3FVVA

The crystal structure of the protein with unknown function from bordetella pertussis tohama i
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
223
structure length
223
Chain Sequence
b'TTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Bordetella pertussis
publication title The crystal structure of the protein with unknown function from Bordetella pertussis Tohama I
rcsb
total genus 79
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.100 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) SG protein - dephosphorylation function 3fvvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fvvA01
5IS2A 2QLTA 5AI0A 2GHQA 4F72A 2HOQA 2I55A 2QYHA 4EELA 5AIAA 3VAYA 1ZRNA 1L7NA 4Y2JA 3PDWA 3NUQA 5ALOA 3QYPA 5AI9A 5ALTA 3I28A 3RFUA 1ZD5A 4BKMA 3KZXA 3L8GA 4B6JA 2G07A 3W5CA 2NO5A 5AVYA 5AVTA 2FPWA 3WK9A 4F71A 2YN4A 5ALHA 5AKJA 4FE3A 4UMEA 3NIWA 2P69A 3WKDA 5AVVA 4MWOA 4L6CA 3B9BA 5ALVA 1Q91A 1KYTA 3SD7A 4ZEWA 4Y2QA 4XPZA 3F9RA 4YIKA 3B9RA 4BNDA 5AW0A 2IYEA 3FPSA 3OTQA 1TJ5A 1YDFA 2IOFK 3ET4A 1RKVA 2JAOA 2WF8A 5AK5A 4C4RA 4BBJA 4YCNA 4DWOA 4KNVA 1LVHA 3EF1A 3ZWKA 5AKZA 4NAVA 5AVWA 4Y2TA 4HGPA 4KX5A 5AW5A 4I9GA 3M1YA 2YMQA 2R8EA 4QJBA 5FP0A 1JUDA 4UM7A 1PW5A 4EX7A 1CQZA 3OCVA 3A1DA 2WF6A 1U7OA 1RPZA 3WKEA 4GIBA 3SF0A 3R09A 3QU9A 5AM4A 2BY4A 2YY6A 1AQ6A 4CNQA 1RLOA 1WR8A 2MSNA 2FPUA 4C4TA 2ZBFA 1T9ZA 3AR7A 3CNHA 1RLTA 5E0OA 3OCUA 2YMMA 3HLTA 2WFAA 3ZVLA 3AR5A 2CFTA 1X42A 4YCMA 1Z88A 1Z5UA 2FPRA 5ALKA 1RMTA 2JAWA 2W4MA 3ZWDA 4Y2PA 1YV9A 4C4SA 1VFPA 4Y3UA 1L7OA 4KX3A 3QU4A 3SKYA 3RF6A 3QU7A 4GXTA 4E88A 1T5TA 4JB3A 4YIHA 1TA0A 2O9JA 3L5KA 1RQNA 3KDPA 4ZEVA 2B1RA 3NAMA 5AVUA 3QUQA 4BEWA 5AM2A 2G1AA 1IWOA 1L7PA 4KYTA 5AIBA 3D6JA 3ZTWA 3AR2A 3NRJA 5AKLA 2WF9A 3OPXA 4Y2RA 1L8LA 2I33A 4UM5A 1L8OA 2YJ3A 2ZBDA 3M9LA 2ZOSA 4HGQA 4BNDB 5ALPA 2G80A 2GHTA 2FEAA 4IG4A 2R8XA 5ALSA 5AW6A 1Z4MA 5AW2A 2JARA 2GO7A 5A3RA 4CF4A 4YGYA 1EK1A 4XOUA 2WF7A 4XQ0A 3WKCA 5AI8A 5AVRA 1O03A 1ZD4A 1Z4LA 1S2OA 3A1EA 2YMLA 2Q4RA 2I6XA 2YJ4A 5ALGA 3R9KA 3ZTYA 5ALIA 5AW4A 5ALNA 1N9KA 2FDRA 3WGVA 3DNPA 3L0BA 5ALRA 5AI6A 3PGVA 4CE6A 3WK6A 1U7PA 1VJRA 1TJ4A 3ZU6A 2YJ6A 3E84A 2X4DA 5ALQA 4RESA 3TLMA 4BYGA 2Q4TA 5ALYA 1TE2A 4IFTA 1T5SA 4Y2XA 3BA6A 3FZQA 4UMFA 2CFSA 5AKHA 4Y2VA 3AR4A 2HDOA 2B8JA 4YCLA 3MC1A 1WPGA 2HEGA 3ZW7A 3I6BA 2B0CA 3L8HA 3FM9A 1QQ5A 3DDHA 3QGMA 1Z4PX 1J97A 2FUCA 2B8EA 2P11A 5AK3A 3UMBA 1Z4KA 2G08A 4RETA 1ZS9A 2C9MA 1Z4OA 3ED5A 3N28A 2ZBEA 2GFHA 2YFYA 5AI5A 3I76A 4BX3A 3L1VA 1Z5GA 3QUTA 3WKAA 3ZI4A 2BDUA 3EPRA 4FFDA 4KN8A 4NABA 2GMWA 3U7FB 1ZD3A 3CZ4A 1QQ6A 5AKIA 1SWWA 4AS3A 4DCCA 2EARA 3ZVNA 3UM9A 4OHFA 4AS2A 4OFZA 2FPXA 5AHXA 4UW9A 5AKKA 5AW9A 3E58A 3U19A 2G0AA 2WF5A 4DW8A 2ZG6A 1L6RA 1YJ5A 2HHLA 2RARA 3E8MA 3S6JA 4EEKA 1MH9A 4CF5A 1EK2A 4UU0A 1F5SA 3AR9A 2OM6A 4UAVA 5AKYA 3HYCA 3L8FA 3SKXA 1ZOLA 2P9JA 5ALUA 3ESQA 5AK6A 2CFRA 5IT0A 5AM5A 5A3SA 4BEVA 3L0YA 4OCZA 4AP9A 2B82A 4BX0A 3N5KA 4O8CA 2WM8A 4EX6A 4UAUA 5AVSA 2MU1A 1QYIA 3AR3A 3L1UA 3W5DA 1RC8A 5ALWA 3U7GA 1Z4JA 4ZEXA 2RAVA 5ALDA 3B8EA 4HGOA 1YMQA 3ONNA 3WK8A 1J8DA 3NANA 3W5AA 5ALFA 5ALZA 2AH5A 2G06A 3UMGA 3KOOA 3IJ5A 2WHEA 5AW1A 2W11A 1YNSA 1RMYA 1O08A 5AVQA 4OD0A 2C4NA 2HSZA 2R8YA 3FGOA 3KBBA 2HI0A 3AR8A 5T41A 3KC2A 5ALLA 2JAUA 4JDPA 3ET5A 4J2TA 4UASA 1XPJA 2G09A 1NRWA 4L6AA 3SHQA 1RMQA 2YMPA 2ODAA 2I7DA 3KD3A 1Z4QA 2P27A 2HO4A 1U02A 2IOHA 5AICA 5AKXA 1WZCA 1N8NA 3PGLA 3QUBA 4G9BA 1RDFA 3ZVMA 4KNWA 4MUMA 2O2XA 5ALJA 2DQSA 1XVIA 2I34A 1Y8AA 1NF2A 2FPSA 5ALMA 3ZX5A 4DFDA 2C8KA 3W5BA 3MMZA 1SU4A 4XE5A 3L7YA 3OCWA 4H1WA 3E81A 1XP5A 3QLEA 3QXGA 3P96A 1YS9A 2RB5A 2JGAA 2C8LA 3IRUA 5ALXA 4UU1A 2HCFA 3WK7A 4NWIA 2HF2A 2D2VA 3SLRA 5ALEA 2FUEA 2AGVA 3R4CA 3IB6A 2OA0A 2RBKA 2PKEA 3L8EA 3WK5A 2B30A 3QU5A 1VJ5A 3BWVA 3ZUPA 1RKUA 2IA5A 5IT4A 1LTQA 2PQ0A 3WKBA 2PR7A 1RQLA 1Z4NA 1RKQA 5AKEA 3FVVA 3OCYA 3NASA 5AVZA 2VKQA 1ZD2P 2B1QA 2HF7A 4Y2SA 3J7TA 2Q5EA 2YJ5A 3N8GA 3ESRA 4BX2A 1S8OA 1CR6A 3AR6A 3U7EB 3QX7A 2AMYA 4HGRA 1RLMA 5A3QA 4HGNA 3OCZA 3FPBA 2YBDA 4EENA 4Y2YA 5AI4A 5AM1A 3L0CA 3DV9A 3U7HB 2CN1A 2FI1A 3K1ZA 4HAIA 5AW3A 3PCTA 1RRCA 5AM3A 4HYTA 2EATA 4UARA 1U2SA 4NFLA 5AKGA 3U26A 2HX1A 3QU2A 1ZJJA 5AK4A 2I54A 1SWVA 3NALA 4UATA 3A3YA 1Z4IA 2C88A 1TJ3A 2W43A 4I9FA 2ZXEA 2NO4A 5AM0A 4EZEA 2OYCA 3I1YA 3N1UA 1QQ7A 3MPOA 3N07A 3EWIA 2BDEA 3QUCA 4PNHA 1Q92A 3WGUA 4UMVA 4J03A 4YH1A 3GYGA 5AW8A 2IOFA 3OCXA 4QQFA 4G63A 2OBBA 1L7MA 4Y2UA 1QH9A 3UMCA 3DAOA 1NNLA 4UMDA 3U13A 3ZX4A 2EAUA 4FYPA 2NYVA 5AVXA 2R8ZA 3MN1A 5JJBA 1U2TA 4L57A 1K1EA 3SMVA 3A1CA 4NV0A 3QNMA 3WK4A 1FEZA 5AESA 2ZBGA 1WVIA 2AUTA 3EF0A 5AW7A 1ZRMA 4CF3A
chains in the Genus database with same CATH superfamily
