CA 1LTLA 3A0JA 2UUAL 1G51A 3M3YH 1SRUA 4A3JG 1YITA 2E5LL 1VQPA 2UUCQ 1PYSB 2Q2UA 1CKMA 4LFBL 5C0XJ 1YI2A 3KLWA 5GADC 1YEZA 3TS2A 1QUQA 3I4MG 5GAEC 4HEA1 5BR8Q 3J81i 2R7ZG 5IYCG 2JEAI 4JBMA 4H02A 4BY7H 4YZ9A 1WI5A 4OXPA 3U4VA 4LF6L 3MXNB 5C44H 5JEAG 3CMEA 2CAZB 4JI8L 1Z47A 2JA8G 4DAMA 4IPCA 1A8VA 4IO9A 1HR0Q 4QQBX 4B3SQ 4Z7GA 1UE6A 1VQ5A 1YBYA 2NN6I 4R4QA 4HJ9A 4A76A 1KD1C 2MQHA 3BJUA 1VQ7A 4L5RC 2D0OA 4IJLA 3PUXA 4LUVA 1HNZQ 2E2IH 3GTLH 2UU9L 1X3FA 2R92G 4YCWA 3DA3A 4R1JA 2F3IA 4HJ5A 1VQFA 3E9IA 4X66L 4A3KH 2AKWB 4P71A 4DV1Q 1IZ6A 3UE1A 1B8AA 4JBJA 4A3FG 1Q81C 1IBLL 2BA1A 4K0KL 4IPHA 1SR3A 3S24A 3KOJA 4GKKL 4JOIC 3GTGH 2GVAA 2BA0A 4PMWA 1PH8A 4QY7A 2F66B 1NJIC 4DR5Q 1Y1VH 1A62A 2Z0SA 4YZDA 1CUKA 2EIFA 4R4CA 1UE5A 1HNWQ 3LJ2A 1NMGA 4X6AH 1IBKQ 2QEXA 1HNXL 3PUVA 3SGIA 1BBUA 1QVCA 3ULPA 1N9WA 4GLAC 5C3EG 3F2BA 2B29A 4DV5L 4A3EH 2FXQA 4YCUA 4BA1I 3IRBA 1VQHA 1YNXA 1J6QA 5GAGC 3CCSA 4DV6L 1U0LA 4OX9L 1L0WA 3HOVH 1I94L 1K8AC 3CAMA 4EX5A 3ZJYC 2UXBL 4G75A 2K5NA 3PO2G 1PH3A 2A8VA 4R4TA 4JI4Q 3BU2A 3DO9A 1RIPA 1PH4A 1HR0L 3AFPA 4DR7L 3M4OH 2D62A 2N8NA 3T1HQ 3L0IA 4JOIA 3BZCA 2I5MX 2F4VQ 2XMXA 3K7AH 1KQSA 4DK6C 1Y1WG 2R93G 4LFAQ 5IY0A 3U50C 2GN5A 3ERSX 2R6GA 3S1QH 1VQOA 1SROA 1X54A 1HJPA 5M3MG 1YZ6A 3KYHC 2MNAA 4JI7L 3RNUA 4A93G 3PO3G 4LUOA 1J5EQ 2JA6H 1NTGA 4AYBG 3I4NG 3RN2A 4LF9Q 4MTNA 3B6YA 4A3DG 4LF8L 4BBRG 2VW9A 1E1TA 1WCMG 3KF6A 4PL5A 4AH6A 5M5WH 2NN6G 2ZTDA 3PUWA 4LFCL 4JI3L 2VNUD 1E3PA 2B63H 3I2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJL A;  1VCI A;  4DV7 L;  4JI2 Q;  1VQN A;  1X3G A;  1VQ9 A;  2K5V A;  3RLO A;  1SLJ A;  3S2H H;  4JI0 Q;  2CWP A;  3JAM i;  4NXM Q;  5JEA J;  2UXD Q;  1WOC A;  2JA9 A;  1OXV A;  1QUQ B;  1FL0 A;  2ID0 A;  2V1C C;  3CPF A;  3HKZ E;  4X62 Q;  4DUY Q;  1K9M C;  2VZA A;  3CF5 A;  4B3M Q;  1FJG L;  4BBS G;  1G6P A;  5LMN Q;  1IBM Q;  3J80 i;  1L2F A;  1I5F A;  2AMC B;  1V43 A;  1CSQ A;  3TQY A;  3TEH B;  5GRO A;  4DV3 L;  1Q46 A;  4IOC A;  1M90 C;  1PVO A;  1KC8 C;  4PG3 A;  1PH1 A;  4BY1 H;  4A3J H;  1S3O A;  1JJG A;  3T1Y L;  1K83 H;  2I5L X;  2L15 A;  3GTJ H;  1VS0 A;  3HKZ G;  1XTD A;  2VY3 A;  3UDI A;  1GD7 A;  3AQQ A;  3GDE A;  4C3I H;  3TS0 A;  1PH6 A;  4NXN Q;  1K73 C;  2VUM G;  4JI6 Q;  3S1N H;  4BA2 I;  2DUD A;  5FLM H;  4C2M H;  4C3H H;  1OXU A;  2OCE A;  2Y0S G;  4LW1 A;  3PGZ A;  4YY3 Q;  4AQY Q;  5FLX c;  1OXT A;  1YHB A;  1XJV A;  2JA8 H;  1BBW A;  5M5X H;  3PIO A;  3RZO H;  3CCL A;  5FJ8 G;  4DR3 Q;  1HZA A;  4AIM A;  4LF7 L;  4DR6 Q;  3KDF A;  1X9N A;  1GVP A;  1FGU A;  2OQ0 A;  2PQA A;  5ELN A;  3K8A A;  4DR4 Q;  3CCR A;  5IP7 G;  1V1Q A;  1VQ8 A;  1SMX A;  5IYB G;  1CKN A;  2IX1 A;  2JEB I;  4A3F H;  4L5Q A;  4LF5 Q;  2AWO A;  3W5O A;  4A3G H;  1GO3 E;  2IY5 B;  2R7D A;  1X55 A;  1VQC A;  2HIX A;  1VQA A;  4R4I A;  1WFQ A;  5IWA Q;  1N34 Q;  1HR0 W;  2UUC L;  2PI2 E;  5HY6 A;  1VQK A;  1H95 A;  5IP9 G;  5H1S E;  5BR8 L;  3WWV A;  2CFM A;  4DV0 L;  4A3I H;  4X64 Q;  4A3C G;  2E2J H;  2MO0 A;  3EBE A;  3FKI G;  2EXD A;  1W3S A;  1XMQ L;  3A5Z B;  3KF8 B;  5C3E H;  2E8G A;  3CCV A;  4YHH Q;  4KI0 A;  4B3S L;  2K5H A;  1UE1 A;  1S72 A;  1D8L A;  1N36 Q;  1X65 A;  2I0Q A;  1E7Z A;  3H3V I;  3HOX H;  3HOU G;  1SN8 A;  4C3J H;  2UXC Q;  1QVF A;  1TWG H;  3PO2 H;  5M3F G;  2A19 A;  4JI1 Q;  2N78 A;  1WYD A;  4BXX G;  3I56 A;  4DV1 L;  1Q12 A;  3KF6 B;  4NPS A;  5LMU Q;  1LYL A;  2ES2 A;  2R93 H;  1TXY A;  1PH2 A;  3TRZ A;  4HIO A;  4DNI A;  3M9B A;  1DGS A;  2NVT H;  3PUY A;  5JJK A;  4A3M G;  3CC2 A;  2YTY A;  3ULJ A;  4JYA L;  4A93 H;  4P75 A;  2KHJ A;  3U4Z A;  1Q1B A;  1W2B A;  1GM5 A;  4LF4 Q;  2NVQ H;  4A3L G;  1IBK L;  4DUZ Q;  2UU9 Q;  2QA4 A;  2JJQ A;  1EIY B;  2NZH A;  4DV2 L;  4B3R Q;  5DLQ E;  1WCM H;  3STB D;  5C4X G;  4L5T A;  4X65 Q;  3S1M H;  2ZJP A;  2UUB Q;  1I50 H;  1IBL Q;  1BKB A;  4IPD A;  4DV4 Q;  2ALY B;  2ZJQ A;  2JQO A;  2JA7 H;  3F1Z A;  4UP8 A;  3VDY A;  1JJC B;  2IT1 A;  1MIU A;  3CCM A;  2WAQ E;  5HGQ A;  2Q2I A;  1YJN A;  1CKO A;  1UEB A;  4JI4 L;  3G71 A;  2VQF Q;  4PZ6 A;  1LUZ A;  1Q8K A;  4BY7 G;  5K36 G;  1HNX Q;  2Q2T A;  3K0X A;  3T1H L;  4UY8 C;  3HOZ G;  4BBS H;  2F52 A;  5C44 G;  2ZJR A;  3J81 c;  1QVG A;  1D7Q A;  4DV5 Q;  4LFA L;  2WP8 J;  3S14 H;  2ZM6 Q;  2NVX H;  1IL2 A;  5JJI A;  2Q2H A;  2WAQ G;  1SE8 A;  3ICE A;  1E24 A;  1JMC A;  4YCV A;  1KAW A;  2CWA A;  2VL6 A;  1I94 Q;  1EUJ A;  2CCZ A;  1J5E L;  3KDF B;  1WJJ A;  4DR2 Q;  1OXS C;  2GVB A;  4LF9 L;  2PQA B;  1XNR Q;  4EQ5 A;  2H5X A;  4GN5 A;  1R9T H;  4LWC A;  3ULL A;  4DR7 Q;  1CKN B;  3NEL A;  1Q82 C;  3M4Q A;  1UE7 A;  1PH9 A;  4RMF A;  4GLX A;  1NMF A;  5IYD H;  3RR5 A;  3G6E A;  1QZH A;  4IPG A;  4JI2 L;  2RF4 A;  3PCO B;  1KRT A;  4OWW B;  3L0O A;  1LM0 A;  3TRE A;  3CXC A;  4JI0 L;  5FJ8 H;  4JI5 L;  4NXM L;  1YVC A;  1KXL A;  2QGQ A;  3W1G A;  4X62 L;  4DUY L;  4B3M L;  1N33 Q;  5LMN L;  5IP7 H;  1IBM L;  3HOW G;  1XMO L;  2MO1 A;  2IHE A;  5AJ3 Q;  1Q86 C;  3CMA A;  3AEV A;  4A3E G;  3M7N A;  1GKH A;  4JCV E;  3HKS A;  2CQO A;  4OWX B;  4ME3 A;  2Z6K C;  3AYH B;  3OYY A;  3I4M H;  4Y52 H;  2R7Z H;  4B3T Q;  4UP9 A;  4GNX A;  5IP9 H;  5IYC H;  3OW2 A;  4MZ9 A;  3U58 A;  4A3C H;  1P8L A;  2ZTC A;  4A4I A;  1VQG A;  2LSS A;  4YY3 L;  4AQY L;  4GN3 B;  4JBW A;  1JE5 A;  2A1A A;  2XGT A;  3BZK A;  2VQE Q;  2HQL A;  2WB1 E;  4P72 A;  1HH2 P;  4XIG S;  3K81 C;  2JK8 A;  3KJO A;  4KHP Q;  1YJ9 A;  3H0G G;  4KHZ A;  4IOA A;  4DR6 L;  2KBN A;  4A3B G;  3HOU H;  3E0E A;  4POF A;  2R92 H;  1VQJ A;  4DAY B;  1JT8 A;  3I4O A;  2JA6 G;  4GKJ Q;  3STB C;  5M3F H;  1PHJ A;  3KJP A;  1VQI A;  4BXX H;  4GN4 B;  1E22 A;  4HID A;  4LF5 L;  2Z6K A;  2EQS A;  1C9O A;  1KIX A;  1IYJ B;  2B63 G;  1FVI A;  3CD6 A;  1SFO H;  1N34 L;  5IWA L;  3I55 A;  1N32 Q;  4DK3 C;  2K75 A;  3OTO Q;  