3FVVA

The crystal structure of the protein with unknown function from bordetella pertussis tohama i
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
223
structure length
223
Chain Sequence
TTRRLALFDLDHTLLPLDSDYQWADFLARTGRAGDPAEARRRNDDLMERYNRGELTAEQAAEFMLGLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARAFGVQHLIATDPEYRDGRYTGRIEGTPSFREGKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQARGWQVIDLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein with unknown function from Bordetella pertussis Tohama I
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 79
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12710 HAD haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1440.100 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) SG protein - dephosphorylation function 3fvvA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3fvvA01
2W43A 4UMDA 4G9BA 5AVWA 1RLOA 1XP5A 3E8MA 3NIWA 3FGOA 2FUEA 3L0BA 4OCZA 4Y2RA 5ALOA 1EK1A 4BX3A 2GFHA 4J2TA 2HI0A 3NALA 1J8DA 3EPRA 4HGRA 4BX0A 2B1RA 5AW0A 2YJ3A 1T5TA 1T9ZA 2C8LA 4L6AA 5JJBA 3ESRA 4EX7A 5ALVA 4YCLA 3QU5A 2WF7A 1ZD4A 4L6CA 4YCNA 3CZ4A 3L1VA 5AW3A 1NF2A 5ALPA 2Q5EA 4BEVA 3D6JA 1N8NA 4FE3A 5AW5A 1U2TA 2I6XA 4I9FA 3U7FB 1RMQA 4H1WA 1PW5A 3SF0A 3IJ5A 2G09A 1SWWA 2B82A 2NYVA 1QYIA 4MWOA 3WKAA 4YIKA 1L7MA 5AW4A 3ET4A 3QGMA 2EATA 2ZOSA 3U7EB 5AK6A 4B6JA 3R4CA 3R9KA 4CF3A 1QQ7A 1T5SA 3QU4A 5AKHA 4ZEVA 4CNQA 1YV9A 2Q4TA 5AKZA 4QJBA 3I76A 3NUQA 3PGVA 2GHTA 3UM9A 4ZEXA 3M9LA 3W5CA 5AVSA 5AVVA 4Y2YA 3P96A 4OFZA 3N07A 5A3SA 1L8LA 4XOUA 4F71A 4FYPA 2R8YA 3QXGA 4UMVA 4UU0A 4Y2SA 3N5KA 1Z5UA 3A1CA 1Z4LA 4UASA 3OCWA 1RC8A 2EAUA 5AI9A 3ZW7A 3N1UA 1Z4KA 3I6BA 4Y2QA 2YJ6A 4Y2TA 3SLRA 4HAIA 3WK4A 2WM8A 4NV0A 4QQFA 3L0CA 2JAWA 5ALQA 1WPGA 4AP9A 3SKYA 3WKEA 1L7OA 5AM5A 2IA5A 1NNLA 5AICA 1U7OA 2AH5A 1QQ5A 3E58A 5ALZA 2P27A 4UM5A 3RFUA 5AKIA 1NRWA 1Q91A 1Z4PX 3MC1A 1YJ5A 3QU2A 5ALUA 1MH9A 2I55A 3KDPA 