1LPPA 2DUNA 1RYDA 3SC6A 1KYIA 3T06B 3EDMA 4EZIA 2CMGA 1YAJA 1XDBA 5J4VA 5K0EA 3AP3A 5DNEA 5A03A 4S0XA 2BZSA 4JUIA 1LFDB 5D84A 1BYIA 4Y2JA 1G1AA 3GXBA 2DAPA 5ALOA 1Y1KE 3PFKA 1RTKA 5KVAA 3I28A 3GNQA 3ZQ6A 1TVCA 3GPCA 3RD5A 4MI3A 3RVJA 4J94A 4FCCA 4G5FA 4CPDA 1H3NA 1J07A 4PC7A 5TC4A 1E1CA 4M7PA 2XADA 3BICA 3OTIA 5LM3A 2ZKLA 1DO0A 3BZWA 3P9CA 4IJ6A 1KS9A 2ODEA 4QGSA 4URVR 2ETXA 4U9IS 1N33B 3HO8A 4XEUA 1YZ3A 1XU4A 4UVHA 4IBOA 4OKSA 3UT6A 2ZRKA 4D0GA 2DCUA 3ITDA 4ESOA 2LWIA 4MUHA 1KDYA 4L1KA 4MW9A 4BECA 3W2IA 3W2GA 4F4CA 5FFFA 3ZU4A 2IP6A 1Q19A 4BNWA 1E2EA 3M9WA 5C8VA 2W48A 2R8OA 4KJZA 2VF7A 2XMBA 1HDRA 1T15A 3TNFA 3WBFA 3TR5A 3CU5A 1UDXA 2PKQO 3E27A 1EKXA 3UN1A 5KVSA 2AG5A 1OXKB 1TD1A 2ZDQA 4JU8A 1KGSA 2BC9A 4UU7A 1RPTA 1IULA 3SJ7A 2AFIB 1WQ3A 3IKJA 3NGLA 4AC9A 4PE5B 1Z38A 4IJKA 1M2HA 1Y6JA 3IIJA 3GW8A 1PV1A 1E9SA 1T24A 2I8CA 3VYTB 3JPWA 1U81A 2RHWA 1Z56C 2JGMA 5FP0A 3PK0A 1J00A 1O94A 4NECA 1X74A 2IXFA 4BGUA 3QWFA 2I8LA 3BL6A 1C14A 1RHJA 3CRRA 2YWDA 2X5OA 4RKQA 1ZMRA 3ZE7A 1E1QA 4AK9A 5DLEA 2FSFA 2IHYA 3WYCA 5F7OA 1ZPDA 2OAP1 1NLZA 4PCUA 5G4KA 4RH3A 3MWDB 1F60A 3QLTA 4BS9A 4JB0A 4PGFA 4M8NE 2W6ID 4I1TA 2VT2A 1M1NB 1RR6A 4JS0A 5T4FA 1JAHA 3KKMA 2QVYX 2J4DA 2JIBA 2G83A 1BCSA 2OKCA 2VCHA 1JT2A 2NU9A 4LXTA 4X6UA 1MJGA 2VBCA 2XYQA 1E2LA 2ILVA 5FI3A 4IIBA 4HZUB 5FOWA 2VTBB 1XYGA 3JARB 4DWJA 2MJLA 4OAVB 3UEOA 3LVBA 3KDSE 2OM2A 2F3PA 1UM8A 1I1HA 3H84A 5HFNA 2PKYX 2ZS9A 1GRRA 1P4HA 3KEQA 1KVRA 1Q0PA 2QNRA 5FBLB 4F96A 2JLRA 4HY3A 4L27A 4MQ6A 3N76A 5H81A 4H35A 2B92A 3AJDA 1TM4E 4BMZA 4DA4A 3MNFA 5ITWA 3BXEA 4OLBA 3TNLA 1T0UA 2Q9AA 1TGYA 1FDRA 1LBQA 5TV2A 4JB3A 1K2VN 2E48A 4YCSA 2GEBA 4HQ6A 4X3OA 2EFJA 2Y2UA 3TKYA 1F51E 1JLHA 5CT5A 4AAYA 1OIWA 3ZH9B 4CFYA 5AM2A 5IJAA 3MWYW 1NF3A 4MV5A 1TM5E 3ITNA 5K51A 2A0FA 2ATCA 4HOYA 1MOSA 1ZD9A 1XCLA 1MC5A 4M4SA 5L3RA 5KSZA 2JFNA 3KJXA 1MIOB 1U4OA 2GEUA 1SUCA 3QE2A 3HP4A 2VA8A 4E51A 3KLMX 1P5RA 4OYLA 1QU2A 1EHCA 2ZBVA 1DVRA 5ICCA 4OHZA 2PH3A 1I4OA 5ALPA 3WQHA 4PFSA 4XOIA 1B15A 2QTBA 4KMOA 3N2YA 4IG4A 4P3YA 4LJ9A 4AJNA 4PSUA 5KJEA 4FFRA 1ARZA 1E92A 4FGUA 5GTDA 2R1ZA 1JG2A 1OJ7A 2OENG 3DUFA 4MLCA 1MB9A 4DWLA 2QAIA 3BIJA 3GLRA 4I1SA 3OQMA 1FX0B 3D3WB 1P3JA 2G8NA 3LP8A 4MCHA 4UEOA 4E12A 1UXGA 1BQ4A 1D2CA 3LUDA 4F3KA 5CJPA 5FHQA 4N47A 2IU4A 2H2WA 2EHDA 5F1YA 2I6XA 5ALGA 1V4NA 3I39X 1A04A 1J1IA 1SRQA 4OLJA 1OFVA 2Q1XA 5LWHA 2ZTLA 2P2SA 3ZY4A 5FR2A 2B7LA 2R87A 3QE4A 4KO8A 5IDWA 4L74A 5KYKA 4XWYA 3NNDA 3EULA 1EAMA 2JRCA 3PVCA 4POOA 4WLEA 3STTA 1FFCA 1B6TA 1C50A 3N8IA 3U7RA 3VHXA 5JSZB 5D87A 1TFUA 4O2AB 1K2WA 2L18A 4RESA 4QXPA 2QN2A 5HF8A 2O57A 3AUYA 4AWXA 4AP6A 1QIJA 4WY8A 2ZYDA 5ARBA 2QORA 4CEHA 1HTTA 1B16A 2V9PA 3B1JA 4OU5A 1J0XO 4XWGA 1KZ9A 2G77B 1UXKA 3MD0A 3VRHA 1JPUA 4RK5A 1XZFA 1C80A 3G5MA 5FYQA 1JH9A 4GYYA 2MIIA 3CA8A 1RT9A 1X9HA 2A92A 5KYUB 1Z62A 3M6WA 3FNRA 4K2HA 4YLGA 3ZWWA 1VSBA 3ZHUA 4EO7A 1VGVA 4QHYA 3VO2A 3WLHA 2QX8A 3ZD8A 1QG4A 1OGJA 3ZE9A 3MRSA 5JQGA 5EIWA 2VP6A 4CJXA 4MYCA 2P11A 2OWEA 3C0KA 3RSQA 2P4EA 1HOXA 5JDCC 5FRDA 3VU9A 1PJ2A 4LY3A 3V5NA 2GZHA 5E3HA 4YDHB 5I51A 4DLWA 4ANFA 1RXSA 1SBYA 2AIRA 4LJ8A 1SC9A 3G2PA 1UBFA 4OJQA 5KZMB 2JLYA 3ZCRA 1Q1QA 4AO7A 4Z4HA 4BTEA 3QEAZ 1Y1PA 1CEEA 3KJNA 5FJJA 1CUCA 2VQ3A 3UW1A 4EI7A 4EHIA 1Y81A 3D4BA 2DJIA 4HAYA 3BMNA 4UEQA 1FB5A 3UATA 4OHKA 4N01A 2AEMA 5F7ZA 4CL0A 5KB3A 1GKLA 1HY3A 2YIDA 4F84A 3L0PA 2RH8A 3WKAA 1F6WA 2Q5FA 1J8YF 3Q0EA 3F7MA 5JPIA 3EPRA 1DAGA 4NFYA 2ZYGA 4RIEA 4ZU1X 1P73A 2VYVA 2AMLA 2HTFA 1IE3A 4PS0A 4DDUA 5ADVA 4AWBA 2HLHA 3DBHB 4Q16A 4RVCA 1TZCA 3TQSA 4RQAA 1WCXA 3EXAA 3IVXA 3IUNA 3PIRA 4I5GA 1Y4AE 2PFGA 4N5HX 2IWHA 3C6KA 3L93A 3DLTA 3LBIA 3GEMA 1XLWA 4RXMA 4DQ0A 4DCTA 4M9QA 1YJ5A 2HHLA 1EDBA 2G82A 1EINA 1GDHA 4NYMQ 1LF5A 3MYRA 5GY7A 1JXMA 2GTPA 2ETVA 1I32A 1ODLA 3EUWA 3MJHA 4FFSA 1F5SA 1VI5A 3VHLB 5H68A 3F5DA 2OM6A 2IPMA 4UAVA 3UJ8A 2JFQA 3AI3A 4TLMB 5DMHA 2XCUA 3E9QA 3QJYA 2IYQA 4OK3A 5FBZA 3TMKA 3V8NA 4DCSA 3KZKA 2H4ZA 2GGSA 4PFJA 3L7AA 1I2MA 3A6ZA 4HH1A 5AK6A 4KLNA 4V03A 1V4VA 3ZGNA 1SXJB 1QGUA 2OPHA 1GYRA 4E6EA 3V00A 4DMGA 4WFQA 3KAQA 4CETA 3A4YA 1E9RA 3ABQB 4QJ3A 5A6VA 2JLZA 2J7PA 5FWAA 3JY6A 1H94A 4BKQA 4YUZA 3H8JA 2VK4A 3IMEA 4B2IA 3A3OA 1Z5VA 2NZ2A 3BD6A 4K81B 4Y9UA 2Y77A 4R1PA 3ZXSA 5EWJB 3ROXA 1YBAA 4CW7A 1D4FA 4PLFA 1GGFA 4L4RA 1LD3A 3R6DA 5TT1A 3BZBA 9LDBA 3DPSA 3ITKA 3K30A 1DFIA 4DR3B 4PZZA 3IEVA 1MEOA 1CVLA 5KMGA 3LY7A 1GOTA 1LFAA 1T29A 3KOOA 1NBME 4Q00A 4A23A 2WFMA 2UVQA 3V4RA 3JD2A 1LWNA 3D8UA 3OPYB 2IV2X 1YNSA 1R9NA 2XY4A 3AESB 1J2JA 3EVEA 2GJAA 4OHRA 4EAQA 4D57A 5K6RA 3OQNA 1EZ4A 1OZFA 1FMLA 3DBRB 2E85A 5FNZA 4P33A 1ISPA 4ZICA 5BYKA 4L4ZA 2VTBA 4E14A 5I4CA 2YRFA 3EVDA 1W0JD 2P9GA 3JWJA 2JAUA 3BTOA 2NU9B 4AUKA 4ZJUA 3CUYA 3QYJA 5EHQA 2V65A 2JGKA 2PUJA 3DT8A 1N6KA 3A1VA 2VZ9A 1QBKC 4JCOA 4L9RA 2ODAA 3JQ9A 4QPPA 4TXJA 1S5PA 4UUBA 3TIIA 2P6RA 2A1UA 2HO4A 2ERXA 2ZAYA 1UK9A 2ONKA 3MJTA 2A0KA 4WKOA 4Q7EA 5B3KA 3QUBA 2OKGA 3AP2A 4GI1A 1ULZA 4WECA 5DEOA 1KQNA 4YLYA 4KN9S 5G41A 3ZVMA 3BC1A 1T0JB 1R5JA 2EP7A 3IBGA 5FUVA 5JS6A 1J9ZA 2BR4A 2I7XA 2EG5A 2FYTA 4YRPA 1C81A 1CY4A 1BFDA 1D2HA 1SUAA 1VYVA 2BF7A 2DWUA 3ZV5A 3LSTA 1KEPA 3NYQA 5CX1A 3NDJA 3JYQA 3AHGA 1XFAA 4ZQGA 3K9LA 1XNRB 4OQEA 3WOVA 4NOJA 1USVA 4G24A 3H1FA 4F3TA 1ZH8A 3CWQA 4N9QA 4H1WA 3A28A 5CURA 3ZQKA 1XTIA 3AJ8A 2XBUA 2Y0DA 4J29A 5LDGA 2LIPA 1Z5ZA 5CM2Z 1I2DA 1AO0A 1RM4A 4PZLA 2JB2A 5K20A 4BNJA 1O5TA 1EVZA 1M8JA 4HSGA 