1AE2 A;  4A75 A;  3UE0 A;  4HJ7 A;  3GTM H;  3CCE A;  4A3M H;  1S40 A;  4JV5 Q;  4WJ4 A;  3RZD H;  4RG1 A;  4X64 L;  5ELO A;  4TQU S;  4IFD G;  2RHS B;  4DR1 Q;  2HHH Q;  1XNQ Q;  1AE3 A;  3JAM c;  1HZC A;  1NBW A;  3GTO H;  3S2D H;  2B3G A;  4OO1 I;  3G4S A;  5C4X H;  2JE6 I;  4YHH L;  2MFI A;  4LUZ A;  1N36 L;  2CKZ B;  5C0X I;  2UUA Q;  1MKH A;  2HIV A;  2YTX A;  2D0P A;  4BY1 G;  4QIW E;  2E5L Q;  3J80 c;  4LFB Q;  3NEN A;  1HNZ L;  1YHQ A;  3LGJ A;  2HT1 A;  2UXC L;  1P16 A;  3CCQ A;  2VS1 A;  1CSP A;  3UDF A;  4P74 A;  4YWK A;  4APV A;  4DV0 Q;  4JI1 L;  1MJE A;  4GS3 A;  5FLM G;  3RN5 A;  4LF6 Q;  3HOY G;  2LXJ A;  3HOZ H;  4JI8 Q;  5LMU L;  1Y1W H;  4NB3 A;  1XMQ Q;  2RHQ B;  1NE3 A;  3FP9 A;  3EIV A;  4JBK A;  5LMN W;  4P73 A;  1E1O A;  1KHI A;  4DR5 L;  1PH5 A;  5M3M H;  3KFU A;  4GOP A;  4JC0 A;  4OWT B;  2IX0 A;  3PO3 H;  1M1K C;  3CC4 A;  3JC6 6;  4LF4 L;  4HIK A;  1HNW L;  3I4N H;  4KLK A;  1AH9 A;  2OWO A;  1L1O A;  1TWF H;  2LXK A;  5E7N A;  3H15 A;  4DUZ L;  3I7F A;  4LNQ A;  4BBR H;  5M5Y H;  4A3D H;  1JJ2 A;  4B3R L;  5J3B A;  3Q8D A;  4HJA A;  2JA5 G;  4X66 Q;  3PF4 A;  1YJW A;  4X65 L;  4O2D A;  2UUB L;  4A3G G;  4K0K Q;  1XPO A;  4DV4 L;  3H3V H;  2ZTE A;  1XPU A;  3CCJ A;  4GKK Q;  1I6H H;  3J81 j;  2KCT A;  3CP0 A;  4Y7N H;  1X3E A;  3L7Z C;  3NEM A;  3CC7 A;  3S16 H;  2I5H A;  1TWA H;  4YWL A;  4FDB A;  4JYA Q;  4A3I G;  4HJ8 A;  4MNO A;  3ER0 A;  4GNX B;  2VQF L;  2BH8 A;  1Q1E A;  2YV5 A;  2F4V L;  1OXX K;  3EN2 A;  3A5U A;  4DV2 Q;  1B70 B;  1TWC H;  3PV0 A;  1G29 1;  2N3S A;  4PZ8 A;  4DKA C;  3PIP A;  1C7Y A;  4J15 A;  5EAY A;  2ZM6 L;  1VQM A;  2KCM A;  1I3Q H;  4TVA B;  5C4J H;  4JG2 A;  3J7A 5;  2PNH A;  4DV6 Q;  4OX9 Q;  2UXB Q;  3HOX G;  1VQ6 A;  1HZ9 A;  3NBH B;  2VUM H;  1QZG A;  1KL9 A;  4OON A;  4DR2 L;  3MEF A;  1K0R A;  2BH2 A;  4OO1 G;  1IXR A;  3DLL A;  4QGU A;  1JB7 A;  1XNR L;  3HFZ B;  3A74 A;  3GO5 A;  4O0A A;  4GNX C;  2AWN A;  4A3K G;  2R7F A;  5C0X G;  3M4P A;  4AYB E;  2OQK A;  4L5S A;  1OTC A;  4ALP A;  4IFD I;  1EFW A;  1V9P A;  1VQE A;  2YU9 H;  3D31 A;  1HZB A;  1C0A A;  2UXD L;  1VQD A;  1NY4 A;  3M85 A;  3H0G H;  3PF5 A;  3DM3 A;  4POG A;  4IFD J;  4R4O A;  3CPW A;  1Y1V G;  4JI7 Q;  4GLV B;  4A3B H;  1ASZ A;  1PFS A;  4PZ7 A;  2K52 A;  1EWI A;  1N33 L;  3S15 H;  3K80 C;  4LF8 Q;  1VQB A;  1KRS A;  2XTI A;  5IYB H;  1A63 A;  1Q7Y C;  5AJ3 L;  4JI3 Q;  4LFC Q;  4WJ3 M;  2OTJ A;  1Y14 B;  3RLN A;  3E9H A;  1X6O A;  4XTC S;  4DV7 Q;  2K4K A;  3D0F A;  2K50 A;  2NZO A;  3GD7 A;  2JA7 G;  1U5K A;  5GAH C;  1Z9F A;  3HOW H;  3HOV G;  4IJH A;  1ASY A;  2ASB A;  4NXN L;  1EOV A;  3UDX A;  4B3T L;  2WFW A;  4JI5 Q;  5IT9 c;  4JI6 L;  1N8R C;  3W1B A;  1EIF A;  1FJG Q;  2KHI A;  4QL5 A;  3CW2 C;  3UDG A;  5IE8 A;  1EQR A;  3FKI H;  3CCU A;  2E2H H;  1UWV A;  2DGY A;  4HIM A;  2VQE L;  1O7I A;  2OTL A;  5GQO A;  1XMO Q;  3K7U C;  2NVY H;  4DV3 Q;  2YYZ A;  2C35 B;  2Y0S E;  4KHP L;  3J7Z C;  4DR3 L;  1EYG A;  1PH7 A;  3CQZ H;  3F2D A;  1PYB A;  3T1Y Q;  1VQL A;  1RL2 A;  1K8G A;  1T9H A;  3RLF A;  4GOP B;  4DR4 L;  3PUZ A;  1B7Y B;  4UP7 A;  4GKJ L;  1L1O B;  3F8T A;  4UPA A;  2WB1 G;  2AHO B;  1X56 A;  3L2P A;  1YHA A;  3GTP H;  3GTQ H;  3HOY H;  2N49 A;  1K3R A;  2KEN A;  3PSI A;  3AFQ A;  3S17 H;  5IYD G;  1PV4 A;  1TWH H;  4QJF A;  1XPR A;  2PI2 A;  1N32 L;  3OTO L;  1YIJ A;  4LF7 Q;  2PMZ E;  3FHW A;  4DPG A;  4JV5 L;  2IHF A;  1A0I A;  2YTV A;  4A3L H;  1VQ4 A;  2K14 A;  1MJC A;  3G48 A;  4GOP C;  3S1R H;  1PA6 A;  2RCN A;  4DR1 L;  2HHH L;  1XNQ L;  2JA5 H;  1L1O C;  4YWM A;  1EQQ A;  2ATW A;  3GTK H;  1BVS A;  3F2C A;  1LTL A;  3A0J A;  2UUA L;  1G51 A;  3M3Y H;  1SRU A;  4A3J G;  1YIT A;  2E5L L;  1VQP A;  2UUC Q;  1PYS B;  2Q2U A;  1CKM A;  4LFB L;  5C0X J;  1YI2 A;  3KLW A;  5GAD C;  1YEZ A;  3TS2 A;  1QUQ A;  3I4M G;  5GAE C;  5BR8 Q;  3J81 i;  2R7Z G;  5IYC G;  2JEA I;  4JBM A;  4H02 A;  4BY7 H;  1WI5 A;  4OXP A;  3U4V A;  4LF6 L;  3MXN B;  5C44 H;  5JEA G;  3CME A;  4JI8 L;  1Z47 A;  2JA8 G;  4DAM A;  4IPC A;  1A8V A;  4IO9 A;  1HR0 Q;  4QQB X;  4B3S Q;  1UE6 A;  1VQ5 A;  1YBY A;  2NN6 I;  4R4Q A;  4HJ9 A;  4A76 A;  1KD1 C;  2MQH A;  3BJU A;  1VQ7 A;  4L5R C;  2D0O A;  4IJL A;  3PUX A;  4LUV A;  1HNZ Q;  2E2I H;  3GTL H;  2UU9 L;  1X3F A;  2R92 G;  4YCW A;  4R1J A;  2F3I A;  4HJ5 A;  1VQF A;  3E9I A;  4X66 L;  4A3K H;  2AKW B;  4P71 A;  4DV1 Q;  1IZ6 A;  3UE1 A;  1B8A A;  4JBJ A;  4A3F G;  1Q81 C;  1IBL L;  2BA1 A;  4K0K L;  4IPH A;  1SR3 A;  3S24 A;  3KOJ A;  4GKK L;  4JOI C;  3GTG H;  2GVA A;  2BA0 A;  4PMW A;  1PH8 A;  4QY7 A;  1NJI C;  4DR5 Q;  1Y1V H;  1A62 A;  2Z0S A;  1CUK A;  2EIF A;  4R4C A;  1UE5 A;  1HNW Q;  4X6A H;  1NMG A;  1IBK Q;  2QEX A;  1HNX L;  3PUV A;  3SGI A;  1BBU A;  1QVC A;  3ULP A;  1N9W A;  4GLA C;  5C3E G;  3F2B A;  2B29 A;  4DV5 L;  4A3E H;  2FXQ A;  4YCU A;  4BA1 I;  3IRB A;  1VQH A;  1YNX A;  1J6Q A;  5GAG C;  3CCS A;  4DV6 L;  1U0L A;  4OX9 L;  1L0W A;  3HOV H;  1I94 L;  1K8A C;  3CAM A;  4EX5 A;  3ZJY C;  2UXB L;  2K5N A;  3PO2 G;  1PH3 A;  2A8V A;  4R4T A;  4JI4 Q;  3BU2 A;  1RIP A;  1PH4 A;  1HR0 L;  3AFP A;  4DR7 L;  3M4O H;  2D62 A;  2N8N A;  3T1H Q;  4JOI A;  3BZC A;  2I5M X;  2F4V Q;  3K7A H;  1KQS A;  4DK6 C;  1Y1W G;  2R93 G;  4LFA Q;  5IY0 A;  3U50 C;  2GN5 A;  3ERS X;  2R6G A;  3S1Q H;  1VQO A;  1SRO A;  1X54 A;  1HJP A;  5M3M G;  1YZ6 A;  3KYH C;  2MNA A;  4JI7 L;  3RNU A;  4A93 G;  3PO3 G;  4LUO A;  1J5E Q;  2JA6 H;  1NTG A;  4AYB G;  3I4N G;  3RN2 A;  4LF9 Q;  4MTN A;  3B6Y A;  4A3D G;  4LF8 L;  4BBR G;  2VW9 A;  1E1T A;  1WCM G;  3KF6 A;  4AH6 A;  5M5W H;  2NN6 G;  2ZTD A;  3PUW A;  4LFC L;  4JI3 L;  2VNU D;  1E3P A;  2B63 H;  3I2Z A; 
#chains in the Genus database with same CATH topology