5ALHA 1S2OA 1SWVA 4E88A 1Z4QA 3R09A 2ZBEA 2FDRA 3PCTA 3DDHA 2W11A 4EZEA 1FEZA 5AKKA 4Y2UA 5AKGA 1LVHA 4O8CA 3ZUPA 2VKQA 4KX5A 3L5KA 2WHEA 4HGNA 1WVIA 4JDPA 3K1ZA 2HSZA 2GMWA 2YMQA 1KYTA 4GXTA 2BDUA 3FPBA 1RMYA 3QYPA 3UMGA 1XPJA 2FPXA 4NABA 4UMFA 2HF2A 5AK3A 2ZBFA 3EF1A 2RARA 5AI8A 2B8EA 2C9MA 3IB6A 2IOFK 3ZU6A 2B1QA 4EEKA 3IRUA 2QYHA 5T41A 1EK2A 5ALEA 3MMZA 2D2VA 5AHXA 1RPZA 2YN4A 2C88A 1L7NA 1ZD2P 4Y2JA 4NWIA 3AR3A 5AKLA 3ZX4A 1O03A 1TJ3A 3AR9A 3DAOA 4UARA 3VAYA 2C4NA 1SU4A 1Z4IA 1L8OA 2R8EA 4NFLA 3I28A 2AGVA 1Z5GA 1RLTA 2YJ5A 3NAMA 1TE2A 4KNWA 3WK6A 2P69A 3ZVLA 3L7YA 1L7PA 4JB3A 2YFYA 4OD0A 4DCCA 3ZX5A 2WF9A 2CFTA 5ALNA 2RB5A 4BYGA 1RLMA 2OBBA 4XPZA 3SHQA 5A3QA 4BNDB 3B9BA 2FEAA 4UU1A 3DNPA 2G08A 5AI5A 4EENA 4L57A 3OCXA 1YNSA 2MU1A 1Z4MA 3KOOA 4UMEA 5A3RA 5ALMA 5AW6A 2NO5A 5ALJA 3EF0A 3NRJA 3U13A 3OTQA 4FFDA 2PR7A 1IWOA 2FI1A 1VFPA 2QLTA 2WF5A 4UAVA 3ZVNA 5AM0A 3ZI4A 3WK8A 3AR6A 3UMBA 2P9JA 3A1DA 2IYEA 3M1YA 3AR5A 3OCUA 2CFRA 1TA0A 4CF5A 5ALTA 3A3YA 2HEGA 4XQ0A 5E0OA 3SMVA 3I1YA 5AVXA 1QQ6A 5AI6A 4HGQA 4UW9A 1YDFA 4MUMA 2FPRA 3QUCA 1VJRA 4XE5A 3WK5A 4UATA 2IOFA 2HCFA 2WF6A 3KBBA 5ALSA 3U7GA 4IFTA 1Z88A 1Z4JA 3QU7A 2CN1A 3CNHA 5ALYA 2EARA 3WKBA 2G06A 4OHFA 5AM3A 1TJ5A 3B8EA 3L1UA 3SD7A 1ZRMA 5ALXA 3HYCA 3ONNA 5AIAA 3FZQA 3ET5A 4Y2PA 2W4MA 2OYCA 4UM7A 2ZG6A 3OCYA 3OPXA 3QX7A 5AVTA 5AW1A 2WF8A 4F72A 3UMCA 3W5AA 5AKJA 4AS2A 4BBJA 1RKQA 1N9KA 4GIBA 2FPUA 2HF7A 3U19A 2ZXEA 5AI0A 4YIHA 4NAVA 4C4RA 3WGUA 1K1EA 1ZOLA 1QH9A 4Y2VA 4ZEWA 3FM9A 3J7TA 1RMTA 1U7PA 2AUTA 1RQNA 3PGLA 5AW7A 1RQLA 3F9RA 4AS3A 1YMQA 2OA0A 4BKMA 2Q4RA 2JAOA 4YH1A 3MPOA 1WZCA 5AM2A 3AR8A 4EELA 5ALDA 5IT4A 2MSNA 2HO4A 3NANA 2G07A 4YGYA 4KX3A 3ED5A 3W5BA 5AVRA 1L6RA 2I34A 2WFAA 2RBKA 4HYTA 4KN8A 3AR4A 2JARA 3L8GA 2G0AA 2JGAA 5IT0A 2GO7A 3OCZA 5IS2A 1JUDA 3ZWKA 3WK7A 1XVIA 2YMMA 2PKEA 3L0YA 1ZD5A 1Z4NA 3W5DA 3PDWA 1RKVA 2RAVA 3BA6A 3QUQA 3AR2A 3GYGA 5AIBA 2G80A 3ZTWA 3AR7A 3HLTA 5AVUA 