1C1XB 3AKCA 3PC8A 2IGBA 1IY2A 1T3GA 4GUAA 4E2FA 1PHPA 2CFOA 4PLCA 1CUGA 1G6Q1 1DCKA 5JLJA 4YLEA 2PUDA 3N70A 2AFHB 5A0TA 2CDRA 1T4GA 1ONSA 3LPLA 1C7RA 2YQZA 3ONWA 4M9CA 4JQSA 1CJUC 1JJVA 4L8YA 5GVRA 3VV2A 5HCNA 1MG5A 2J0EA 1JQJC 4RA9B 3TTYA 5FPKA 2JBAA 3PX2A 4LWZA 1B0UA 1SG9A 3P5BA 3NT5A 4NP6A 3S8MA 1R5OA 1SOUA 4B3XA 3GMTA 4O08A 4NL4H 2EX0A 3FROA 4B3JA 2VPZA 3KE8A 4P7FA 4XIJA 3TAUA 1C8KA 1HDGO 1A2OA 2QL5A 1ODCA 1YJ8A 2EDAA 2LV8A 3FTNA 3I2KA 3N2KB 3NJRA 1VPLA 2YV3A 3M1IA 3RSHA 2BHSA 2HYDA 5U4XA 3WXMA 2J6IA 1VJ5A 4FINA 4KACA 1IQ0A 2RHHA 4ZGWA 4U7GA 3LJ0A 2PQ0A 4N5MA 5IVDA 3A10A 4HUQB 1QQAA 3SJCA 5J2TA 1XKLA 1R4MB 4ALKA 1BD3A 1ESMA 4DNFA 4WFJA 1ATIA 1VLJA 2VKQA 5B12A 4KR3A 1FJGB 3KQNA 3IEKA 3MUFA 1R16A 5HF6A 2E4UA 1G8JA 3OOSA 1JFRA 1C0KA 3EMKA 3U1TA 4L0CA 3TD6A 1NBHA 1CR6A 3CN9A 2D8MA 3L7JA 3SR3A 1UCFA 5LJIA 4KPEC 1NRIA 2RCYA 2Y71A 3PE3A 5HCIA 3OWXA 1E2KA 3DP7A 3M34A 1DCTA 2FWAA 2C29D 3PFIA 5SY6A 3EBOA 2BFPA 3S1SA 4GKKB 3GLFB 4KB5A 3PNLA 5K7SA 5G1NA 3VX4A 5IC4A 4CQLA 3BMOA 1OWPA 4IW3B 5AI4A 1PBNA 4MKGA 2FWRA 4UUQA 1XXHA 2MTBA 1PT8A 3DV9A 3FNQA 3QTTA 4QE3A 4UZSA 2QSBA 2BI8A 3N0RA 2K7FA 4NY1A 1ST3A 4FKZA 1Z7WA 3VSBA 1DXQA 1P1RA 4WXYB 1HE3A 4NH0A 1REQA 3C3EA 4ZCRA 3DMRA 3T9DA 4CKXA 5KNDA 2KLBA 2WSIA 3NOXA 3GVXA 1FFWA 1GZ3A 1RYEA 1S2GA 4MW1A 1ZJJA 4D4JA 5LD2B 1WG8A 2XUIA 4R9NA 9GPBA 5I7OA 3RAEC 4QECA 2GK3A 3ASZA 4RIGA 2GVNA 5EP1A 3HV0A 2J9ZB 2MSWA 2ZIXB 1QQTA 4GZLA 2R6JA 3WDKA 2A57A 3AIMA 3FA2A 3F9IA 3ORHA 1Z73A 4EZEA 3NVKI 4IKPA 2HV9A 1CUEA 2WU4A 3DDZX 3FLBA 3F6CA 4KXYA 3FWNA 4QUAA 1JNXX 3U5TA 1YKFA 1QTIA 2EQ5A 1X3SA 4I7EA 4TYPA 2HK9A 2VAMA 3H65A 4E1VA 4M6WB 4M7OA 1OROA 4YP9A 2W42A 2KKMA 3DMTA 4F1JA 2JA1A 5COBA 1VJ0A 1JBEA 2BHTA 1ZJ4A 2OBBA 5M04A 5B57C 2IS2A 2B99A 1ECCA 1U3WA 1Z36A 2JH8A 3KTAB 3PF8A 4IHKA 5EIOA 1MF7A 4N0MA 4II7A 2XPCA 2OBLA 1PSWA 3CZAA 4P5DA 2RADA 2EEPA 2Q3LA 1YZYA 3U13A 4EFKA 4EGFA 1THZA 4O59O 3IPCA 1ZIXA 2A9OA 4FYPA 4BU1A 1FJ2A 1X13A 4ZREA 5JRDS 3S1AA 4E94A 2AJBA 1YU9A 4YBRA 5BXQC 4FWTA 1LDNA 2GYUA 1YS1X 4PC3A 3S55A 2VFAA 3ETCA 5EZYA 1XTPA 4EGQA 4RXTA 3S2FA 3D4PA 3G7SA 2I0FA 3NKVA 2I4OA 1BS1A 1TMKA 5EIFA 4ZTZB 1OXUA 4GW3A 3U1VA 4DOMA 3IR7A 3M1AA 3BG5A 4R0VA 3TVTA 1YDWA 4EELA 5AIAA 1GKYA 2JFWA 4NCHA 4LHVA 1ZGAA 4FZVA 1GG2A 3T7JA 1Y5IA 1NV9A 3T4UA 1EGAA 3ZZNA 2HBRA 1AHHA 3GQBA 4JR0A 3VU8A 2UUOA 4HWPA 3RFUA 1LV7A 1U0TA 5IAOA 3FWHA 2LTAA 3MTEA 3RH0A 1XB2A 4CM4B 2CLCX 1M74A 2DR0A 4WT7A 1JWAB 5HYVA 3GFFA 1WBDA 5C46F 5KYYB 4Z7GA 1GEGA 2Z8YA 3PEUA 4TT3D 5CT8A 2BGGA 2A8YA 3I5XA 1XMIA 2I6GA 2AXQA 4KIWA 4MYHA 1C9NA 5CK4A 5MN6A 5DOVA 2GN6A 2JK1A 2OBFA 2BBTA 1GADO 2A2DA 3R4VA 4KE7A 1J1ZA 2O06A 4DLAA 2EXXA 4F9EA 4TS4A 1J33A 3PYXA 1ZFNA 4RC9A 3WO1A 4D43A 2CXPA 2LD4A 2V7PA 1RHQA 3OU2A 3F5QA 4LGMA 4ZVUA 2UYGA 3JVIA 5KTOA 1J8MF 4UBNA 1L4HA 1ZSVA 1PR1A 5J59A 1JLSA 4DC9A 4XPZA 3G0CA 3UHOA 3X1WA 1H1LA 3WMRA 4NYJQ 3LLUA 1RJEA 3KKQA 1DG3A 1Y89A 4YRJA 5BMVB 5FKJA 1G41A 1MCZA 2PL5A 3KZ1E 2JAOA 3DJFA 3K73O 3QX8A 2DH6A 4G1CA 4GGOA 4IJUA 1BEUB 1CD5A 5DXFA 3HO1A 4BBJA 3SE7A 1FYDA 2QZZA 5FLKA 2ZETA 4A0SA 4HB3A 4D45A 1NOJA 2F6RA 5KYVA 4HNVA 4LK3A 2QZ9A 4HQ0A 2D8AA 1Z6PA 1E20A 4I55B 1L8XA 4TWZA 4YUAA 5IHXA 3V9AA 5JMWA 1E9BA 4F8YA 1XZAA 3STUA 3G2KA 3NIDB 3V42A 1M2VA 3KU4A 4MUKA 1OXBB 5F2OA 3UAVA 1IM2A 3ZJ4A 3TRHA 1L7VC 2P4HX 4MGIR 1FDIA 3KHSA 4EG3A 1YFLA 1GVHA 4HRVA 2WT8A 4DLZA 1X6VA 4UFPA 3HYTA 3JATA 3A1DA 4OHOA 1DNPA 4V1CI 4JJFA 4Q7QA 3B7PA 3GVHA 2F3RA 2WF6A 2R9VA 4FEGA 1HL7A 3H3XA 3MSCA 4RVNA 3SGLA 5LDDC 3SF0A 3GBSA 3QU9A 3R09A 4MV0A 4EL0A 5L3QA 3O92A 1T4CA 1Y1LA 1ZGCA 4FU0A 4G4SP 1IHUA 4KDRA 4CKWB 5K6AC 5D00A 4JKOA 1L5OA 3NHUA 5D85A 2XXAA 2QMYA 3DEKA 1DBQA 3G02A 1Z75A 4IFEA 1WP4A 1ZM7A 2J59A 3WL4A 4KZKA 2FPOA 5HKKA 1VZ3A 1VB3A 3NIBA 4DARA 3GCZA 3L8DA 3U4AA 4YRBA 2XSZA 1JZTA 3T35A 1CZNA 3NHFA 2I66A 5JDIC 1HGXA 3CUVA 4LJ4A 1JFTA 3TUZC 4J7CA 1O6FA 3HA2A 2DF8A 3HXLA 1VMKA 4IDHA 3C43A 3OLVA 4N82A 2G1PA 3NHAA 3OJOA 4RMJA 1UIRA 4M46A 1FNNA 1E7RA 4FJ1A 4MWBA 2PFSA 2XCTB 3WP1B 1QX3A 3OFSA 5MDHA 2OLKA 4R41A 5CA0A 4P2GA 5BV0A 1FVXA 4RTRA 1E6CA 4FD2A 1U8UA 2OQIA 1T34A 4ZP1A 5BUSA 2P8SA 1X2EA 2I78A 4GAEA 3QF7A 3SAJA 4CLDA 4GXTA 5CH8A 1JDNA 4IL5A 1TM3E 3RSLA 3UMVA 2BDTA 2AK2A 3UT5A 2J4FA 2JPDA 2CYCA 3UCXA 3G8DA 3LG2A 4KXQA 5CB4A 1FLAA 5LIRA 1N7JA 1OASA 2HNAA 4FOPA 3WLEA 4F1KA 3MTBA 4PYNA 1TYDE 5CB0A 1FQKA 5KX5A 1S2IA 2DCMA 1A9ZA 3BYZA 3ZG6A 4JLKA 3RKRA 1P33A 1JIQA 3ZV4A 2MINA 2QJRA 3HB0A 5BYJA 1L5WA 2AN5A 1YO7A 1LPOA 2F3UA 1V37A 3IBYA 4DNPA 1V39A 2PUVA 4G07A 4LXYA 3ZXXA 1DEKA 4L4YA 2X6TA 3KZOA 1MN6A 4ZT6A 2WEKA 3BA1A 3N0VA 4DNQA 1B2LA 1B41A 4PQGA 1LW7A 4QFMA 4ROTA 5F3DA 5JZBA 1PDOA 4BDTA 4OHYA 4OHPA 4BLSA 4B2PA 4CGYA 3TKLA 1P0IA 4BE9A 1FVOA 5FEUA 4H2DA 5HZKA 5JEEA 2HDNB 3LDGA 1H85A 4ZJYA 5CITA 1XZLA 3A6FA 1GQSA 4LRSB 1ODKA 1MX3A 4F04A 5JNUA 1VG9B 1VL8A 1BKDR 5H82A 1NN0A 4LZZA 3LPMA 1XL1A 1CRQA 3TTVA 4C07A 2FE4A 3G79A 2AXNA 1GPYA 1ZQ1A 2MSEB 3PRHA 1F8UA 4Y1RB 3R0VA 2VJYA 4QYMA 2FSPA 3WIUA 4YXWA 4B3TB 2N47A 1GUFA 2OQVA 2DECA 4O25A 1X1SA 4NK4A 3X2FA 5I5EA 4IHAA 2WLTA 