 3HOY B;  5JJL A;  1VCI A;  4JI2 Q;  4DNT B;  1HTP A;  1VQ9 A;  4F87 A;  3JAM i;  5JEA J;  2PYK A;  1FL0 A;  2ID0 A;  3HKZ E;  2K28 A;  2VZA A;  4BBS G;  3WOE A;  2XIW A;  1I5F A;  3TQY A;  1DCZ A;  1EFI D;  2EY5 A;  5GRO A;  1H9M A;  1Q46 A;  4IOC A;  4F88 A;  4BY1 H;  5DAU A;  5IGG A;  4A3J H;  2L1L B;  3T1Y L;  1K83 H;  1JJG A;  3GTJ H;  4OIJ A;  1PH6 A;  4MTK A;  2VUM G;  2A74 C;  4HAE A;  4DK1 A;  5FLM H;  2Y0S G;  1YHB A;  3NPP A;  1H9J A;  1I4H A;  2KEC A;  4DF7 A;  1V8Q A;  3MVV A;  4DR3 Q;  1D5M C;  5CV4 A;  4DR4 Q;  2A69 C;  3EFX D;  1KDC A;  5IYB G;  2IX1 A;  2AWO A;  1EQV A;  4JW0 A;  5FK9 C;  2IY5 B;  2R7D A;  1VQC A;  4R4I A;  1HR0 W;  5IWA Q;  1EU4 A;  2L9H A;  1H95 A;  4OHJ A;  4A3I H;  4DV0 L;  4X3S A;  3EBE A;  2BDN A;  1NNX A;  2F0J A;  4WJW A;  2NUC A;  2LY7 A;  3CCV A;  2B2V C;  2K5H A;  1S72 A;  1N36 Q;  1D8L A;  1X65 A;  4B9W A;  1S4Z A;  5ISR A;  1CI3 M;  3H3V I;  4C3J H;  3HOV B;  1QNU A;  4IUN A;  4PL4 A;  3DWQ A;  4JI1 Q;  1EY5 A;  4G7H C;  5C0X H;  3Q6S A;  4DV1 L;  1Q12 A;  5LMU Q;  1STY A;  1B44 D;  3I72 A;  3M4O B;  4TKO B;  1TXY A;  3SHL A;  1WTH A;  2BE5 D;  3H09 A;  3BDO A;  4KK7 A;  1DGS A;  3ULJ A;  1CZW A;  3S1Q B;  3KLS X;  2NTS A;  4LF4 Q;  1J8I A;  2RA4 A;  2JJQ A;  3A8J E;  1EIY B;  4DV2 L;  2Z8L A;  3R2I A;  4RGM A;  1JC7 A;  2NN6 H;  2B2W A;  3P20 A;  2ALY B;  1EWH A;  2ZJQ A;  5T1I A;  2JQO A;  1B9M A;  2IT1 A;  3CCM A;  2WAQ E;  2Q2I A;  1CKO A;  4UHV A;  1QJO A;  1STA A;  1HXY D;  1XX8 A;  4XXE A;  1Q8K A;  2O5J C;  1HNX Q;  2Q2T A;  4UY8 C;  3HOZ G;  3SXH A;  2ZJR A;  1SDF A;  4MN3 A;  2WP8 J;  3DWA A;  2RSO A;  2NBF A;  2CWA A;  1I94 Q;  2CCZ A;  3D8G A;  1OXS C;  2GVB A;  4EVO A;  4YIJ A;  3C3L A;  3VR5 A;  2IP6 A;  2H5X A;  2OF1 A;  4GN5 A;  3ULL A;  1F77 A;  3M4Q A;  3K5N A;  2K5W A;  5IYD H;  3RR5 A;  1E2Z A;  1KRT A;  1F9P A;  2JA8 B;  3MFG A;  3TRE A;  4NXM L;  3T13 A;  4OAV B;  3RZO B;  4X62 L;  1DOL A;  1SJ8 A;  2C5C A;  5LMN L;  4KJO A;  4IAL A;  1KAB A;  2TSS A;  4A3F B;  2GA4 B;  2F0U A;  2F0G A;  2Z6K C;  2XTR A;  4K5W A;  3I4M H;  1Z7T A;  2R7Z H;  4B3T Q;  5IT9 L;  5IYC H;  4IZ8 A;  2A5H A;  1ONL A;  3I8Z A;  1EEF D;  3NK9 A;  4A4I A;  2LS0 1;  5J39 A;  2LSS A;  4DFA A;  2XGT A;  1JQO A;  2HQL A;  2WB1 E;  3KJO A;  4AS2 A;  1U9R A;  1STG A;  4HSP A;  3QG1 A;  3HOU H;  1PXU A;  3E0E A;  4POF A;  2R92 H;  4OL7 A;  2LMC B;  4Q0F A;  4GKJ Q;  5M3F H;  3CU7 A;  3V96 A;  3SK5 A;  4CGY B;  1I4G A;  1VQI A;  2V4D A;  1QB5 D;  5LL6 S;  4GN4 B;  4LF5 L;  4HID A;  2EQS A;  1ENC A;  3Q22 A;  4OGQ C;  3T51 B;  1N34 L;  1SXT A;  3I55 A;  1N32 Q;  2R93 B;  1AE2 A;  3UE0 A;  1GOZ A;  4RG1 A;  1KLU D;  3FDT A;  4TQU S;  4A93 B;  4IFD G;  2RHS B;  1HZC A;  1HTL D;  1NBW A;  3I4N B;  2B3G A;  3QOL A;  5C4X H;  2JE6 I;  4YHH L;  1WCM B;  2QDL A;  2CKZ B;  5C0X I;  3S1M B;  1YNJ D;  4U67 3;  5ELF A;  3AB9 A;  4WFN 3;  1S5D D;  3CCQ A;  1CSP A;  2D5D A;  1NUC A;  1MJE A;  1AW7 A;  1PDQ A;  4GS3 A;  4C3H G;  2J7Z A;  4RAU C;  4H7B A;  5JOB A;  1XMQ Q;  1HA6 A;  4BBS B;  2L55 A;  3FP9 A;  5JVG 3;  1T5X D;  1LV9 A;  2CQA A;  2F0N A;  4DR5 L;  2IX0 A;  3PO3 H;  1T5E A;  2PQE A;  3HP3 A;  1HNW L;  5AFW A;  4CBV A;  1AH9 A;  3MTS A;  1WD1 A;  2XNA C;  2JA5 G;  4X66 Q;  3PF4 A;  2VUM B;  4CKE A;  4HCE A;  1KNA A;  2Y0S B;  1XPU A;  3J81 j;  3M4Y A;  4Y7N H;  1X3E A;  1CT1 D;  3BDC A;  4ODG A;  3K5L A;  2YU9 B;  4YWL A;  1SE3 A;  3L3O C;  3ER0 A;  2BH8 A;  2YV5 A;  2EYM A;  3I70 A;  1H9S A;  4PZ8 A;  1G29 1;  2N3S A;  1G91 A;  3QJY A;  4J15 A;  1I3Q H;  4JG2 A;  3SEB A;  3R8B A;  2QIL A;  2BH2 A;  1HUM A;  2TMP A;  4QGU A;  5I2X A;  4HN7 A;  4GNX C;  2R7F A;  4XYQ A;  1S5C D;  3FMC A;  4IFD I;  2HDM A;  1EFW A;  2A6H D;  1VQE A;  2E2H B;  1HZB A;  3O13 A;  5ELD A;  4IFD J;  3H0G H;  4CJ0 B;  3CPW A;  2MGS A;  1SEB D;  3DWP A;  3NP8 A;  4PL3 A;  2K32 A;  4PZ7 A;  1SMY D;  3HEJ A;  2IWH A;  3S15 H;  2EE1 A;  1VQB A;  1KRS A;  5KND A;  4PNY A;  4LK1 C;  1Q7Y C;  4JI3 Q;  5D65 A;  1U4R A;  1X6O A;  1Z9F A;  4IJH A;  2F0D A;  3ERO A;  1G8Z D;  3UDX A;  4JI5 Q;  1N8R C;  1EIF A;  1IYU A;  1X3P A;  1EQR A;  3RZD B;  2ZT9 C;  4IUU A;  2DGY A;  2F0F A;  1H9K A;  1O7I A;  4HIM A;  5GQO A;  4FYD A;  2NVY H;  3S2D B;  5LNK 1;  1FR3 A;  2KQ3 A;  3J7Z C;  4DR3 L;  2B2U A;  5F2D A;  1PH7 A;  3ND9 A;  1PYB A;  3T1Y Q;  1I4P A;  4DR4 L;  2P5Z X;  3PUZ A;  1F9S A;  2FIN B;  4RCO A;  3NQT A;  4KY6 A;  3HOY H;  2K19 A;  5FLX L;  2KEN A;  3PSI A;  1STE A;  3S17 H;  3HOZ B;  4K2L A;  1Y1W B;  4QJF A;  1EWC A;  2PMZ E;  4DPG A;  4G76 A;  5DM7 3;  3OMC A;  3H91 A;  3S1R H;  2RCN A;  5IGD A;  3FEW X;  2HHH L;  2E2I B;  1RDP D;  1H9S B;  3D4W A;  2G9H D;  2UUA L;  3MC0 B;  1SRU A;  1F9Q A;  1PYS B;  2Q2U A;  3K5M A;  2CHB D;  2EYO A;  5GAD C;  3TS2 A;  5GAE C;  4NW2 A;  1FNW A;  1LTA D;  2JEA I;  1B9N A;  4JBM A;  1PTO C;  4YZ9 A;  2HCI A;  5C44 H;  2CAZ B;  1ROD A;  3DEO A;  4JI8 L;  5JPM C;  3JAM L;  1A8V A;  3K58 A;  3DM1 A;  1UE6 A;  1PTO H;  4WOR A;  2AUK A;  2VB3 X;  1Y69 U;  1LTB D;  4R1J A;  2F3I A;  1Y8P B;  2AKW B;  4DV1 Q;  1SR3 A;  3NE5 B;  3KOJ A;  2G9D A;  3GTG H;  2K33 A;  1G2S A;  3OOC A;  1NJI C;  1XYI A;  4YZD A;  1HHV A;  1UE5 A;  1NMG A;  3GV6 A;  1HNX L;  2ZW3 A;  4MIU A;  2F3V A;  4ULL A;  2A69 D;  2B29 A;  2MP1 A;  1VQH A;  5M5W B;  4DV6 L;  4OX9 L;  3BG3 A;  1GUO A;  1I94 L;  3SK8 A;  3HOV H;  1EOT A;  1GUN A;  2AQ3 B;  4G75 A;  2K5N A;  3VR2 A;  3KK7 A;  2IPK D;  3M4O H;  3LWE A;  3L0I A;  3FRP B;  2I5M X;  4JOI A;  1IHZ A;  3QWN A;  4S3S A;  4FF4 A;  5IY0 A;  3U50 C;  2GN5 A;  3ERS X;  2R6G A;  3S1Q H;  5CV9 A;  1SRO A;  5M3M G;  3KYH C;  4JI7 L;  2Q8R E;  3CQZ B;  1NTG A;  2EYJ A;  4AYB G;  2OT2 A;  3LNN A;  4L63 B;  4A3D G;  4BBR G;  2VW9 A;  1OO9 B;  3PUW A;  4LFC L;  2VNU D;  1R4Q B;  3I2Z A;  4PV1 C;  4O1N A;  