5DYTA 3ENZA 1HYGA 4AQDA 3SC4A 3PEEA 5L3ZA 4A4DA 1M7GA 4PAGA 4BFWA 1DIHA 1P7YA 2F1KA 3H7IA 3AIKA 3OIYA 3AXTA 1GAEO 1SCUA 4MSUA 1B4DA 2ON6A 2PKQP 5KQLA 4LECA 3QK7A 1Z06A 2QQ5A 2Y3IA 2IYNA 1Y3IA 3OFKA 4L51A 1XZ8A 2FWJA 4WCFC 1HDYA 1U0SY 1SIBE 2Q5HA 2UZ0A 4JH0A 4UC0A 4EVQA 1R2QA 2XMSA 2ZRQA 5HHTA 5LMZA 2GBLA 4R3NA 2O2JA 1PT6A 2H11A 2PGOA 1D7AA 4GBJA 1RQXA 1N57A 5EQFA 2BH2A 3SZLA 1VLZA 2O2GA 1DKOA 1UZMA 3G88A 1VE3A 3NGXA 4L7QA 1J0EA 5KAMA 4BVFA 1TMOA 3ODGA 2HDOA 4Q02A 3UYKA 3HEBA 1Y3HA 4KK4A 2JIPA 3G89A 1U2EA 5DXAA 2C77A 4O4LF 2DKOA 3B3AA 4ESVA 3ROQA 1TKBA 5EMNA 3T5CA 3GWGA 3I6BA 4CLHA 2OB1A 3JU3A 1GLNA 1Z12A 2X5KO 1IY1A 1MXHA 2ZWOA 1J06A 4RE5A 4A0QA 2XB8A 2FNAA 7GPBA 4DR4B 3CKKA 2NVOA 2YNMC 1GHTA 1ZS9A 3U7QA 2J30A 3K9GA 3NUGA 4MWTA 1RWPA 2C9BA 1IN7A 1UBRS 3ED5A 1SMKA 5DWVA 5I48A 1EXNA 2FW1A 4MR8A 4QDUA 1KZ6A 2YFYA 4M22A 2OZPA 3ZU5A 3DL0A 3TEFA 4HWOA 4ME6A 5JAMA 4UE2A 3EASA 2K2WA 4TV8B 3ZLVA 1TDJA 2OGSA 1P9OA 1TIBA 2MYUA 3EXFA 2HR1A 4MW0A 3GUCA 2WJ3A 3BD8A 4LA4A 3RLFA 3O74A 2QRQA 4EVRA 2PN1A 3FCOA 4MI9A 1FRQA 3BERA 1Q0LA 4RDCA 4TXMA 4WUTA 1HL3A 3R6TA 1XROA 3WIBA 3GLIE 2GZDA 4CIDA 4WBNB 5I9NA 4OQYA 5T64A 2V3CC 3N0TA 1P1BA 1BA3A 2HLNA 4QT0A 3W2HA 1A2KC 4B2YA 4F3CA 4CKEA 4F11A 4YPVA 1NVMB 2JEZA 4N41A 1C7JA 3AVXA 5AW9A 4JDUA 2W2OA 3IQIX 3P9XA 1N78A 2NT4A 2ZUUA 1L6RA 2V98A 2VQDA 3OU6A 4RVSA 3V1UA 5KKAA 2BMJA 1CIPA 1P61B 2O2SA 4WNAB 1W73A 2PBLA 2GAJA 3H6GA 5IUJC 2PUCA 3FLEA 3HB4X 3IB3A 3GLVA 2A9VA 3R0QA 5EKSA 1WUKS 1AKMA 2JD2A 3SOPA 3D8SA 3KOUA 4OU4A 4WZBA 3F6EX 5ALUA 3EISA 1F4PA 2B1JA 4J1TA 5EFOA 1TC2A 1HI9A 1N0IA 4B3FX 4WHMA 4FFBB 4MKHA 4UNPA 3A1UA 3C14C 1RWQA 5IK2A 4EPYA 4AUMA 3L0YA 4B71A 1GGHA 3ELUA 2N3ZA 4UCWA 4JGIA 3E53A 1CE8B 1VLVA 4UPDA 5CAEB 4ZDIA 2OFXA 5LZ5A 2HD4A 4L3WA 1LLDA 2E1PA 2XJ4A 4C21A 9ATCA 1HURA 1QFZA 3O4RA 5IHPA 1YVDA 3BMQB 2JGRA 2OP0A 5ARDA 4ER6A 1HT2E 2OAEA 4CODB 1DKRA 2Y0EA 4UTPA 1YCDA 4L72A 2OOSA 4MI1A 4Y9TA 1EGMB 4I9UA 3WGNA 2Q5IA 4G36A 3S4YA 5K8CA 3KS9A 2I67A 2ZSJA 1YB2A 1OC2A 2VOJA 5E95A 3WICA 3PWTA 3ZCSA 4XB2A 3Q7SA 1SCJA 3V3KA 3FUTA 1H0HA 1NBMD 2O1EA 4FKMA 3BJZA 3DHNA 3KJQA 2AVDA 3JQRA 2A0UA 1KAGA 4MDYA 3U3ZA 4YREA 3VKVA 3LQRA 5TJHA 2YVAA 4D0LB 2DB3A 4LISA 4N03A 4ZYLA 1DIGA 2NTNA 4A10A 3EQZA 1H4VB 3NM6B 1BGXT 2CZCA 2VT3A 4LE2A 2BGWA 2IUEA 3QYFA 3RCBA 3DOUA 4FFPA 1R5BA 3VOSA 4IQ8A 5BNTA 5HJ7A 2WWFA 4OGLA 2O7NA 1EXVA 4MUFA 2YHIA 1Q1EA 3H1PA 1P31A 2M6LA 4DLLA 5HZHA 1EDEA 4EMSA 2Q8PA 3B2EA 1KO5A 1YKGA 2O7QA 5BMOA 2DLNA 4ER0A 2WWWA 4HVTA 4AXXA 1QP0A 2FFRA 5EJ4A 3C4QA 4G8JA 4J6EA 1EGVB 4O1IA 2XDQB 3IQFA 3WIDA 4YRGA 3GLFE 2Q3HA 3M83A 5LP6B 1KQOA 1AHIA 2C8KA 1CUJA 1LNSA 2XTMA 3BE6A 3CNOA 3EXHB 3NQ41 4MQFA 1RWWA 2XHEA 3QE9Y 1QH8B 2MINB 3OCWA 4X1YB 4B73A 3MXTA 2G0TA 2IEYA 1JH8A 2HMTA 2I76A 3KOZA 4X8HA 3IUQA 2C96A 2B3DA 1T2UA 1KK3A 2H9YA 1DHTA 1Z15A 5AP9A 1RWXA 5FBVB 3M3HA 1UBGA 2ZVPX 3H4MA 3KU1A 2RB5A 4MH0R 5JWHA 4Z2YA 3UO8B 2VDKB 3EXFB 1W85A 2GRUA 2YUTA 4C5CA 3LC7O 3HSYA 3KJHA 3IDOA 6REQB 1M54A 2XGOA 1J2EA 3GCGA 2B1GA 2XUHA 3PFGA 5A6SA 3H4IA 2XIQA 1PT9A 1K68A 2PX6A 1JA1A 3AJEA 3R7LA 1BGVA 4POAA 2QGZA 3I32A 1VKRA 3JQGB 5I9MA 2ZVQX 3WMEA 3OVMA 1DAMA 1WIWA 3CTPA 3DV0B 1W4LA 3R2JA 4JJ4A 1M2JA 1TK9A 1P75A 4W82A 5B7PA 2IYUA 4I6JA 4X45A 2P0EA 1U6JA 2ECKA 2HU8A 3L05A 3L3BA 4MO2A 3QELA 3RREA 3W6UA 1G38A 2VSYA 3K0BA 2RK4A 3BKXA 1DV2A 4IIHA 2INGX 3DP9A 2XVZA 4V2UA 3IL2A 3VZQA 2GZ3A 2Q2QA 3AZQA 4V24A 3CH4B 1UC5B 4IYJA 4OXKA 4RSRA 2GCNA 3B53X 2PYIA 2C7OA 2CCGA 4ZQBA 5DKFA 3GEHA 1U2GC 1RBZA 3MOIA 3UQYS 4M60A 4MKXA 2ID4A 1DRVA 2QVLA 1E0KA 2Z58A 5AVZA 4BCBA 2C3PA 2ZSUA 1AX9A 2FN8A 3K0KA 1FL9A 3IP1A 2W6JD 1J25A 2VNKA 2IP2A 2Z4TA 3C3KA 4MLZA 2P79A 4O4IB 3GP8A 1XPRA 1AQYA 2Y76A 1QYWA 3IUEA 4FOTA 5KYWB 1XHLA 3ESCA 2C04A 4UTNA 4IY1A 3GOHA 4WWHA 4R8VA 4ES6A 1G5HA 2ZS7A 3C1TA 5TF0A 2N75A 3U4CA 1L8AA 4AX8A 3D2LA 5C8DA 3LIIA 4FFWA 4MO9A 4AULA 2IQ5A 1JR3D 1INLA 1GILA 2RGYA 3DH0A 3T3DA 5CVEA 2YBDA 1V1JA 2FF7A 2VG8A 4ACAA 1DQRA 3NEYA 5M2QA 2EW8A 4QOJA 2RHJA 4QARA 2NVUB 4AB1A 1KO8A 5IBRA 2GSDA 2QJOA 2Y92A 1E8NA 3PD0A 1Z25A 1CNFA 1CY8A 1D4OA 2QA5A 3B9PA 3CX4A 3F6PA 4L75A 2HXGA 1XWWA 2P3SA 2Q1WA 4LHEA 1MC8A 4N1AA 1U2SA 1WF6A 4A0FA 4I6EA 3E1SA 2QXUA 3CUTA 4ZA2A 2A3RA 3UWOA 1ICIA 1VMEA 4DILA 4PW0A 4ZJPA 3BMOB 1N4AA 1AQLA 1GGVA 2I54A 2Y0CA 2HBYA 3T5DA 3TAHA 2WJ6A 5DI3A 1YQWA 1G4HA 2J4CA 2IUUA 2JJMA 2P35A 3FGZA 4I9FA 2ZUCA 2QY9A 2F4NA 2B94A 1XSEA 1M6WA 1PYDA 3TQRA 4D25A 2JVJA 2GOYA 2NW6A 2Z08A 4LXIA 4PNHA 5FQNA 5JG7A 1P9LA 3AHCA 3LKVA 5K4AA 4ZHQF 4M0UA 3ZDEA 2CV0A 2Y1OA 4AJ9A 2IOFA 5K6AA 1HT3A 5GWXA 2TMGA 4PTLA 5FEMA 1VMAA 3IR6A 3C3XA 3E9YA 1MKYA 5DP2A 5KYWA 4I08A 2BFBB 3PKIA 3KP1A 3QITA 4GLLA 4U3JA 5F7XA 1L7MA 3UC9A 3OLZA 3IA7A 1DRWA 3WRWA 1ZVQA 3M33A 2P2LA 3T9CA 1JHRA 1ADFA 3FAKA 5IU6A 2X1LA 4Z4GA 3WQQA 2A3NA 1E2QA 4OQPA 4BP9A 1TJYA 1T3ZA 4MVJH 2OHXA 3EYWA 4DMLA 1B14A 3QBVA 5AVXA 3MN1A 3QHQA 2IK8A 3OPYI 3ZY2A 3T3OA 4NU5A 1Q83A 2PJZA 3VNUA 4NV0A 5D3MB 3QNMA 2BKVA 3RVNA 3UK7A 5AESA 1OYYA 3R0XA 4E46A 2XYPA 3NORA 5HQ3B 3W34A 2NTYC 4NXMB 3TZLA 1OWLA 4P53A 3L41A 3QTBA 2HOQA 4RABA 1W2GA 3EWNA 2CUNA 2IVFA 3WNQA 2XGJA 3JYPA 5H8WA 4IGAA 4BNHA 4LRYA 3BWYA 2NGRA 1NXXA 2OCPA 1FPQA 4XYGA 3WBJA 1FSGA 4NULA 2BN4A 2GBGA 2X0DA 3SFZA 3C3YA 3HYRA 5ALTA 2LXNA 2YV5A 2CVPA 1PL6A 1QZ3A 4CMEC 2HCRA 4HYEA 5NULA 1RAFA 3Q7QA 4B3IA 5E38A 2YIVX 3AM3A 3QWBA 2L17A 4EARA 1CUYA 4G5XA 1IJEA 3WX0A 4JMLA 2DFPA 4OMCA 1MAAA 4YJ3F 1L6IA 2I2WA 2X86A 3VR4A 2QL7A 2EBWA 4FE3A 1PWEA 2H1IA 1C4XA 4FGZA 4HEQA 3UJCA 2RGEA 3HI4A 1HYBA 1OLUB 1X1QA 1X8LA 2A5YB 4KKVA 5L40A 4L6CA 3QUAA 3IAM6 2NU6B 1Q91A 3SD7A 5EGNA 4K9QA 2Z3VA 1JPJA 1X9GA 2Q3DA 3QNWA 4ZOLA 2G4CA 3QEOA 3N87A 4TTQA 4PSCA 4WN3A 1QRSA 3IC5A 3ET4A 2XCRB 2D7DA 1MJFA 2WOJA 1YE5A 2ZI9A 3GEGA 3D2AA 4RHFA 5TMPA 1IZ9A 3W5SA 5C0OE 3GFTA 4UZEA 4YMUA 2BIFA 1AHNA 4ACBA 4D9JA 2X76A 2VHQA 2R3SA 5D86A 3H0EA 5EQTA 2D3TA 1V5EA 4Y6OA 3KJGA 1XLTA 3AW8A 4KQXA 4D96A 1KYZA 1CVIA 1DBPA 1NNUA 2IHTA 5JCJD 4MCJA 3ZHZA 1F8GA 2MJFB 4FE4A 4LW8A 4M7RA 4M38A 2KSQA 3THSA 1ZCZA 4EMTA 4MIYA 4I1RA 2V1UA 4LRWA 1GSOA 1ADYA 2B1IA 2VJMB 4DMRA 2Y1EA 4JUCA 1VLHA 5GZ6A 1AURA 3E15A 2BY4A 1TO2E 5FAXA 1EUDB 2D5CA 1TUBB 1ZUWA 4LMBA 5DTQA 2PUGA 1XF9A 4OTZA 3H2JA 1NTOA 3L46A 4PLWA 1JE1A 5E0OA 4S1OA 4CMBA 4ZVKA 4K2AA 2GPAA 3RUHA 2JLUA 4TTTS 4WOKA 5EVJA 3A6GA 1JR3E 4CLXA 5CTJA 4AJLA 2PS3A 3IT0A 5E4FA 2GF9A 3C3AA 4XUGB 3ML1A 5L3SB 3BT7A 4MTCA 1Z68A 4JA0A 1GD1O 4ENRA 1L4KA 2HLDD 3F3SA 3JPYA 4X44A 2OD2A 3RJ5A 3PX7A 2G72A 1O97D 1ZK1A 5K3SA 4KCGA 3ZY5A 4C78A 4C04A 2I4NA 2NSHA 1Z83A 5FPQA 3VZBA 5JZSA 4GQIA 5T8KA 3RS3A 1LSJA 2J41A 4Q1EA 3GJ5A 4GG1A 4LBVA 3GGJA 4BNMA 3T7AA 4C0HA 3TBHA 3LI2A 6ADHA 1K4MA 4QBTA 5JD5A 5KX5F 4Q48A 5E8JA 3A27A 2V7WA 5AVUA 2Z43A 4AU1A 2W71A 4PBTA 2EF0A 4PGHA 3ZY6A 1RLUA 1ULHA 4FFBA 1OH8A 4RJ2A 4M6WA 4XIIA 2IZ0A 1QHHB 2JB9A 1V4BA 3PJGA 4ISCA 4IV0A 1GU1A 4AF8A 4I6GA 2I80A 4LI3X 2D5BA 1M10A 2IIVA 4FW9A 5A5GA 3T12A 4MV8A 1XMVA 3RSSA 3MUEA 3I1JA 1E1KA 1IEWA 1WXHA 1H5QA 3CQ9A 4PVCA 4BHTA 3OUTA 5DN6A 1DIOB 1JU4A 1E1RD 2HSGA 3V8PA 4UPEA 3PUJA 1KMCA 2WHQA 3P5SA 5IVKA 3V1TC 3UY4A 2EJCA 2V03A 2XAAA 5KNBD 3UAOA 4TWIA 3BMNB 1RAEA 2XLCA 1XMOB 2L42A 1Z13A 4OLHA 2VWQA 2R6HA 3VKGA 1HQYE 4XJVA 4QGHA 3KQWA 2PV0A 1NLMA 4FBMA 3PDHA 4UTXA 3PNYA 3PTAA 4RLQA 3IV6A 3GN1A 4UREA 2YWGA 2A4MA 1Q0UA 2YJ4A 3E22B 4JJIA 3R9KA 1WVMA 3RUCA 3COVA 2H2HA 3FFBA 3LP6A 5ALNA 5LVAA 1CHNA 1ZUD1 2YVLA 1ZHFA 2C58A 1B8UA 2QM3A 5CHEA 4LPKA 5KJFA 3OJLA 1BEZA 1BXZA 3G6KA 3UKJA 4JYMA 3IMFA 3VHQA 1YIOA 2OCLA 4D26A 2C5BA 2F43B 1U7PA 3L18A 4MVXA 4JBYA 4L5YA 2XQVA 4MR8B 5AWFC 1M5RA 1TL7C 3IS3A 2D1TA 4GXNA 3LDHA 2EZ4A 3PYMA 2GN9A 5JYDA 1JMYA 3QPUA 1UOEA 2XZPA 3AXSA 3UVEA 2H4FA 3K3PA 5E1MA 1N2JA 1GQ2A 3AUXA 1FFYA 3KL4A 4KAJA 4BJ6A 5JZ9A 4QGGA 3ZKWB 3GARA 5LDHA 2DZDA 4RIHA 1LV8A 3SICE 4MW7A 4RVOA 3HNOA 5A1JA 5CU7A 2VDOB 3GBVA 3U31A 1DEOA 3URKA 4R0MA 1SBZA 4NEHB 4HF7A 3GZTB 3HPRA 1TLTA 4Q4LA 2QTVB 3W6NA 2NADA 5JXWA 1KOFA 5ES3A 3GMIA 4G4SO 1AV6A 1U3UA 2CVOA 3IJPA 5PGMA 3MGBA 3HTXA 1OIXA 1XZCA 2ZRCA 4MQEA 4UDYX 4WMLA 5CGZA 1HFEL 2G5TA 3F7OA 1YHNA 2W70A 1A8HA 7MDHA 3U4MA 2HFKA 3UNXA 2DMRA 2QQEA 4P98A 3ED1A 3C8DA 4ND4A 4WESA 1LK5A 3HCEA 3TINA 1SUIA 1U98A 4UTOA 4DZZA 1XEXA 1A8QA 4JOQA 3WNDA 1WV0A 1JDJA 1JQBA 2Z30A 2CE7A 1G5RA 1V8PA 1QDLB 3IERA 2I3ZA 4JLMA 3KT8A 2DE0X 1FMJA 2QNBA 1OMOA 3GJSA 3DDWA 3NJ4A 4J7AA 4QU8A 4TXNA 2LNDA 3RVDA 4TWBA 3G7UA 4LSMA 2CJXA 2O7SA 2GCEA 3A1FA 3T3EA 3WWZA 3R8XA 2X9VA 3AF5A 4JROA 3SF8A 5FI0B 3UJNA 1SAYA 4YMWA 3EK2A 1LJLA 4XRRA 1S8AA 1KFBB 1M5UA 1TQ4A 1MC1A 1XLUA 2Z83A 4H60A 3FX2A 4DMMA 4DJAA 2XRZA 3BJMA 4CFSA 3B6ZA 2PMBA 4DLUA 4OQZA 3NLLA 3KSRA 4INPA 5EUMA 1J4AA 3HEAA 2HKIA 2XGGA 1XIVA 2O2EA 4LRTB 4MEBA 2XJ9A 5JTTA 4K7JA 2E7ZA 1AKRA 1Z6QA 5J23A 1H2XA 4N39A 1AJEA 1EIWA 5HS6A 3D3JA 1DPGA 1MH9A 3F90A 1EM8A 2YHUA 3PDIA 4IDFA 4J0JA 2Z4RA 2YR0A 4JOSA 1TIKA 5DTMA 2QTVA 3WGJA 1BYUA 1VHLA 3WDSA 3EDOA 1IAQA 3DOHA 1G5PA 5AKYA 3USZA 4EFMA 1E9AA 3LHSA 1CJTC 4PZAA 2QRMA 4TN1A 3R3JA 1Q16A 1A96A 1UK7A 1MORA 2AN3A 3KWJA 5REQA 4RA6B 4C30A 3TPCA 2LIVA 3B6EA 2WKSA 4DHEA 3N8NA 1DIBA 3SI7A 2FR8A 2H2GA 3ABSB 1OXMA 2XODA 8ATCA 5C34B 2ATIA 5H3CA 2FEXA 2XCIA 1SU7A 1PZFA 1UWKA 3O4FA 3LE8A 3I5MA 5EMKA 2GNPA 3SQDA 4G0NA 1Y37A 1M33A 1USIA 4IHJF 4M1OA 2NSDA 2EBUA 3EZLA 3RFVA 3FGNA 4L15A 1XQ9A 3L1UA 2WB2A 1CEXA 3QKRB 3O3OB 1X7XA 5EXSA 4AKEA 2D1FA 1GFZA 1Z8DA 4MUAA 3NWPA 3LLMA 2FOXA 1YFKA 3NANA 4OOFA 4Q24A 5L7TA 2VDUE 4FXOA 4RM2A 1PJZA 4F9TA 1YI0A 5K09A 5I7VA 4UBKA 1S01A 5C51B 2H2AA 2PRJA 2WU3A 1MMFB 4LCJA 3TLCA 5GIPE 2YW2A 3OZWA 3DW1X 2HJWA 4FEAA 4LSGA 1FDOA 4QYSA 1L5KA 2JBAB 2IF0A 5FL7A 4OD0A 3EPKA 2R8YA 4NTZA 4U0KA 1IN1A 1YL5A 2HI0A 4R2WA 1VA4A 2AV6A 3KC2A 2PEZA 3L7CA 2O0HA 2P9TA 3ZUGA 4CM5A 1QRRA 3JQ7A 4UASA 1XPJA 4QG3A 1KYQA 4R8LA 4WGFA 1CUDA 4FS3A 4DUGA 2AFIA 4BGEA 2AKEA 4DV0B 2G3YA 1O5OA 2C07A 3MUOA 3LC2O 1XAJA 3CS3A 3PFFA 5A6SB 1QQBA 1D3AA 2WJWA 4C7MA 4IM7A 3EZYA 3N2GA 1E2IA 1NWCA 1JAZA 5JI3E 2B3TA 13PKA 1RKXA 2C2YA 1XZNA 1WEHA 2I71A 3JQFC 1ONPA 4UCQA 1KE1A 3ZWVA 1U4NA 2DVMA 3TFWA 1H1DA 1NJSA 1PR6A 2KLHA 4J8PA 4HRYA 4LNAA 4ZQIA 1S9DA 2FPSA 4I9NA 4UDOA 3W2FA 4ETIA 1JFLA 