5IGF A;  4C3H B;  1MSG A;  3T53 B;  2MPM A;  4HTH A;  1BCP B;  1X3G A;  1W6K A;  2UXD Q;  3KUP A;  4NXM Q;  3PMF A;  1STN A;  1WOC A;  3SVM A;  2V1C C;  4X62 Q;  4ZLT F;  3CF5 A;  4F7X A;  5LMN Q;  4DAP A;  4FP5 D;  1ZYR D;  3J7Y W;  3D4D A;  3ND8 A;  3C46 A;  1D2B A;  3TME A;  2JA5 B;  1Q90 A;  2EZV A;  1DZ1 A;  3GTK B;  2K05 A;  3HKZ G;  3JAM E;  4BA2 I;  4JI6 Q;  5L37 A;  2PZU A;  1MSH A;  2AQ1 B;  4ID6 A;  1SND A;  2K7V A;  5EKK A;  1OXT A;  1XJV A;  2JA8 H;  3F2U A;  4E6I A;  5M5X H;  3PIO A;  4R8N A;  5CBE E;  3RZO H;  1CA6 A;  3CCL A;  4RHS A;  1E2V A;  5FJ8 G;  1ILP A;  4AIM A;  4CKB A;  1GVP A;  1FGU A;  1GUT A;  1HQM C;  3CCR A;  5LL6 X;  1FNU A;  5IP7 G;  1CKN A;  4RHR A;  4A3F H;  4RGN A;  4L5Q A;  4LF5 Q;  4A3G H;  3NWS A;  3A56 A;  1N34 Q;  1VQA A;  1WFQ A;  5IP9 G;  2CFM A;  1PZI D;  2L5T A;  5IGE A;  1W3S A;  2KEE A;  1XMQ L;  3A5Z B;  3BVZ A;  2NVQ B;  2E8G A;  1LTT D;  4YHH Q;  5EPJ A;  1F2M A;  5KRU A;  1UE1 A;  3CRL C;  4HSV A;  5M9O A;  2FEF A;  2BDO A;  2NZ1 D;  2QF7 A;  1QVF A;  1TWG H;  3DHQ A;  1TT2 A;  3I90 A;  2A19 A;  5C4H A;  5KYL A;  4RFB A;  2N78 A;  1WYD A;  1PRT C;  3I56 A;  1PTO F;  1B50 A;  4O1P A;  4K14 A;  5I6W A;  2ES2 A;  2R93 H;  3C1F A;  1PH2 A;  3TRZ A;  2RAD A;  4A93 H;  1YO7 A;  1X32 A;  1GM5 A;  2KHJ A;  1W2B A;  2I46 A;  1BR9 A;  4A3L G;  1RCV D;  1PYW D;  2NZH A;  5DLQ E;  1WCM H;  4KV6 A;  1B2T A;  3S1M H;  3URY A;  2ZJP A;  2I07 B;  1H9R A;  1IBL Q;  1BKB A;  1GHJ A;  2JA7 H;  3NSW A;  5CR3 A;  3BZD B;  3TP5 A;  5CC4 A;  1MIU A;  3IL8 A;  3R2T A;  1C8C A;  1DM0 B;  3OMG A;  3A55 A;  1VMP A;  1LUZ A;  5K36 G;  4BBS H;  3T1H L;  2F52 A;  3MXG A;  3J81 c;  1C48 A;  4O1O A;  5JJI A;  3S9W A;  2WAQ G;  3OSO A;  2NTT A;  1KDA A;  4YCV A;  1KAW A;  2DJF C;  2QZG A;  1QOH A;  1DD2 A;  1I6V C;  2SDF A;  1HA5 A;  2VXW A;  3IAS 1;  1DYQ A;  1CKN B;  3NEL A;  2AUJ D;  5HUR A;  1DOK A;  4DNR B;  3PCO B;  4ZRZ A;  3TZD A;  4JI5 L;  1KAA A;  2B2T A;  1KXL A;  5D3D A;  4DUY L;  1IKM A;  5CV6 A;  5HGT A;  4B3M L;  4DAV A;  1IBM L;  2BL8 A;  3MXP A;  3R93 A;  5DEH A;  3DXJ C;  3BYT B;  2WV6 D;  3QIA A;  3AEV A;  4A3E G;  2K6A A;  1GKH A;  4OAU C;  1GUS A;  1UUP A;  3HKS A;  4KTA A;  4OWX B;  2FUG 1;  2A2C A;  3AYH B;  4Y52 H;  4UP9 A;  2EJM A;  2GSC A;  3OW2 A;  5BN3 A;  4PMB A;  1RTN A;  4NV2 A;  1VQG A;  4AQY L;  1C4Q A;  4GN3 B;  1JE5 A;  1L0Y B;  2A1A A;  2WKC A;  3BZK A;  1ICF B;  3K81 C;  2KA7 A;  4IOA A;  1UEA B;  4DR6 L;  2PW7 A;  4HMI A;  2F0T A;  2HDL A;  1VQJ A;  5CYU A;  4LJZ C;  2JA6 G;  3HOX B;  4HR7 B;  1QNK A;  1E22 A;  1KIX A;  1FYC A;  1F2Y A;  4ZK9 B;  2B63 G;  1FVI A;  2L11 A;  4FF1 A;  5IOC A;  1SYD A;  2EYP A;  1NCV A;  3CCE A;  3RZD H;  4X64 L;  4X3U A;  5ELO A;  5M3M B;  2HHH Q;  1AE3 A;  4AYB B;  3S2D H;  4OO1 I;  1LAC A;  4IQZ A;  3G4S A;  4X3T A;  4A3D B;  3AJF A;  4BBR B;  2B39 A;  2B2Y A;  2HD3 A;  2MFI A;  4LUZ A;  2UUA Q;  2HIV A;  2D0P A;  2MJF B;  4BY1 G;  1MHW C;  5C5L A;  4CDF C;  3J80 c;  2HT1 A;  1TDP A;  3UI2 A;  2UXC L;  5JJZ A;  2F0E A;  1P16 A;  1E0B A;  4YWK A;  4I1T A;  3GP7 A;  1G2T A;  3S16 B;  5FLM G;  1EY8 A;  1TWA B;  3RN5 A;  3HOZ H;  4JI8 Q;  1F2L A;  1Y1W H;  5C3W A;  3WDN A;  1B3Q A;  2K03 A;  3C1E A;  1TWC B;  1HCZ A;  1WTO A;  2RVL A;  2ZXR A;  1ZYR C;  2F0W A;  2LXK A;  5E7N A;  3HKZ B;  5TSS A;  5M5Y H;  3Q8D A;  4X65 L;  1MI2 A;  1PRT F;  4O2D A;  1K0S A;  2UUB L;  1R9T B;  4DV4 L;  3CCJ A;  1B3A A;  1KNE A;  4RA8 A;  2I5H A;  3I91 A;  4A3I G;  4MNO A;  1LLR D;  2VQF L;  4GZY C;  1EZ8 A;  1OXX K;  3EN2 A;  1B70 B;  3PIP A;  4CKC A;  1C7Y A;  3J7A V;  1MD2 D;  1V1O A;  5K5P A;  1SSO A;  3TDQ A;  4DV6 Q;  4OX9 Q;  2DJG C;  1HZ9 A;  5ELC A;  4C3J G;  2BL7 A;  4DR2 L;  2J4X A;  3MEF A;  1IXR A;  1A3V A;  5HGI A;  3HFZ B;  3A74 A;  3GO5 A;  4O0A A;  5C0X G;  1PTO D;  3GV3 A;  2NB0 A;  4NMZ A;  2UXD L;  1VQD A;  1NY4 A;  5JAV A;  2M2L A;  4JI7 Q;  5EPL A;  1JCK B;  4AS3 A;  1EWI A;  5EQ0 A;  4QF4 A;  1JOR A;  1A63 A;  4LFC Q;  4N8F A;  4F8M A;  3RLN A;  1A2T A;  5C3X A;  2K50 A;  2NZO A;  3M7G A;  1U5K A;  1EOV A;  4JI6 L;  5IT9 c;  4ILW A;  2H1E A;  3GTM B;  5IE8 A;  3FKI H;  3CCU A;  2JB3 A;  2OTL A;  1XMO Q;  3K7U C;  3GTO B;  2C35 B;  2Y0S E;  3IKJ A;  4KHP L;  1ICW A;  1EYG A;  2YFB A;  3CQZ H;  3RLF A;  1B7Y B;  4KJN A;  3F8T A;  4UPA A;  2AHO B;  1YHA A;  2N49 A;  1AFP A;  3J80 E;  5IYD G;  1PV4 A;  2EOT A;  3E3X A;  1XPR A;  2P22 B;  2PI2 A;  4FVM A;  4KN7 C;  1EYA A;  3OTO L;  1YIJ A;  2XN9 C;  5IGC A;  3FHW A;  3SE0 A;  2WAQ B;  2IHF A;  2YTV A;  2EPB A;  2K14 A;  1ET9 A;  4GOP C;  1GHK A;  4DR1 L;  1XNQ L;  2JA5 H;  1L1O C;  1CZG A;  1EQQ A;  2ATW A;  1B1Z A;  3GTK H;  1BVS A;  3A0J A;  3M3Y H;  1YIT A;  4LFB L;  1CKM A;  2E76 C;  5C0X J;  5FO8 B;  2SNM A;  3I4M G;  2R7Z G;  3J81 i;  2N88 A;  5IYC G;  1UAP A;  4BY7 H;  3TP7 A;  3U4V A;  3VR4 A;  4LF6 L;  1NAP A;  1Z47 A;  4IPC A;  2HQE A;  4Z7G A;  1VQ5 A;  1EIH A;  5J22 A;  3P1H A;  2NN6 I;  4A76 A;  2MQH A;  1U4M A;  5C4J B;  1HNZ Q;  1DJR D;  2NYZ D;  3VYR A;  4YCW A;  2R92 G;  5D3I B;  4HJ5 A;  4J1M A;  4P71 A;  3UE1 A;  1B8A A;  1IBL L;  1I4X A;  2BA1 A;  4FNF A;  4QB4 A;  3I4L A;  1TS4 A;  2LKV A;  4GKK L;  4JOI C;  2F0P A;  2E2D C;  2BA0 A;  3X3M A;  1HFG A;  2K04 A;  1PH8 A;  2FU2 A;  4DN4 M;  2EIF A;  4FXG C;  4R4C A;  4X6A H;  2F0V A;  2QEX A;  3V05 A;  1A3U A;  3KBG A;  3SGI A;  2B2V A;  1JWS D;  1N9W A;  4GLA C;  5C3E G;  3F2B A;  2JA6 B;  1XTC D;  2RBM A;  4YCU A;  4BA1 I;  1JOK A;  3IRB A;  1SYE A;  1YNX A;  2SNS A;  1L0W A;  1CQV A;  1JE4 A;  2B63 B;  2WKD A;  4EX5 A;  3ZJY C;  2UXB L;  3PO2 G;  1RF2 D;  1WTR A;  2MUY A;  3BU2 A;  3W3A A;  1HR0 L;  1SYB A;  2KHS A;  2D62 A;  1SE4 A;  2N8N A;  3T1H Q;  4UDU C;  1DXM A;  1ZXT A;  2PO4 A;  1BNZ A;  1PFB A;  1YZ6 A;  