4C6RA 1ZA2A 2BFFA 3OEHA 4EGSA 1PNOA 4TKMA 4XYMA 4A9AA 2JS7A 3RVSA 1Z74A 4DMCA 2JCSA 3EB9A 4CUJA 4DUGD 2FJPA 1ENYA 3GX1A 3C5HA 1VCHA 2WHXA 4DLBA 2P67A 4C0AC 2IDMA 1UKAA 4U7FA 4ENTA 3GN2A 2WJHA 1WPXA 4NZPA 2V6BA 3GROA 3LBFA 3MCAA 4YJGA 5LQSA 1DTWA 4XYLA 1V1RB 3GLHE 4YUXA 1CIJA 3P2JA 5BP7A 2XOXA 2CFIA 3FGPA 4OX9B 2PGDA 3DXYA 3LP5A 1LBTA 2FFQA 3R7DA 4U2FA 2J9GA 2VWGA 4QBIA 1KOLA 3EGIA 3QLVC 4HKTA 1ZK0A 4IDDA 3C6XA 3C1UA 3MHTA 3QLVA 4N7BA 3FFWA 3N58A 5IM4A 4I66A 2FQ1A 3A6JA 5ALEA 2FCAA 3CIFA 3VV3A 5JU6A 1OZAA 1FU7A 5F64A 2AGVA 2ZJ4A 3EIXA 4CEIA 5HWSA 1JA0A 4KQ6A 3D4IA 2RMKA 3Q87B 2A2ZA 4JEUA 4EMUA 1RYFA 2P9YA 2C4TA 4OJNA 3TIVA 1C0EA 3IP5A 1OH6A 3DKRA 1KY4A 1QFJA 5JVDA 1AY0A 5LYJF 3F6BX 5IFLA 4EJ0A 2EBFX 4FHCA 1X3LA 3RIHA 2WMYA 3ZUPA 3QEJA 1VJDA 4EJSA 1KYYA 1N3YA 5HMMA 1LTQA 3AIOA 1M1NA 2H07A 2XAUA 1F2DA 1Z4NA 2YWFA 3DEFA 3HEMA 1G20A 3Q88A 4QUIA 4URFA 4B74A 1Q0SA 4AY5A 2AOUA 3UQZA 1SVOA 3NASA 5G4KB 4B7AA 1HUQA 3D1VA 3AINA 4JI1B 3P23A 1IVSA 3RYCB 2C7RA 2CLDX 2Q8QA 3OFND 1JIJA 2QVZX 4YJGB 2QX6A 2RB4A 3MQFA 1NAIA 1S8OA 4R1LA 4RL6A 1N7GA 2HWKA 2V1CC 3G82C 3PICA 5LCXA 1LVUA 1FFEA 4Y9SA 4QQ8A 1VIAA 3W8DA 1QKJA 4F9GA 1EZZA 1XNGA 2D5IA 2K5UA 3MWEB 5TSDA 4F9FA 1Q6YA 2REXB 3MCZA 2EIHA 3IKLA 5BSFA 3T5TA 2FW9A 1EX6A 1UWLA 2BFBA 2ZRHA 3AERB 2BBOA 3LL7A 3LOUA 4U3JB 3SC2B 1Y6GA 3VOTA 3EMVA 1R0XA 2BH9A 4ALIA 3CPJB 4INZA 4DCUA 4WCFB 1N2XA 1E6UA 2PMDA 5DNDA 1PG5A 2EATA 1NW5A 5GONA 1Z28A 3WJ1A 3SG0A 3LXMA 1YZKA 1L7AA 4YJHA 3FSEA 3QUSA 3UWSA 1UP4A 2GTHA 1BZYA 3HRHA 4P34A 3K09A 5TGDA 2BJHA 1DEXA 4ZOEA 6ABPA 3FPFA 4DT1A 5IM5A 1Z4IA 4TLEA 2NPOA 2IELA 4M37A 4N6OA 5HF5A 3N53A 4PFKA 3NBUA 4LJYA 5ILGA 2XB6A 2V45A 2OYCA 5KJCA 5F2EA 2UVDA 1QPBA 4CQLB 5GONF 3VC2A 1XELA 1YUNA 1Q92A 2BHRA 1LA2A 2W6ZA 3KQVA 4J03A 2UUCB 4JC8A 2QSZA 2XEXA 3RJMA 2ZW3A 3FPLA 3V33A 3VNAA 2G25A 2P9CA 2WFLA 3CKMA 3E8SA 5BSEA 2XXBA 4F60A 3ZE1B 2ZSAA 4OGGA 1CLUA 4B4UA 1MQAA 3CLKA 1RPNA 2OSVA 2EFGA 3PWKA 2EYUA 1CQJA 3RGGA 4KIGA 2QZSA 3VGJA 4DA8A 4EB0A 1G55A 3BWDD 1BJRE 1TJPB 1O4VA 1ZEJA 3EAQA 3G6WA 4OXIA 1GTL1 1IJKA 6CHYA 4FHFA 3E7FA 4RD4A 1S89A 1G0OA 5J1TB 2QI9F 1DB3A 1EDOA 3Q5EA 4L95C 3NHKA 2J0QA 4HXYA 1W5AA 3AEZA 4JEIA 5DLQC 1IMJA 1QS0B 1ISIA 3F74A 1SG6A 4OXRA 2FFAA 2I5PO 5EVCA 1I6MA 4BQSA 5REQB 2ZI6A 5CA1F 5K45A 2O3UA 3LTNC 2A5DA 3TZBA 1WETA 4Z0PA 3G8YA 3QF4A 2FU2A 3AVUA 5J2TB 1CJVC 4QPCA 3TEJA 2JHGA 2QLTA 3OLXA 4YV0A 1JXQA 1PWHA 5CIQA 3WHIA 2Z98A 5JJKA 4TVSA 1SK8A 3I6IA 4FR2A 1QONA 4E7OA 2OBNA 4DVGA 1V2GA 1PFQA 3BS4A 4JELA 4BMVA 1WKCA 1B0PA 1W2HA 3RYIA 1PR4A 3I2JA 4PVDA 5TPZA 3NUQA 4KE6A 5KI6A 1HE5A 4DXAA 1Y4UA 3S2ZA 4BAZA 1YDEA 1KY3A 2QG6A 4G0OA 5B1HA 3AEUB 1AK1A 3PQ2A 2D54A 3P0RA 5JLAA 4MQBA 1SC3A 3G9XA 4CV1A 3C1OA 5K8JB 1E89A 4J90A 1ODTC 5GOZA 2VC2B 5CUQA 4DQXA 1VBMA 1UADA 4MWCA 3O7WA 3U3XA 4LHWA 4QVKA 4TMYA 5KTTA 3OQJA 5LB4A 5GIOE 1VL0A 2EIXA 3UUGA 1I4DD 2HAEA 2P69A 3SX4A 4CU2A 5JY6A 3ZDFA 2PXXA 1VYHA 4KYIB 2R5NA 2DBQA 4CGZA 1JJFA 3RT1A 4DR6B 4TTPA 3TGPA 4MMYB 4WPGA 1ORDA 3G59A 3DB1A 1TJ5A 2EFDB 4K9DA 1JE0A 3CT4A 5E4TA 2QG4A 5J5VA 2ZJBA 2IOYA 4KFSA 2WTAA 4X61A 3OBBA 4F06A 1I0LA 2DHEA 1T10A 2FMFA 4LDJA 4QYTA 4URYR 3BFVA 3H5RA 3H86A 1NUQA 1JB1A 1ZH2A 1KZHA 3OD1A 4MB6A 5AUQA 1G42A 3O1HB 2FDCA 2IEAA 2EF1A 3Q8DA 2WD8A 4Z8YA 2NXNA 3L6RA 5GONB 2JHAA 1ZG3A 4Y2TA 2FN3A 3QFTA 3HUTA 1L4FA 2RG7A 1KQGA 3P71T 4R2JA 3B82A 4Q01A 3LVRE 1JEQA 4E32A 1UOQA 5KX5B 4ABTA 1CQZA 1D5WA 5DIFA 4W5TA 1E2JA 2YHIB 4MHTA 5TLSA 3GBPA 2IGTA 2EC5A 4AJPA 3WKEA 1AHPA 1QZXA 5CH3A 1BDBA 5AM4A 5HEKA 5BSRA 1LY1A 1N7IA 3SXPA 2XUJA 3H13A 2Q5JA 4ZYVA 5L3QB 3I8OA 1O0SA 3SK0A 2G1KA 2HYIC 4KTVE 2X5NA 4C1NA 3WGHA 1EUQA 2QLBA 2J5RA 4RTNA 1QIHA 3A9UA 1CZKA 2CFTA 2VDRB 3EHEA 3KUXA 1RCUA 1ZVKA 2DSNA 2YZGA 1Z88A 2HM7A 3D31A 2HK8A 4HV4A 3T3GA 2NZVG 3DF7A 5L51A 2AJCA 5EMLA 3OT4A 5U4QA 4W1PA 2HPHA 4IGFA 2VUHB 2GD6A 1G7TA 5HFAA 1KJIA 3W1EA 1JDTA 5KAPA 2QD5A 3F6SA 4ARBA 3AUJB 2QD3A 4EYGA 1L7OA 4EHAA 5CFMA 3IUSA 2BFNA 5JH7F 2OZEA 4TWAA 2VPPA 1EAYA 3EMBA 1IHOA 2FP4B 3H0KA 4W5OA 1B6SA 1ZW6A 4LVCA 4EG4A 3B2QA 1TQ8A 1Y6RA 3LYAA 3ZDQA 5J2UF 3ZE6A 3PC7A 2OV8A 2P2GA 2Z1NA 3I45A 2XT0A 4P81A 2QR5A 3PS9A 1ZRSA 2NU7B 1NSFA 4ZOLF 5I4BA 3LV8A 5JMTA 1KXZA 2QPTA 4O3MA 3L4EA 3IQHX 3M9XA 2QLLA 3EDQA 4Q4HA 4BRZA 1LQ2A 2B1RA 2OO3A 3EXHC 3OHSX 2E5WA 1O6GA 4A15A 1QCDA 3GFSA 3GLGB 2PLNA 4ZCSA 4R1MA 2F8LA 3KKPA 4ZEOA 3AM4A 3Q5DA 1HZJA 1DQSA 1NG1A 3UJ7A 5TQJA 4G0YA 4UTVA 3ZTWA 4MMXB 4YAKA 3AV3A 1RHRA 1XJ5A 3OPXA 2DLDA 2QAGB 4M87A 3HM9A 2ZT8A 3ZHSA 2A30A 2GNAA 1L8OA 3FLMA 2D0OB 1TF2A 2ZBDA 4P4SA 3R5TA 2G80A 2VNAA 3RVBA 4O4JA 4EAAA 1Z4MA 1D7OA 4GZ5A 2WTBA 1BD4A 1NXWA 1QVAA 3BB4A 1RW4A 3ZIDA 4Z3OA 4JBXA 5EPOA 1D0SA 2HDHA 2QUZA 3A1EA 1S9HA 4DJEC 4ERXA 1PZEA 3C3PA 1XZKA 1OF1A 3TXAA 1YULA 3Q8MA 3W3AD 2P9QA 3H5WA 3ORQA 4ZPJA 4MVCA 3TQCA 5LJLA 3PUHA 4ZQHA 4J1QA 3I5YA 3KFVA 3AF6A 4L08A 4GLJA 3KLNA 2RK3A 4GDMA 4ZT5A 4MP3A 2H57A 5ED4A 3HKEA 4BO4A 2A1TR 5EA2A 1OKKA 3H1AA 4B6QA 5B5SA 1GXSB 1JXOA 1C7QA 2C59A 2JJ1A 2G7ZA 4NATA 2I2XB 3VXKA 4BYGA 2FVYA 1QRAA 2XNJA 3IQGX 2ZBRA 1JKJB 2EZ9A 2ZRIA 