3PO3 G;  4BY1 B;  2RDH A;  5T1G A;  1K83 B;  5ELE A;  4MTN A;  4N9T A;  2ZTD A;  2L12 A;  3PIO 3;  4XQN A;  1PRT D;  3GTQ B;  4DV7 L;  4CDE C;  3MXU A;  1VQN A;  2PCF B;  3W2D A;  1JIC A;  2K5V A;  3S2H H;  2CWP A;  1GJX A;  2IX3 A;  1K9M C;  1FJG L;  4DUY Q;  4B3M Q;  1IBM Q;  3J80 i;  1L2F A;  2AMC B;  1V43 A;  5BN4 A;  4DV3 L;  3Q23 A;  4PG3 A;  5C6A A;  1S3O A;  2SOB A;  2SEB D;  2YFA A;  2I5L X;  1VS0 A;  4V0B A;  4XDX A;  1GD7 A;  1D6E C;  3AQQ A;  4C3I H;  3TS0 A;  4NXN Q;  3S1N H;  1K73 C;  2B8G A;  1ET6 A;  1Z6H A;  3EJI A;  4A3I B;  4AQY Q;  3UIT A;  5FO9 B;  3A7A B;  5FLX c;  1ZEQ X;  1WTP A;  3MEH A;  1HZA A;  4DR6 Q;  1L0X B;  2K5D A;  5ELN A;  3FBV A;  2C9O A;  3D6W A;  5KNC A;  2MJ8 A;  3GTL B;  1V1Q A;  4C3J B;  1SMX A;  5EGT A;  4FXD A;  3LJ1 A;  3W5O A;  1GO3 E;  1YNN C;  4R8I A;  2CH4 A;  2DNE A;  2HIX A;  5HY6 A;  5H1S E;  1HPC A;  2B8F A;  4WRD A;  3WWV A;  3GQB A;  1VF5 C;  4I65 A;  4X64 Q;  4A3C G;  1TVX A;  4UAI A;  4LAA A;  2EXD A;  3L9A X;  2WAC A;  4DGZ A;  5C4Z A;  2RSN A;  4QUC A;  1F2Z A;  5COY A;  2EY2 A;  1Y8O B;  1E7Z A;  2Z4I A;  3HOX H;  1SN8 A;  2UXC Q;  3K59 A;  4EQO A;  1TY2 A;  1IW7 C;  1QIL A;  2EJF C;  1D5Z C;  4BXX G;  5FOB B;  1G6Z A;  4NPS A;  1ENA A;  1SJE D;  1LYL A;  2QGM A;  3M9B A;  3TBI B;  2JSO A;  5JJK A;  4A3M G;  3K6O A;  2YTY A;  4P75 A;  3U4Z A;  1V1P A;  1IBK L;  2ICI A;  3E0J A;  2EYF A;  2D9U A;  4L5T A;  4X65 Q;  4BS9 A;  2UUB Q;  3CRK C;  4FO2 A;  4IPD A;  4DV4 Q;  3IFT A;  4NDX A;  3P23 A;  3F1Z A;  1B4O A;  3VDY A;  1JJC B;  1TR5 A;  1E2W A;  4H0L C;  2RDF A;  5FO7 B;  3NTK A;  5HGQ A;  1YJN A;  1SNQ A;  1UEB A;  1TU2 B;  1KTK A;  2KJX A;  4DXF A;  3G71 A;  2VQF Q;  1A3T A;  2AQ2 B;  1M8A A;  1TS5 A;  4DXG A;  5I2Y A;  5C44 G;  1SBB B;  3MHB A;  1D7Q A;  1LTR D;  4LFA L;  2JBW A;  1IL2 A;  2Q8T A;  1EY9 A;  2Q2H A;  3TN2 A;  2PPB C;  1SE8 A;  4R9W A;  3ICE A;  4HMJ A;  1E24 A;  1K28 A;  4B08 A;  1JMC A;  5A2Q E;  1WD0 A;  2PMZ B;  4DR2 Q;  3OPO A;  3I4M B;  1R9T H;  2R7Z B;  5COR A;  4C2M B;  2F0S A;  1UE7 A;  4RMF A;  3VR6 A;  4GLX A;  5I9P A;  1QZH A;  3C2P A;  2RF4 A;  4QIW B;  2DY8 A;  4JI0 L;  3CXC A;  4FF2 A;  4L8J A;  5FJ8 H;  1EU3 A;  1CFM A;  2QGQ A;  2G5D A;  3NBI A;  5IP7 H;  4K6D A;  1R4P B;  3HOW G;  1XMO L;  2R92 B;  4NKL A;  1SJH D;  2MO1 A;  2IHE A;  4C1N K;  1Q86 C;  1LT6 D;  5KNB A;  3CMA A;  5C5M A;  1LTG D;  3A8I E;  4JCV E;  3N6R A;  4ME3 A;  4PQX A;  2FHT A;  1QG7 A;  3OYY A;  4GNX A;  5IP9 H;  4MZ9 A;  3KLS A;  3MFY A;  1P8L A;  4OEL B;  4ZKC B;  2A68 C;  5JEA H;  4YY3 L;  2E2J B;  3NTI A;  1HH2 P;  2QKI C;  4P72 A;  4XIG S;  2JK8 A;  1S5E D;  4KHP Q;  3SDJ A;  5C3E B;  2KBN A;  3NBH A;  4A3B G;  2B2Y C;  5I9O A;  1JT8 A;  3I4O A;  3STB C;  1V1P B;  1BDO A;  4EQN A;  1PHJ A;  3PO2 B;  3KJP A;  1JQY D;  4Q9V A;  4ZUI A;  1O80 A;  2QEJ C;  3CD6 A;  2IW3 A;  2XWJ B;  1O78 A;  3OTO Q;  3R3O A;  3NUC A;  4HJ7 A;  4ABN A;  3GTM H;  3E5S A;  4WJ4 A;  2Z1C A;  2NVT B;  1QWY A;  4DR1 Q;  3B55 A;  1XNQ Q;  3PO3 B;  3SK6 A;  3GTO H;  4KKS A;  4ZCK A;  2A6E C;  1JWM D;  1MKH A;  2YTX A;  1I50 B;  1RD9 D;  2B2W C;  3H6M A;  3NEN A;  1HNZ L;  4LFB Q;  1YHQ A;  4K6L A;  2XVS A;  2VS1 A;  1SNO A;  4P74 A;  3UDF A;  3K57 A;  4LF6 Q;  2LXJ A;  3HG9 A;  3NHH A;  1B53 A;  1MBY A;  2RHQ B;  1ZKO A;  2FMC A;  2X69 A;  4JBK A;  2BCO A;  2HCC A;  4P73 A;  3BVM A;  1KHI A;  5LMN W;  1EY7 A;  3FPP A;  3S14 B;  2NVX B;  5LHY 1;  3QR8 A;  1M1K C;  1I3Q B;  3I4N H;  1D1I A;  2OWO A;  2LFN A;  3KFU A;  4DUZ L;  3H3V C;  1LT4 D;  4B3R L;  5DNF A;  3OIP A;  1JJ2 A;  5J3B A;  4HJA A;  1RJT A;  3HRZ C;  5CV5 A;  1YJW A;  1RTO A;  4L6T B;  4A3G G;  1EIG A;  1XPO A;  3H3V H;  2ZTE A;  4GKK Q;  3CP0 A;  5IOD A;  1WTQ A;  3CC7 A;  1SYF A;  4JYA Q;  1NR2 A;  4HJ8 A;  4GNX B;  1Q1E A;  4DKA C;  3PV0 A;  1LO5 D;  4Z9C B;  2DNC A;  2ZM6 L;  1VQM A;  4TVA B;  5C4J H;  3J7A 5;  2PNH A;  1BOS A;  2Z4H A;  3HZX A;  2UXB Q;  1AZP A;  1D1K A;  3NBH B;  3OWE B;  2VUM H;  1EQT A;  1KL9 A;  1QZG A;  4OO1 G;  1K0R A;  2K1B A;  1RKN A;  3DLL A;  1XNR L;  1HR0 Q;  4A3K G;  4KKT A;  4AYB E;  4L5S A;  1OTC A;  4ALP A;  1O7L A;  5EKL A;  3SK4 A;  3HGB A;  1V9P A;  3J81 L;  2YU9 H;  1C0A A;  3N52 A;  2DY7 A;  1PMR A;  4C1N I;  3PF5 A;  3BDL A;  4G4K A;  2JB1 A;  3DM3 A;  1PZK D;  4KD4 A;  4R4O A;  1Y1V G;  4GLV B;  2QW7 A;  1ASZ A;  1PFS A;  2K52 A;  1N33 L;  4I7A A;  3K80 C;  5IYB H;  5AJ3 L;  2CW0 C;  2J0T D;  1Y14 B;  5E4W C;  4K8I A;  2OTJ A;  3E9H A;  2ZRR A;  4DV7 Q;  2JA7 G;  2F03 A;  2QCP X;  1SFO B;  2ASB A;  4NXN L;  3S17 B;  1JB3 A;  5E3F A;  1I4Q A;  3W1B A;  3FVQ A;  1FJG Q;  3IFD A;  3TSS A;  4A3M B;  1UNS A;  2E2H H;  3VR3 A;  2VQE L;  4FF3 A;  3S1R B;  2FMM A;  4DV3 Q;  1I4R A;  2YYZ A;  1XXG A;  2ETD A;  4RH6 A;  1T9H A;  1PZJ D;  4UP7 A;  2WB1 G;  1X56 A;  3GTQ H;  1K3R A;  2JYO A;  3AU7 A;  2CH4 W;  3U9S A;  3H94 A;  5C44 B;  5EPK A;  3K5O A;  3BS1 A;  4JV5 L;  5CV7 A;  1PTO B;  1A0I A;  1CM9 A;  1VQ4 A;  5FKA C;  1MJC A;  3LJ0 A;  3VA7 A;  4QCL A;  1CHP D;  1TWF B;  4XT3 B;  4TRD A;  5G3L F;  3F2C A;  1LTL A;  3FVV A;  1ESR A;  4A3J G;  2E5L L;  1VQP A;  1YI2 A;  3KLW A;  1YEZ A;  3AMU A;  1QUQ A;  4DK0 A;  1I6H B;  4JVZ A;  3GTG B;  5J1Z A;  1BQQ T;  2Z6B A;  1RHP A;  3ERQ A;  5IGB A;  2IL8 A;  3CME A;  2H4O A;  4K5X A;  4DAM A;  4IO9 A;  4QQB X;  2L1B A;  1X3Q A;  3HOW B;  4H44 C;  1YBY A;  1QCB D;  4R4Q A;  1TS2 A;  1KD1 C;  3BJU A;  4L5R C;  1EY6 A;  5E4X A;  3J80 L;  1TKW B;  4IJL A;  3PUX A;  4LUV A;  2E2I H;  3GTL H;  2BOS A;  4FXK C;  1WTV A;  1IKL A;  3DA3 A;  3J81 E;  3CHB D;  1CQF A;  1VF7 A;  1FGB D;  1J9O A;  3BVG A;  4K0K L;  1EL0 A;  4IPH A;  2DN8 A;  1K3B C;  4RWS C;  4PMW A;  3VYU A;  4QY7 A;  3BYY B;  1LAB A;  1A62 A;  1JR0 D;  2Z0S A;  1CUK A;  4ZUJ A;  1Q3L A;  3T4A C;  1IBK Q;  4A3B B;  1BBU A;  3D3R A;  2O5I C;  3ULP A;  1W6J A;  2F0I A;  4U68 A;  1YNN D;  1K8A C;  1BXT A;  2KVM A;  3NQI A;  3EQL C;  2L0C A;  1RIP A;  3VYT A;  3BZC A;  3KF8 A;  3ZYY X;  2F4V Q;  5KYI A;  1SNC A;  1Y1W G;  2PZT A;  4LFA Q;  1VQO A;  1X54 A;  1HJP A;  3IAY A;  4LUO A;  2B2U C;  2WIN B;  2QDB A;  3VYS A;  2O4X A;  4LF8 L;  3QB3 A;  3KF6 A;  4PL5 A;  2M00 A;  4AH6 A;  5M5W H;  1IW7 D;  2NN6 G;  1DON A;  1E3P A;  4P2C B;  3GTP B;  1CA5 A;  2RLD A;  3RLO A;  1SLJ A;  4JI0 Q;  4K5V A;  1TWH B;  4MHE A;  5M5X B;  1MGS A;  2JA9 A;  1OXV A;  1QUQ B;  3CPF A;  4Z7H A;  4IFD H;  3KP9 A;  1G6P A;  4J8Q A;  4QUF A;  1A6X A;  5EBC A;  4HCS A;  1CSQ A;  4IUQ A;  3TEH B;  1GXD C;  2F0Q A;  4ZKB B;  1KC8 C;  1M90 C;  1PVO A;  1PH1 A;  5EBD A;  3U9O A;  4A3G B;  2L15 A;  1XTD A;  1BCP C;  1EY0 A;  2VY3 A;  3UDI A;  3GDE A;  4ZAI A;  2CVR A;  4XQQ A;  4KHV A;  2DUD A;  3J7A F;  3OWF A;  4C2M H;  4C3H H;  1OXU A;  3I9V 1;  2OCE A;  3FPU B;  3PGZ A;  4LW1 A;  4YY3 Q;  1PFM A;  1A2U A;  4TSS A;  1VDZ A;  1BBW A;  2EYH A;  1K8M A;  1SYC A;  3DEP A;  4K2K A;  4IUV A;  4LF7 L;  4RGT A;  5I6Y A;  3KDF A;  5JPN C;  1X9N A;  2OQ0 A;  2PQA A;  3K8A A;  4ZYS A;  4HFV A;  2XRQ D;  1VQ8 A;  1TWG B;  4RGO S;  5CGK A;  2JEB I;  4G7Z C;  3WOF A;  2F0H A;  4A3K B;  4EGV A;  1X55 A;  4KN4 C;  2UUC L;  3F4M A;  2PI2 E;  1EYC A;  1VQK A;  3G6J B;  1F9R A;  5BR8 L;  2RQX A;  1PRT B;  2E2J H;  1Y1V B;  3TP6 A;  2MO0 A;  3FKI G;  4OEM B;  3KF8 B;  5C3E H;  2XTQ A;  4KI0 A;  2KCC A;  4B3S L;  2KKM A;  4A3E B;  2I0Q A;  3HOU G;  1LT3 D;  1U4L A;  3PO2 H;  2JA7 B;  5M3F G;  4RKL A;  4X3K A;  2KCN A;  3KF6 B;  2A68 D;  3K7A B;  1IL8 A;  1FD7 D;  2PW5 A;  2ZXO A;  4HIO A;  2JP1 A;  4DNI A;  2NVT H;  3PUY A;  3CC2 A;  4JYA L;  4DAY A;  1M4V A;  1Q1B A;  2NVQ H;  4DUZ Q;  3D4R A;  2UU9 Q;  2QA4 A;  1S5F D;  4B3R Q;  5D14 A;  3STB D;  4NV5 A;  2RIO A;  1SYG A;  3DMU A;  3T56 B;  2A73 B;  4CJ1 B;  5C4X G;  1I50 H;  2EJG C;  2WB1 B;  5G3L D;  4O42 A;  4UP8 A;  4KY7 A;  3SDZ A;  2HGK A;  1JOO A;  4XYO A;  3V2T A;  4JI4 L;  5CV8 A;  4PZ6 A;  4BY7 G;  3I73 A;  3K0X A;  5A35 A;  1AEX A;  4XT1 B;  1EZ6 A;  4JPB W;  3RMH A;  1QVG A;  2X6G A;  4DV5 Q;  3S14 H;  2ZM6 Q;  2NVX H;  4KD3 A;  5IT9 E;  4CJ2 C;  2NWG A;  2A6E D;  4DU9 A;  2VL6 A;  1EUJ A;  4A3J B;  1J5E L;  3KDF B;  1WJJ A;  3GTJ B;  4LF9 L;  2EXZ A;  2PQA B;  1XNR Q;  4EQ5 A;  3A8K E;  1JWU D;  2KED A;  2KOL A;  4LWC A;  4DR7 Q;  1Q82 C;  2IJ0 A;  1PH9 A;  1NMF A;  1SAP A;  3G6E A;  4IPG A;  4JI2 L;  4G57 A;  2F0O A;  3VA9 A;  1LM0 A;  3L0O A;  4OWW B;  1BF4 A;  1CK1 A;  1YVC A;  2VB2 X;  1ENF A;  3W1G A;  1STB A;  3DA4 A;  1N33 Q;  2L4N A;  4QMG A;  1LTS D;  5ELB A;  1ILQ A;  4NP5 A;  2EY1 A;  5AJ3 Q;  1TY0 A;  4GXT A;  3M7N A;  2JB2 A;  2K01 A;  2OXP A;  1VMC A;  2CQO A;  3D6C A;  1LTI D;  1STH A;  1JOQ A;  1DOM A;  3U58 A;  4A3C H;  2ZTC A;  5A2Q L;  1SNM A;  4IUT A;  4Q5V A;  4JBW A;  2VQE Q;  2BE5 C;  1ML0 D;  2M9V A;  4CDC C;  1YJ9 A;  3H0G G;  4IUR A;  1HRJ A;  4KHZ A;  4DAY B;  3FNB A;  1BCP F;  1Y8N B;  2PZW A;  4M1U B;  3OW7 A;  1LT5 D;  1SNP A;  3Q0A A;  2JN4 A;  4YZC A;  4I7Z C;  4BXX H;  3RD4 A;  2RKS A;  2Z6K A;  4RKB A;  1C9O A;  4KMU C;  1IYJ B;  4M8A A;  2Z9H A;  1SFO H;  2A2D A;  5IWA L;  4KKU A;  4DK3 C;  2K75 A;  4A75 A;  4DA2 A;  4A3M H;  1S40 A;  4JV5 Q;  5KIX A;  2RCF A;  3LWU A;  3JAM c;  3TP8 A;  1II3 A;  3KBX A;  1D5X C;  5M5Y B;  4K8J A;  1N36 L;  3A7L A;  2E5L Q;  2CW0 D;  4QIW E;  2O2L D;  3LGJ A;  5NUC A;  2EDG A;  4C3I G;  3DUZ A;  4APV A;  4DV0 Q;  4JI1 L;  2JAE A;  3HOY G;  5LMU L;  2F0K A;  4RCN A;  4NB3 A;  1ESF A;  1NE3 A;  4HED A;  3EIV A;  3QOJ A;  1WTW A;  1E1O A;  1PH5 A;  5M3M H;  4GOP A;  4JC0 A;  4OWT B;  3CC4 A;  3JC6 6;  4LF4 L;  4HIK A;  4KLK A;  4BWG B;  1L1O A;  1TWF H;  4LNQ A;  3H15 A;  4A3D H;  3I7F A;  4BBR H;  1FNV A;  1K8O A;  2XRS D;  4K0K Q;  3ITP A;  1AP0 A;  1I6H H;  3OIQ A;  2KCT A;  3L7Z C;  1O7Z A;  3NEM A;  4H13 C;  3S16 H;  1TWA H;  4FDB A;  1WVL A;  2B2T C;  2F4V L;  3IAM 1;  1EY4 A;  3A5U A;  3HOW H;  4DV2 Q;  1TWC H;  4CHT B;  2KUM A;  5EAY A;  2KCM A;  3NXW A;  1CTM A;  1AZQ A;  3HOX G;  1BBX C;  1VQ6 A;  2V6E A;  1GUG A;  4OON A;  1JB7 A;  1TII D;  2JXM B;  3MXN A;  1HUN A;  2AWN A;  3A54 A;  5E1F A;  3M4P A;  2OQK A;  4ME5 A;  1Q8I A;  3E6Z X;  4N9P A;  3FKI B;  3D31 A;  3JSB A;  2F3W A;  3M85 A;  1EEI D;  2EVB A;  3MZ5 A;  1EYD A;  3P7J A;  4POG A;  1IYV A;  2QSB A;  4A3B H;  3MA2 B;  5FLX E;  3HOU B;  2WII B;  2XTI A;  4LF8 Q;  5DM6 3;  3TZU A;  5M3F B;  1U4P A;  1YNJ C;  3QO2 A;  4IN3 A;  3SR1 A;  4WJ3 M;  5IIF A;  3NTH A;  4XTC S;  2K5Q A;  2K4K A;  3D0F A;  3HOV G;  1NR4 A;  3GD7 A;  3NWT A;  5GAH C;  1GUW A;  2F0M A;  1ASY A;  4B3T L;  2WFW A;  2F4I A;  4U6R A;  2FJ2 A;  2KHI A;  4QL5 A;  1PLF A;  3CW2 C;  3UDG A;  5I4D A;  1UWV A;  2XWB B;  3ONA B;  4DWL A;  1S5B D;  5C4X B;  5EKI A;  3F2D A;  2XSC A;  1VQL A;  1RL2 A;  1K8G A;  5CMD A;  4GOP B;  3M3Y B;  3VA5 A;  4GKJ L;  1HQR D;  1L1O B;  3L2P A;  2ICE C;  3GTP H;  2PNR C;  2X6L A;  3AFQ A;  4BY7 B;  2F6M B;  3MWY W;  1TWH H;  3I3C A;  4G7O C;  5KGU A;  1N32 L;  4LF7 Q;  2ZXP A;  2D2C C;  1WTX A;  2F0L A;  4A3L H;  5KEE A;  3G48 A;  1PA6 A;  4YWM A;  4V19 0;  4C56 C;  5EJW A;  2Q8I B;  1G51 A;  2HUG A;  4EQP A;  3HS0 C;  2UUC Q;  1A15 A;  1BUV T;  3CKI B;  1KDB A;  3EVQ A;  4HEA 1;  5BR8 Q;  4Y7N B;  2R61 A;  1PFN A;  2F1M A;  3PIP 3;  4H02 A;  5K36 H;  4J6H A;  1WI5 A;  4JK1 C;  4OXP A;  3MXN B;  5JEA G;  2A6H C;  2JA8 G;  1TQO A;  4B3S Q;  2R3Z A;  4HJ9 A;  1VQ7 A;  1SMY C;  2D0O A;  3K0Y A;  3LX0 A;  2UU9 L;  1X3F A;  4OO1 H;  1CHQ D;  1BCP D;  1VQF A;  3E9I A;  4X66 L;  4A3K H;  4IUP A;  4A3F G;  1IZ6 A;  3G7L A;  1Q81 C;  4JBJ A;  4XQJ A;  4B9X A;  3P75 A;  3S24 A;  2GVA A;  2F66 B;  4DR5 Q;  1Y1V H;  3H0G B;  1BO0 A;  1HNW Q;  3LJ2 A;  5BN5 A;  2FFK B;  3PUV A;  4KY5 A;  2E74 C;  1QVC A;  3MAQ A;  3S15 B;  4DV5 L;  4A3E H;  2FXQ A;  1O7Y A;  4N8X 1;  1QE6 A;  1TS3 A;  2MHV A;  1J6Q A;  5GAG C;  3CCS A;  1U0L A;  3PQI A;  3CAM A;  2RDG A;  2E75 C;  4CDD C;  2EY6 A;  1PH3 A;  4LMQ D;  2A8V A;  4R4T A;  4JI4 Q;  1HFN A;  3DO9 A;  3S2H B;  1PH4 A;  5CBA E;  3AFP A;  4DR7 L;  1XWE A;  2OEO A;  3X3N A;  2XMX A;  3K7A H;  1KQS A;  4DK6 C;  5JVH 3;  2R93 G;  3RUZ A;  1KLG D;  3OHX C;  2NVY B;  3Q24 A;  1NSN S;  2MNA A;  4A93 G;  3RNU A;  4PMC A;  1J5E Q;  2N55 A;  2JA6 H;  3I4N G;  3RN2 A;  3EA6 A;  4LF9 Q;  2EYL A;  3B6Y A;  3T16 A;  1E1T A;  3KLR A;  1WCM G;  4OIK A;  1AN8 A;  4C3I B;  3S1N B;  4JI3 L;  2ENB A;  2B63 H;  1SE2 A;  4ZQ3 A; 