3IJEB 4G6ZA 4JT8A 4HS9A 1YVPA 3L7IA 1HETA 2CLFB 5DO9A 2BJWA 2J0UA 2VJDA 3UMFA 4BN0A 3AWIA 1P7WA 1RP1A 3I52A 3DR3A 2W2NA 5A7GA 2WSSA 4LFAB 4Q7JB 3BGDA 1RXCA 3IEXA 1RI5A 5D7NA 2O8EB 5D3MA 1XTZA 2I7TA 3JAWB 3NNSA 4OUDB 3S2GA 3SYLA 3TTWA 3X43A 2D2IA 4ZN6A 2F4VB 4Q9AA 1WPGA 4X1KB 4YRNA 4NMMA 2JJYA 1HC7A 5B55A 3QGMA 4QC2A 1BS2A 4XX0A 3FNFA 3OT5A 1DDOA 4WW0A 4BV3A 3B1ZA 1K08A 1XWFA 3BCUA 1FFBA 221PA 1GPH1 2QI9C 3EY4A 4W6ZA 3PNBA 5G3ZA 3H16A 5F1OA 4CLRB 1K8YB 4WRRA 2OC9A 1Q1ZA 1RAGA 3MT9A 2IYWA 4EO9A 1XT6A 3B6IA 2QRNA 1QGYA 3GZJA 4LBZA 5AI5A 5BWCA 1L7QA 3WIEA 4ND8A 3L1VA 1HNWB 1U8XX 2Q46A 1OTHA 3KB6A 3QVWA 1QYRA 3TI7A 4BAUA 5BV1A 5GVSA 2R6GA 3A9TA 1U8FO 3IAHA 3OE4A 4KVZA 1SHJA 2GWRA 2HT6A 4U63A 3Q98A 2HHJA 3HVIA 3MLAA 3PNMA 4BATA 1EUYA 1QG2A 3HDQA 3D6MA 1U5BB 2AWNA 4OGFA 2VJLA 3DF9A 4NG4A 4G97A 4V0NA 3EQ9A 2RIOA 2FV8A 1CZUA 4W7HA 2QVBA 4A8JA 4IDNA 1VB5A 5DRTA 3HMKA 1KC1A 2WNHA 2C5FA 2Y0PA 3MCUA 4P92A 3G8AA 1RM3A 4QFDA 5H7XA 1TTTA 3BF7A 2WYOA 2YUIA 3GOQA 2BKEA 2NTJA 2IFTA 2RARA 2X2FA 1NQAO 3AV0B 3BTSA 1RAAA 1WPRA 3QVLA 4CEJB 1H8EA 1E3TA 1VE9A 3A6LA 1DEAA 1C7FA 3C45A 4CFZA 3UH1A 3USES 2PSEA 1CY2A 2FDXA 3RADC 1EWQA 1YBFA 5JYEA 3O94A 3CCBA 1X94A 4QUJA 3N2ZB 1FLVA 5M29A 3TSAA 5HUQA 3BEOA 4ZDKA 5AJUA 1U1GA 2XKBA 2AKYA 4O8CA 4EX6A 2HDWA 1OXVA 2ANBA 1THGA 1PV4A 3GLTA 1R0WA 1SBCA 4XI9A 4E13A 1XPOA 3IAS6 3RK1A 1ZXXA 1EWYA 4ENQA 2ZLBA 5BSWA 4HATA 4RAQA 3PR1A 3QFRA 4OMDA 4QEDA 5JNWA 1L2TA 1IC6A 2ZR7A 4MITA 1XK6A 3RYHA 1MDFA 2SCUB 3D6TB 3KOYA 4I4TA 3JVDA 4J3FA 5IDYA 4H17A 2D0IA 2F2TA 1IK4A 2MYTA 4QYWA 3SN6A 1VP3A 4U6RA 2IYTA 2W2MA 4CWAA 5ADUS 3HGQA 2P6MA 3T3PB 1G4UR 3E03A 5J2TF 4AJOA 3N2KA 4BO1A 3WLAA 4D4IA 2GBLC 4WDRA 3GCDA 5HGJA 4EUNA 5K4HA 3GPLA 1MA0A 1AKTA 1HXHA 4LDAA 1ZINA 2UKDA 3DFFA 2KJQA 3FCAA 3IPRA 4K28A 5ALLA 4WDQA 4OBXA 5CDFE 3DWEX 3HJGA 3L6BA 3M6XA 4L6AA 1NRWA 3LYLA 4CKCA 2RGRA 1IZ8A 4FSXA 4RCYA 1KBZA 2BCGY 4RA9A 3W9UA 3MBKA 4A27A 2O19A 1VQ1A 4JQYA 4NBUA 4RKYA 3X1DA 3ABRB 1WCYA 1SKYB 3A0UA 3I2FA 4E2XA 5HFJA 1ZOSA 3KT6A 3M4YA 1RDFA 3BDIA 1MJ5A 2E18A 4FYMA 2OFPA 1W35A 2IJGX 2P90A 4JJ6A 1DEHA 2KBFA 4GX0A 4DXHA 3SQWA 2J45A 3L6OO 3PTZA 4MUMA 1D03A 4TMVA 4UTZA 4PIVA 4S1VA 1XVIA 3EEOA 5M7EA 4PO9A 3TEMA 7ADHA 2YTZA 4KVFA 4DA7A 1EUZA 3MFQA 3DWIA 1O5IA 3RRNA 3W5BA 4MTLA 3ZLTA 2JFUA 2DJ5A 1OKKD 2I3BA 2XDQA 3ROTA 4ALNA 4KNYA 3QPVA 1OAOA 3EFBA 1QDUA 1CUXA 1Z2CA 1HFJA 4PU0A 5BORA 5K4GA 2FZLA 1QC5B 1P9WA 1XP5A 2EKQA 4WZBE 1AB6A 2VP2A 4K87A 3KBOA 4YWHA 4CCYA 4QUKA 2VHZA 4X95A 3TN7A 2ECPA 4Q03A 3T9EA 5I7HA 3VJKA 1UZUA 3R3WA 5DM4A 3N74A 1KR5A 5F5NA 5BVHB 2JGAA 1JG6A 2XYRA 1LC0A 1JEDA 2FSHA 1T2AA 2P9BA 4PPGA 4R6WA 2X0EA 5A4FS 3UWMA 1BKYA 3N5CA 4PICA 4O4IF 1COWD 1TKAA 4EG0A 3ECSA 2QD1A 2CD7A 3DW3X 3D2BA 1JQOA 3HWWA 2OG2A 3BRQA 2QPAA 4N76A 3QQ5A 4ZRNA 1WHSA 1IQPA 5C2JB 3FNIA 3BXGA 3DVLA 5I4KA 1Q0HA 1XVAA 1PNTA 2ZCUA 4UZFA 4UEKA 3C3CA 4C6TB 3HJCA 2R6R1 1W581 1RS0A 5DBFA 1AZTA 2H1FA 5DBEX 4FSHA 3RS7A 3PNOA 2QIOA 1ZKDA 5BNZA 5F3RA 5IM4F 1UIMA 3F8TA 3JRXA 4KBGA 2IIPA 2XR1A 1VE6A 1AGRA 1VI2A 1YVRA 3K8QA 3SVLA 4PYQA 3SCZA 2NT3A 2W4IA 3BK7A 1ODIA 2B4AA 3JQDA 3NCTA 1GNQA 1AA9A 4WE3A 3QZUA 4CR6A 5J4YA 1RQ2A 1OLSA 4E3ZA 2P9ZA 2XNCA 1QP4A 5H4GA 1WSAA 1Z5OA 2FPKA 1Y4ZA 3A7EA 3BWMA 4GBED 4W9NA 3UG6A 5C5DA 2IE8A 2I2FA 1L5QA 2PLWA 4GOXA 4N4AA 3H5NA 3R1IA 3UB4A 3GG2A 1JEYB 4ZRDA 3AFIA 5FADA 1BN7A 1SVWA 2AMYA 3FF1A 5IAKA 3ZOZA 4YJDA 3SM9A 4DG5A 1NTRA 3KV1A 1PZGA 1S1MA 2X22A 3FPBA 3PG5A 1NJ5A 1QZZA 1KI3A 4HYYA 3Q6NA 3DONA 3LY5A 3HP7A 3IE0A 3DZGA 1WMDA 2VAVA 5JH7A 1NQOA 1O54A 3CSDA 1MLDA 3E3AA 3PCTA 2ZSKA 3BWCA 4OSEA 4RVUA 1E2NA 2GKGA 3MBIA 1JILA 5EEGA 1O97C 3IIKA 3TR6A 3DVAB 1USGA 2BT4A 3UB3A 1R37A 2VDWB 4O0MA 4QRIA 3SF8B 2HX1A 3QMWA 2CNDA 4HQKA 4L4SA 4FWIB 2GDZA 5J4HA 1PS0A 2R65A 4M0DA 4QYIB 4UATA 4Z8XA 2ZIFA 3FYCA 2XD9A 2XUPA 3IELA 4RUKA 4ARZB 5GZ3A 4GP7A 4L5IA 1TJ3A 2R6FA 4X7RA 3ZIAA 4RIFA 2DU8A 3FDJA 3I1YA 1RSZA 1SKBA 5EAIA 5LLTA 1KI9A 4AQ7A 1W0CA 3KUUA 4JVLA 1K63A 3WGUA 3D0KA 1QKIA 5FJIA 2AT1A 2Q07A 4B34A 4BP3A 1DQPA 2FN4A 3DDCA 1U0BB 3LX4A 5GJVC 1ETUA 3SBOA 3VO9A 3WGTA 5FUQA 4M53A 5F21A 1R6DA 3DVQX 3C7AA 3L7OA 1X15A 2FR8C 2J0UB 3EWSA 4CM9A 1U7UA 5JFGA 3M6AA 4AKIA 4CN8A 2Y6UA 4ZOBA 2C5GA 5LQNA 3EVGA 3RTDA 2ZTMA 3COZA 3VOAA 1DKQA 4X8MA 4W1SA 1PYOA 3QI7A 2DBYA 1BXGA 3Q6IA 3QLUA 5CIYA 2DTXA 2IYOA 2JJQA 3UHJA 3Q3IA 1CERA 3ZCXA 4H6PA 1KQ3A 4TLDA 3TAXA 3JD3A 1SFRA 1XQVA 2AS0A 4TKUA 4Y1GA 4HDNA 3P27A 1SOVA 2J6CA 3HA3A 2R6AA 5C1OA 3CUSA 1EB8A 2JHCA 3QELB 4DR2B 4EYKA 1A0OA 2XT6A 3K16A 4GL2A 2ZPTX 4DQVA 2Z95A 3R3HA 2BEVA 4RSMA 4ER5A 1Z0FA 3KVNA 5ICMA 3ICVA 1TW2A 1POXA 3AIIA 3NBXX 1YVUA 4LVUA 4KBFA 4G86A 1JVNA 1IQUA 2LBPA 4NQRA 5LZ9A 2C2OA 2QYHA 2V97A 4O2RA 4PSDA 5CHYA 4CQMB 4BVJA 2UYCA 1N6RA 1L3CA 2QVXX 1L7NA 4R1TA 5E3JA 4DLPA 3RTGA 3FDFA 2C5EA 4EHNA 4QXMA 2GM3A 1LSOA 2W6CX 3KZXA 4TRNA 3ZOKA 3F67A 1NUTA 3QI2A 2I7VA 4AUEA 3TJZA 5LBUA 3R75A 1S8FA 3ROEA 1WRBA 3RAFC 2QAGC 1CR0A 2VQFB 5EYPA 2Y93A 1VL6A 2OV6A 4R9RA 3RW9A 1H4SA 1ZGGA 1ISGA 1L7DA 2A58A 2EGUA 2Q7DA 4PWYA 3V80A 1TZMA 5HS4A 2B5OA 