#chains in the Genus database with same CATH homology
 5JJL A;  1VCI A;  4DV7 L;  4JI2 Q;  1VQN A;  1X3G A;  1VQ9 A;  2K5V A;  3RLO A;  1SLJ A;  3S2H H;  4JI0 Q;  2CWP A;  3JAM i;  4NXM Q;  5JEA J;  2UXD Q;  1WOC A;  2JA9 A;  1OXV A;  2V1C C;  1FL0 A;  1QUQ B;  2ID0 A;  4Z7H A;  3CPF A;  3HKZ E;  4X62 Q;  4DUY Q;  2VZA A;  3CF5 A;  1K9M C;  3KP9 A;  4B3M Q;  4BBS G;  1G6P A;  5LMN Q;  1IBM Q;  3J80 i;  1I5F A;  1L2F A;  2AMC B;  1V43 A;  1CSQ A;  3TQY A;  3TEH B;  5GRO A;  4DV3 L;  1Q46 A;  4IOC A;  1M90 C;  1PVO A;  1KC8 C;  4PG3 A;  1PH1 A;  4BY1 H;  4A3J H;  1S3O A;  2L1L B;  3T1Y L;  1K83 H;  1JJG A;  2YFA A;  2I5L X;  2L15 A;  1VS0 A;  3HKZ G;  1XTD A;  3GTJ H;  2VY3 A;  3UDI A;  1GD7 A;  3AQQ A;  3GDE A;  4C3I H;  3TS0 A;  1PH6 A;  4NXN Q;  1K73 C;  2VUM G;  4JI6 Q;  3S1N H;  4BA2 I;  2DUD A;  5FLM H;  4C2M H;  4C3H H;  1OXU A;  3I9V 1;  2OCE A;  2Y0S G;  3PGZ A;  4LW1 A;  4YY3 Q;  4AQY Q;  3UIT A;  5FLX c;  1OXT A;  1YHB A;  1XJV A;  2JA8 H;  1BBW A;  5M5X H;  3PIO A;  3RZO H;  3CCL A;  5FJ8 G;  4DR3 Q;  1HZA A;  4AIM A;  4LF7 L;  4DR6 Q;  3KDF A;  1X9N A;  1GVP A;  1FGU A;  2OQ0 A;  2PQA A;  3FBV A;  3K8A A;  5ELN A;  4DR4 Q;  4HFV A;  3CCR A;  5IP7 G;  1V1Q A;  1VQ8 A;  1SMX A;  5IYB G;  1CKN A;  2IX1 A;  3LJ1 A;  2JEB I;  4A3F H;  4L5Q A;  4LF5 Q;  2AWO A;  3W5O A;  4A3G H;  1GO3 E;  2IY5 B;  2R7D A;  1X55 A;  1VQC A;  2HIX A;  1VQA A;  4R4I A;  1WFQ A;  5IWA Q;  3F4M A;  1N34 Q;  1HR0 W;  2UUC L;  2PI2 E;  5HY6 A;  1VQK A;  1H95 A;  5IP9 G;  5H1S E;  5BR8 L;  3WWV A;  2CFM A;  4DV0 L;  4A3I H;  4X64 Q;  4A3C G;  2E2J H;  2MO0 A;  3EBE A;  3FKI G;  2EXD A;  1W3S A;  1XMQ L;  3A5Z B;  3KF8 B;  5C3E H;  2E8G A;  2XTQ A;  4YHH Q;  3CCV A;  4KI0 A;  4B3S L;  2KKM A;  2K5H A;  1UE1 A;  1S72 A;  1D8L A;  1N36 Q;  1X65 A;  2I0Q A;  1E7Z A;  3H3V I;  3HOX H;  3HOU G;  1SN8 A;  4C3J H;  2UXC Q;  1QVF A;  1TWG H;  3PO2 H;  5M3F G;  2A19 A;  4PL4 A;  4JI1 Q;  2N78 A;  1WYD A;  4BXX G;  3I56 A;  4DV1 L;  1Q12 A;  4O1P A;  3KF6 B;  4NPS A;  5LMU Q;  1LYL A;  2ES2 A;  2R93 H;  1TXY A;  1PH2 A;  3TRZ A;  4HIO A;  4DNI A;  3M9B A;  1DGS A;  2NVT H;  3PUY A;  5JJK A;  4A3M G;  3CC2 A;  2YTY A;  3ULJ A;  4JYA L;  4A93 H;  1YO7 A;  4P75 A;  2KHJ A;  3U4Z A;  1Q1B A;  1W2B A;  1GM5 A;  4LF4 Q;  2NVQ H;  4A3L G;  1IBK L;  4DUZ Q;  2UU9 Q;  2QA4 A;  2JJQ A;  1EIY B;  2NZH A;  4DV2 L;  4B3R Q;  5DLQ E;  1WCM H;  3STB D;  4NV5 A;  2RIO A;  5C4X G;  4L5T A;  4X65 Q;  3S1M H;  2ZJP A;  2UUB Q;  1I50 H;  1IBL Q;  1BKB A;  4IPD A;  4DV4 Q;  2ALY B;  2ZJQ A;  2JQO A;  2JA7 H;  3P23 A;  3F1Z A;  4UP8 A;  3VDY A;  1JJC B;  2IT1 A;  1MIU A;  3CCM A;  2WAQ E;  5HGQ A;  2Q2I A;  1YJN A;  1CKO A;  1UEB A;  4JI4 L;  3G71 A;  2VQF Q;  4PZ6 A;  1LUZ A;  1Q8K A;  4BY7 G;  5K36 G;  1HNX Q;  2Q2T A;  3K0X A;  3T1H L;  4UY8 C;  3HOZ G;  4BBS H;  2F52 A;  5C44 G;  2ZJR A;  3J81 c;  1QVG A;  1D7Q A;  4DV5 Q;  4LFA L;  2WP8 J;  3S14 H;  4O1O A;  2ZM6 Q;  2NVX H;  1IL2 A;  2Q2H A;  5JJI A;  2WAQ G;  1SE8 A;  3ICE A;  1E24 A;  1JMC A;  4YCV A;  1KAW A;  2CWA A;  2VL6 A;  1I94 Q;  1EUJ A;  2CCZ A;  1J5E L;  3KDF B;  1WJJ A;  4DR2 Q;  1OXS C;  2GVB A;  4LF9 L;  2PQA B;  1XNR Q;  4EQ5 A;  2IP6 A;  2H5X A;  4GN5 A;  3IAS 1;  1R9T H;  4LWC A;  3ULL A;  4DR7 Q;  1CKN B;  3NEL A;  1Q82 C;  3M4Q A;  1UE7 A;  1PH9 A;  4RMF A;  4GLX A;  1NMF A;  5IYD H;  3RR5 A;  3G6E A;  1QZH A;  4IPG A;  4JI2 L;  2RF4 A;  3PCO B;  1KRT A;  4OWW B;  3VA9 A;  1LM0 A;  3L0O A;  3TRE A;  3CXC A;  5FJ8 H;  4JI5 L;  4JI0 L;  4NXM L;  4OAV B;  1YVC A;  1KXL A;  2QGQ A;  3W1G A;  4X62 L;  4DUY L;  3DA4 A;  4B3M L;  1SJ8 A;  1N33 Q;  5LMN L;  5IP7 H;  1IBM L;  3HOW G;  1XMO L;  2MO1 A;  2IHE A;  5AJ3 Q;  1Q86 C;  4GXT A;  3CMA A;  2JB2 A;  4A3E G;  3AEV A;  3M7N A;  1GKH A;  4OAU C;  4JCV E;  3HKS A;  2CQO A;  4OWX B;  4ME3 A;  2FUG 1;  2Z6K C;  2XTR A;  2A2C A;  3AYH B;  3OYY A;  3I4M H;  4Y52 H;  2R7Z H;  4B3T Q;  4UP9 A;  4GNX A;  5IP9 H;  5IYC H;  3OW2 A;  4MZ9 A;  3U58 A;  4A3C H;  1P8L A;  2ZTC A;  4A4I A;  4NV2 A;  1VQG A;  2LSS A;  4YY3 L;  4AQY L;  4GN3 B;  4JBW A;  1JE5 A;  2A1A A;  2XGT A;  3BZK A;  2VQE Q;  2HQL A;  2WB1 E;  4P72 A;  1HH2 P;  4XIG S;  3K81 C;  2JK8 A;  3KJO A;  4KHP Q;  3SDJ A;  1YJ9 A;  4AS2 A;  3H0G G;  4KHZ A;  4IOA A;  4DR6 L;  2KBN A;  4A3B G;  3HOU H;  3E0E A;  4POF A;  2R92 H;  1VQJ A;  4DAY B;  1JT8 A;  3I4O A;  2JA6 G;  4GKJ Q;  3STB C;  5M3F H;  1PHJ A;  3KJP A;  4YZC A;  1VQI A;  4BXX H;  4Q9V A;  4GN4 B;  1E22 A;  4HID A;  4LF5 L;  2EQS A;  2Z6K A;  1C9O A;  1KIX A;  1IYJ B;  2B63 G;  1FVI A;  3CD6 A;  1SFO H;  2A2D A;  1N34 L;  5IWA L;  3I55 A;  1N32 Q;  4DK3 C;  2K75 A;  3OTO Q;  1AE2 A;  4A75 A;  3UE0 A;  4HJ7 A;  3GTM H;  3CCE A;  4A3M H;  1S40 A;  4JV5 Q;  4WJ4 A;  3RZD H;  4RG1 A;  4X64 L;  5ELO A;  4TQU S;  4IFD G;  2RHS B;  4DR1 Q;  2HHH Q;  1XNQ Q;  1AE3 A;  3JAM c;  1HZC A;  1NBW A;  3GTO H;  3S2D H;  2B3G A;  4OO1 I;  3G4S A;  5C4X H;  2JE6 I;  4YHH L;  3AJF A;  2MFI A;  4LUZ A;  1N36 L;  2CKZ B;  5C0X I;  2UUA Q;  1MKH A;  2HIV A;  2YTX A;  2D0P A;  2MJF B;  4QIW E;  4BY1 G;  2E5L Q;  3J80 c;  4LFB Q;  3NEN A;  1HNZ L;  1YHQ A;  3LGJ A;  2HT1 A;  2UXC L;  1P16 A;  3CCQ A;  2VS1 A;  1CSP A;  3UDF A;  4P74 A;  4YWK A;  4APV A;  4DV0 Q;  4JI1 L;  1MJE A;  4I1T A;  2JAE A;  4GS3 A;  5FLM G;  3RN5 A;  4LF6 Q;  3HOY G;  2LXJ A;  3HOZ H;  4JI8 Q;  5LMU L;  1Y1W H;  4NB3 A;  1XMQ Q;  2RHQ B;  1NE3 A;  3FP9 A;  3EIV A;  4JBK A;  5LMN W;  4P73 A;  1E1O A;  1KHI A;  4DR5 L;  1PH5 A;  5M3M H;  3KFU A;  4GOP A;  4JC0 A;  4OWT B;  2IX0 A;  3PO3 H;  1M1K C;  3CC4 A;  3JC6 6;  4LF4 L;  4HIK A;  1HNW L;  3I4N H;  4KLK A;  1AH9 A;  2OWO A;  1L1O A;  1TWF H;  2LXK A;  5E7N A;  3H15 A;  4DUZ L;  3I7F A;  4LNQ A;  4BBR H;  5M5Y H;  4A3D H;  1JJ2 A;  4B3R L;  5J3B A;  3Q8D A;  4HJA A;  2JA5 G;  4X66 Q;  3PF4 A;  1YJW A;  4X65 L;  4O2D A;  2UUB L;  4A3G G;  4K0K Q;  1XPO A;  4DV4 L;  3H3V H;  2ZTE A;  1XPU A;  3CCJ A;  4GKK Q;  1I6H H;  3J81 j;  2KCT A;  3CP0 A;  4Y7N H;  1X3E A;  3L7Z C;  3NEM A;  3CC7 A;  3S16 H;  2I5H A;  1TWA H;  4YWL A;  4FDB A;  4JYA Q;  4A3I G;  4HJ8 A;  4MNO A;  3ER0 A;  4GNX B;  2VQF L;  2BH8 A;  1Q1E A;  2YV5 A;  3IAM 1;  2F4V L;  1OXX K;  3EN2 A;  3A5U A;  4DV2 Q;  1B70 B;  1TWC H;  3PV0 A;  1G29 1;  2N3S A;  4PZ8 A;  4DKA C;  3PIP A;  1C7Y A;  4J15 A;  5EAY A;  2ZM6 L;  1VQM A;  2KCM A;  1I3Q H;  4TVA B;  5C4J H;  4JG2 A;  3J7A 5;  2PNH A;  4DV6 Q;  4OX9 Q;  2UXB Q;  3HOX G;  1VQ6 A;  1HZ9 A;  3NBH B;  2V6E A;  2VUM H;  1QZG A;  1KL9 A;  4OON A;  4DR2 L;  3MEF A;  1K0R A;  2BH2 A;  4OO1 G;  1IXR A;  3DLL A;  4QGU A;  1JB7 A;  1XNR L;  5HGI A;  3HFZ B;  3A74 A;  3GO5 A;  4O0A A;  4GNX C;  2AWN A;  4A3K G;  2R7F A;  5C0X G;  3M4P A;  4AYB E;  2OQK A;  4L5S A;  1OTC A;  4ALP A;  4IFD I;  1EFW A;  1V9P A;  1VQE A;  2YU9 H;  3D31 A;  1HZB A;  1C0A A;  3JSB A;  2UXD L;  1VQD A;  1NY4 A;  3M85 A;  3H0G H;  3PF5 A;  2JB1 A;  3DM3 A;  4POG A;  4IFD J;  4R4O A;  3CPW A;  1Y1V G;  4JI7 Q;  4GLV B;  4A3B H;  1ASZ A;  4PL3 A;  1PFS A;  4AS3 A;  4PZ7 A;  2K52 A;  1FJG L;  1EWI A;  1N33 L;  3S15 H;  3K80 C;  4LF8 Q;  1VQB A;  1KRS A;  2XTI A;  5IYB H;  1A63 A;  1Q7Y C;  5AJ3 L;  4JI3 Q;  4LFC Q;  4WJ3 M;  2OTJ A;  1Y14 B;  3RLN A;  3E9H A;  1X6O A;  4XTC S;  2ZRR A;  4DV7 Q;  2K4K A;  3D0F A;  2K50 A;  2NZO A;  3GD7 A;  2JA7 G;  1U5K A;  5GAH C;  1Z9F A;  3HOW H;  3HOV G;  4IJH A;  1ASY A;  2ASB A;  4NXN L;  1EOV A;  3UDX A;  4B3T L;  2WFW A;  4JI5 Q;  5IT9 c;  4U6R A;  1N8R C;  4JI6 L;  3W1B A;  1EIF A;  1FJG Q;  2KHI A;  4QL5 A;  3CW2 C;  3UDG A;  5IE8 A;  1EQR A;  3FKI H;  3CCU A;  2E2H H;  1UWV A;  2DGY A;  4HIM A;  2VQE L;  2JB3 A;  1O7I A;  5GQO A;  1XMO Q;  3K7U C;  2OTL A;  2NVY H;  4DV3 Q;  4DWL A;  2YYZ A;  2C35 B;  2Y0S E;  4KHP L;  5LNK 1;  3J7Z C;  4DR3 L;  1EYG A;  2YFB A;  1PH7 A;  3CQZ H;  3F2D A;  1PYB A;  3T1Y Q;  1VQL A;  1RL2 A;  1K8G A;  1T9H A;  3RLF A;  4GOP B;  4DR4 L;  3PUZ A;  1B7Y B;  4UP7 A;  4GKJ L;  1L1O B;  3F8T A;  4UPA A;  2WB1 G;  2AHO B;  1X56 A;  3L2P A;  1YHA A;  3GTP H;  3GTQ H;  3HOY H;  2N49 A;  2K19 A;  1K3R A;  2KEN A;  3PSI A;  3AFQ A;  3S17 H;  2F6M B;  5IYD G;  1PV4 A;  1TWH H;  4QJF A;  1XPR A;  2P22 B;  2PI2 A;  1N32 L;  3OTO L;  1YIJ A;  4LF7 Q;  2PMZ E;  3FHW A;  4DPG A;  4JV5 L;  4G76 A;  1A0I A;  2IHF A;  2YTV A;  4A3L H;  1VQ4 A;  2K14 A;  1MJC A;  3LJ0 A;  3G48 A;  4GOP C;  3S1R H;  1PA6 A;  2RCN A;  4DR1 L;  2HHH L;  1XNQ L;  2JA5 H;  1L1O C;  4YWM A;  1EQQ A;  2ATW A;  3GTK H;  1BVS A;  3F2C A;  1LTL A;  3A0J A;  2UUA L;  1G51 A;  3M3Y H;  1SRU A;  4A3J G;  1YIT A;  2E5L L;  1VQP A;  2UUC Q;  1PYS B;  2Q2U A;  1CKM A;  4LFB L;  5C0X J;  1YI2 A;  3KLW A;  5GAD C;  1YEZ A;  3TS2 A;  1QUQ A;  3I4M G;  5GAE C;  4HEA 1;  5BR8 Q;  3J81 i;  2R7Z G;  5IYC G;  2JEA I;  4JBM A;  4H02 A;  4BY7 H;  4YZ9 A;  1WI5 A;  4OXP A;  3U4V A;  4LF6 L;  3MXN B;  5C44 H;  5JEA G;  3CME A;  2CAZ B;  4JI8 L;  1Z47 A;  2JA8 G;  4DAM A;  4IPC A;  1A8V A;  4IO9 A;  1HR0 Q;  4QQB X;  4B3S Q;  4Z7G A;  1UE6 A;  1VQ5 A;  1YBY A;  2NN6 I;  4R4Q A;  4HJ9 A;  4A76 A;  1KD1 C;  2MQH A;  3BJU A;  1VQ7 A;  4L5R C;  2D0O A;  4IJL A;  3PUX A;  4LUV A;  1HNZ Q;  2E2I H;  3GTL H;  2UU9 L;  1X3F A;  2R92 G;  4YCW A;  3DA3 A;  4R1J A;  2F3I A;  4HJ5 A;  1VQF A;  3E9I A;  4X66 L;  4A3K H;  2AKW B;  4P71 A;  4DV1 Q;  1IZ6 A;  3UE1 A;  1B8A A;  4JBJ A;  4A3F G;  1Q81 C;  1IBL L;  2BA1 A;  4K0K L;  4IPH A;  1SR3 A;  3S24 A;  3KOJ A;  4GKK L;  4JOI C;  3GTG H;  2GVA A;  2BA0 A;  4PMW A;  1PH8 A;  4QY7 A;  2F66 B;  1NJI C;  4DR5 Q;  1Y1V H;  1A62 A;  2Z0S A;  4YZD A;  1CUK A;  2EIF A;  4R4C A;  1UE5 A;  1HNW Q;  3LJ2 A;  1NMG A;  4X6A H;  1IBK Q;  2QEX A;  1HNX L;  3PUV A;  3SGI A;  1BBU A;  1QVC A;  3ULP A;  1N9W A;  4GLA C;  5C3E G;  3F2B A;  2B29 A;  4DV5 L;  4A3E H;  2FXQ A;  4YCU A;  4BA1 I;  3IRB A;  1VQH A;  1YNX A;  1J6Q A;  5GAG C;  3CCS A;  4DV6 L;  1U0L A;  4OX9 L;  1L0W A;  3HOV H;  1I94 L;  1K8A C;  3CAM A;  4EX5 A;  3ZJY C;  2UXB L;  4G75 A;  2K5N A;  3PO2 G;  1PH3 A;  2A8V A;  4R4T A;  4JI4 Q;  3BU2 A;  3DO9 A;  1RIP A;  1PH4 A;  1HR0 L;  3AFP A;  4DR7 L;  3M4O H;  2D62 A;  2N8N A;  3T1H Q;  3L0I A;  4JOI A;  3BZC A;  2I5M X;  2F4V Q;  2XMX A;  3K7A H;  1KQS A;  4DK6 C;  1Y1W G;  2R93 G;  4LFA Q;  5IY0 A;  3U50 C;  2GN5 A;  3ERS X;  2R6G A;  3S1Q H;  1VQO A;  1SRO A;  1X54 A;  1HJP A;  5M3M G;  1YZ6 A;  3KYH C;  2MNA A;  4JI7 L;  3RNU A;  4A93 G;  3PO3 G;  4LUO A;  1J5E Q;  2JA6 H;  1NTG A;  4AYB G;  3I4N G;  3RN2 A;  4LF9 Q;  4MTN A;  3B6Y A;  4A3D G;  4LF8 L;  4BBR G;  2VW9 A;  1E1T A;  1WCM G;  3KF6 A;  4PL5 A;  4AH6 A;  5M5W H;  2NN6 G;  2ZTD A;  3PUW A;  4LFC L;  4JI3 L;  2VNU D;  1E3P A;  2B63 H;  3I2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...