1LRKA 3A2LA 1VHDA 4M9UA 3SYNA 4RVHA 4G0UA 3D1LA 1DLIA 2PRSA 3NRBA 3U3OA 2X77A 4BFZA 3NIWA 4I99A 4PRKA 2HZ7A 5SZHB 4JODA 1B7GO 3JCZA 4F5EA 3ZCUA 1GPNA 4RY8A 3NV9A 1CF9A 2FPLA 3KEGA 2P3QA 1O8BA 1V11B 1Z0AA 2QRHA 3AY6A 3KR2A 4Y2QA 4G8BA 2QDKA 4DUZB 3FOZA 1JDUA 1VRWA 5JHHB 3K70C 2V6FA 3BWXA 2SHKA 3FOEC 1PJSA 4LSWA 5JC8A 1UZAA 2C2HA 5DI3B 2ZYHA 5KTNA 4FDMA 2ZBQA 3I0MA 4LJSA 4AFNA 3UXMA 1C5KA 1E4OA 2DGDA 3DL4A 3JQBA 1UBUS 1EE2A 1L4GA 1ZJWA 3WS7A 1SCDA 1T6YA 4MVJD 2I99A 5DVZA 5IYZF 1UINA 1GY8A 3RC1A 2XA1A 3UGJA 4GNKA 3GRKA 3PXCX 1O0CA 5TXGA 1FXSA 2QDXA 2YIJA 3PZRA 4REMA 5KKNB 2D62A 2JLAA 3I53A 4PHFA 1W0KA 3V4SA 3DLAA 4OB6A 1AMUA 5FPYA 4MRSA 5CG1A 3A6KA 5CXQA 5IVPA 1HRDA 2NYRA 3EQ6A 1X70A 3JYHA 1YB5A 4RFVA 1V5IA 1I1NA 2CLKB 2GAFA 4S1PA 3W5IA 2ZU6A 3QPBA 2VZ0A 1MFZA 4MWDA 1HQCA 2VYFA 3AFOA 4OI4A 3B5JA 4PPNA 1QIFA 4CG3A 4F6LA 1BX1A 1M2NA 3MTJA 4RCVA 2CKMA 2QVCA 1OV4A 2GILA 2WUEA 3I04A 4H7EA 1ZVJA 4A91A 1EK6A 5CK5A 4BRSA 4MRNA 3DXZA 2WINI 3A3PA 4D0NA 1TQ2A 1T6NA 4M0PA 4EHKA 4KRYA 5ITZB 5DXJA 2DQZA 2BELA 2LDXA 4NYIR 4CHTA 1KIAA 2WMOB 3B1KA 3VISA 4CM1A 1CLEA 2W90A 2QUJA 2WILA 3ND6A 1QJ4A 5IJZA 4B17A 4NS1A 2FGJA 1EB9A 5DYWA 1VFPA 3B12A 3NBMA 1CZHA 1T5DX 2ZYRA 3MMXA 1HG1A 2ID8A 1MB4A 2ODNA 3OOWA 4TSFD 2H7XA 1GKIA 1KRHA 5EPUA 4PQYA 1YGPA 3AT1A 1MQ8B 5F76A 3ZK7A 5BT8A 5IULC 4QUGA 2Q6IA 2FEMA 1IOWA 1J20A 3LGAA 2Y1CA 1NA5A 3RV3A 3STXA 4DA6A 2RE8A 3ZJTA 1U04A 3QEMB 3U9LA 4EWLA 1ECGA 1QO7A 2I65A 4QVGA 1EP1B 5J2UB 1T1JA 3FKSD 1J8FA 4L8GA 3DV0A 4BFYA 3EA5A 1SUDA 3ANYB 3MRXA 3W2TA 4BGVA 4F38A 2GB4A 1LLQA 2NYUA 2G67A 1V1RA 3FW1A 3PF9A 1JIKA 4LOJA 7AT1A 4I5FA 1F7VA 4ZOQI 2Q9BA 1IWOA 5B1DA 3DLCA 3OICA 3UMRA 1TKRA 4KAFA 4NR0A 4XSGA 3MS4A 1UJ6A 1FRVA 1UMDA 3NRJA 4TSFA 3STHA 1JVSA 2XTQA 2VHXA 2HA4A 2J7PD 4DKXA 1BWPA 1UJ4A 4ZT4A 1IN4A 2R1TA 2QL9A 3CO5A 3QQPA 4HDKA 3DXFA 4HLUA 3KJIA 4JJ8A 5KSYA 1F06A 3PA8A 3O2JA 3WL6A 1F9EA 1HDOA 1ESDA 4NPCA 4OXXA 2OV4A 4JKYA 4BMSA 3E9DA 3OE1A 1M2KA 2AA3A 4Q9NA 4OO3A 4X41A 5CDFA 2I4IA 3JVEA 4HMPA 2FZEA 1ODFA 3WDMA 1C3OA 1B6RA 1Z2EA 2ESRA 2ISSD 4KXLA 2ZRLA 4Q18A 1UKVY 2Q4RA 3EXIB 4BFLA 3NIGB 4DA9A 4F3RA 3IT2A 5BSTA 4CTMA 1L4EA 3AF4A 3L04A 2PD3A 4Y0NA 3DO8A 5BYAA 4PGMA 3MRTA 3WGVA 3UH0A 3KQOA 4KV9A 1N8SA 1Y5NA 3HB1A 4IGKA 3HR8A 3AY7A 1XF1A 1WU8A 2IYZA 1D4ZA 4OQDA 4E1BA 4E4RA 3AU9A 2VJBA 3OQVA 2CUZA 5DLYA 3IAS1 2O3TA 3RJZA 1SN7A 4YONB 2HQOA 1RPJA 2OBYA 3QPAA 2YFBA 4BLTA 1EVQA 3PNKA 3S68A 5IJ9B 2FRXA 4C76A 3C15C 4V0ME 1QHEA 2VHUA 1SM4A 1D2NA 3K9BA 5DBGA 4K9LA 4I8IA 1Q20A 2G04A 1CUAA 2AR9A 3FZQA 1GA6A 2ZIWB 3H4TA 4XX0B 3ZCVA 1GIAA 4Y2VA 2VXBA 3VMMA 4NG5A 5E2BA 4P0PB 2FHSA 1AQUA 1YR6A 3M6IA 3FIJA 5TGZA 2PX5A 4TKVA 3GRUA 2BGMA 4I8XA 1U5AA 1QK3A 1UFQA 2WVAA 4OSOA 2FUCA 1K7CA 3KQKA 1Q74A 3TRIA 4HPJB 1NJFA 3KJZA 5L45A 1A82A 4N49A 5K0CA 5TEWA 3HKCB 1AH2A 1DX6A 1KF0A 1MP0A 4KAAA 3C5CA 3AHDA 3T9AA 4LDQA 3D8BA 2AJDA 1PZXA 4FMCF 3I34X 5P21A 5FUMA 3JS5A 2BUBA 2CMDA 3HKBB 2ZZMA 1RI4A 3HJNA 5BRNA 3GP5A 4YQFA 5JS1A 2XUGA 3JWIA 4JP3A 1NPYA 2FSVC 2IPLA 4CM7A 3F98A 2VDQB 2BI4A 4K46A 3STYA 4GOOD 2BDUA 1GQRA 2I6FA 4IEEA 5HVNA 1P1IA 4JLNA 1HSZA 1A5BB 5WRFA 5JZVA 1A9XA 2EP8A 3F7TA 3DYBA 3WWEA 3E4DA 4K6GA 1OZ0A 2WPNA 1DFHA 1P1KA 2V7BA 2A4KA 4QGFA 4QYIA 4EY3A 4KWTA 4AS2A 5CLLA 3MB8A 1TOAA 1Z35A 1UFOA 1Q11A 3ZGOA 2CVQA 2WD9A 2YX1A 5AXBA 2UZ4A 4WBNA 1BMTA 3O7MA 4MV9A 2XA9A 4B6GA 3VZCA 2M6RA 4ALJA 4JJGA 2PKCA 4ZHSA 5A3JA 1FUYB 1WTAA 2HMSA 2O1XA 3L02A 4GMKA 4H77A 1E1QD 1YK1A 3QBDA 4KXVA 3LIPA 4M86A 3TRDA 3KYJB 3VJMA 3THWA 3OQIA 1LK0A 4WXHA 4HH4A 1XQYA 4G2NA 5ICFA 3WFZA 1ZOLA 2WPDD 3KX2A 4HTFB 3GNLA 4N12A 3V4LA 1ADGA 1RHUA 1C1YA 4FI3C 2F59A 1Y6ZA 1P81A 3LQFA 3ZTTA 1P91A 3U44B 4GP9A 1QCYA 4AZTA 1UXOA 4HFVA 4QDOA 2OEPA 4YJ3A 1JEYA 1PFWA 1GG8A 3ID6C 4MR7B 2XNKA 3ONFA 7ABPA 3LAWA 1NQWA 3DL2A 1AOXA 4OHUA 1L1FA 1BXGB 3J81k 1U0NA 2QSUA 4JNKA 2BONA 1QYIA 3PD7A 2A5GA 1X7ZA 4NQZA 1IUOA 3KQSA 5JASA 1Q7CA 4H31A 1G9TA 3EEBA 3W0LB 1JXAA 2C78A 1ZYUA 4HT3B 4MRAA 1JA9A 5JAHA 2AYXA 1RI1A 3L2OB 5EIAA 5LMCA 1W7AA 4HGOA 1E58A 2JIRA 4JLUA 4DL9A 4DLKA 1YQXA 1KSFX 2W2PA 3CZQA 4JP8A 4ZRMA 3THXB 1N5LA 5D3ZA 2PX8A 2G06A 4FFMA 1ZD1A 2ZUDA 2C7GA 3D5TA 4MGHA 2HT1A 2CXNA 3R24A 3D2CA 1NATA 5E7MA 3V48A 3VUEA 2VQ6A 4KFCA 3U3JA 4X00A 1XXLA 4M8LA 4B3DA 2E4WA 4P8RA 4TL8A 5KNCD 5JNTA 3W8NA 2WKQA 1M2EA 2Q5QA 2JJ2D 3I8SA 3R7BA 2X9GA 1CQJB 4E30A 4LC1A 4FFNA 1XA3A 5EMHA 4CBVA 5DW3A 3HXPA 1SBTA 3SHQA 1RMQA 2H9IA 3FBVA 1YBVA 2DWQA 2UYYA 4OSPA 3ZNQA 1DAOA 3WA6A 3BJRA 5F73A 3PHCA 4BJ1A 3O2QB 3LCMA 1Z4QA 2PGLA 4L02A 4XTCS 4FDTA 3VR6A 2G4LA 1KAEA 4GXRA 1Y8QA 1UC8A 4N8DA 4F0JA 1YOBA 4J0IA 3GFVA 4FC7A 3RSZA 1ACJA 4MW4A 3CF6R 5K3DA 3N2GB 3U16A 4YFYA 2DYKA 2HWXA 3ENNA 5LP6A 4XIGS 4GHWA 4DV7B 3FMFA 2QE6A 1IXSB 1OFHA 1YE8A 4WKNA 1W25A 4G67A 1GU0A 1SURA 5LLDA 1YQQA 4N3NA 4KFUA 5T3YA 4RW0A 3WYDA 3IBSA 1N34B 1KDPA 4Q9VA 1O2DA 3GFGA 2CL0X 2IYXA 1L7BA 1L3IA 2WU8A 1D6SA 1EVKA 4DBLC 4JJZA 5IEJA 4W1QA 3D6HA 3PYLA 4YS6A 1A4XA 1OR8A 1KFJB 2NTVA 3D7NA 3FMGA 4D3FA 5KDDA 3JALA 1F8XA 4G65A 4I2NA 3EUAA 3LC0A 4I19A 1U6KA 4X1IB 1WDWB 3W7AA