3E84A 5AESA 1J97A 2P11A 2G1AA 4RETA 3U26A 1U2SA 2X4DA 1VJ5A 4UAUA 3ZWDA 1LTQA 3S6JA 2C8KA 3KD3A 3ZVMA 5ALIA 2FPSA 3SKXA 4J03A 3KZXA 2HDOA 2I33A 1CQZA 2O2XA 3ZTYA 3OCVA 1ZRNA 3L8HA 2NO4A 4C4TA 1RDFA 2DQSA 4Y3UA 4CE6A 2YY6A 4PNHA 4HGPA 3WK9A 1S8OA 4CF4A 1U02A 2YMLA 4KNVA 3MN1A 4BNDA 3QUBA 4IG4A 3QLEA 5AM4A 5ALFA 3WKDA 1ZS9A 4HGOA 2ZBGA 2YBDA 4YCMA 5AI4A 5AK4A 2JAUA 3L8EA 5AKEA 2OM6A 2R8ZA 3KC2A 5AK5A 5AM1A 3RF6A 2PQ0A 3L8FA 4C4SA 4G63A 5ALKA 1X42A 5AKYA 1Q92A 4I9GA 5ALGA 5AKXA 2AMYA 1Z4OA 2HHLA 2HOQA 2GHQA 2O9JA 3QNMA 1RKUA 2I7DA 2B0CA 4Y2XA 1WR8A 3WGVA 5ALRA 1F5SA 3QUTA 2CFSA 3U7HB 2FPWA 2YMPA 3EWIA 3N28A 5AW8A 5AVYA 5AW2A 1AQ6A 1YS9A 2I54A 1Y8AA 4BEWA 4EX6A 2ZBDA 2IOHA 4RESA 2FUCA 5AW9A 4KYTA 2B8JA 4BX2A 1O08A 2HX1A 3QU9A 5ALWA 3A1EA 1TJ4A 5AVQA 1ZJJA 1ZD3A 2BDEA 3DV9A 3B9RA 1CR6A 3ESQA 2ODAA 3E81A 2R8XA 5FP0A 5AVZA 2YJ4A 3NASA 1RRCA 3TLMA 3N8GA 4DW8A 5ALLA 3FPSA 4DWOA 4DFDA 2B30A 3BWVA 2BY4A 3FVVA 3WKCA
chains in the Genus database with same CATH superfamily
3ITKA 4BNNA 3KT0A 3JYPA 1CHDA 5TQ2A 3E8MA 3RTDA 5DXJA 3R3UA 4EG5A 2BEUA 1U8CB 1M2VA 1T4BA 3GPCA 3SSOA 3AP3A 3Q8MA 1OF1A 4KN5A 1QNLA 1XZBA 4YCAA 4BX3A 3JD0A 4UOZA 2WPDA 4GOJA 1KP3A 2OXFA 1E7SA 1T5OA 1YQEA 4HGRA 3JTMA 3U48A 4DSNA 4JI8B 2B1RA 2WLSA 3G2JA 1NFRA 5C8VA 3LJ1A 2JLBA 4O33A 4YCDA 3GLUA 4CEHA 1T9ZA 4KIUA 5TY0A 2HMSA 4M83A 3CB2A 4M1YA 4PGMA 3EFOA 2XIJA 4K9QA 1B2LA 4L07A 1I0LA 4ALIA 2CZCA 5I4CA 5TVKA 2A88A 5IBCA 1E92A 2NZWA 4BEJA 4N9QA 3RYHB 3GOHA 1ZH0A 4ND1A 1OX6A 5C8XA 4DYDA 3LT0A 4KO2S 1RWKA 2XF8A 4BMSA 4Y1RA 5KOHA 1LSSA 1YKFA 3E70C 1UIRA 1N2SA 1BROA 3ICCA 2W2KA 1YRWA 4LJ5A 1OZAA 1GQYA 2Z8YA 1NRIA 4OL9A 3PX2A 2Z5LA 4U00A 5DHQA 1WXIA 3EK2A 1VL5A 3G6KA 3L41A 4I08A 1KH3A 5ECWA 4BVBA 1P2VA 3DDCA 4DA9A 4UNSA 1Z8HA 4FN5A 4YMHA 2FLKA 4CQLA 4E14A 4N6NA 1E1MA 2XTQA 4HWPA 4BV2A 5LXTB 3QVTA 4DKJA 2OMKA 4DDHA 5IVIA 1RM0A 1E6MA 1TW3A 2H7XA 4IKPA 3BXFA 3QG5A 4L3VA 2VNHA 2FWBA 4MB0A 1HQKA 1R6TA 3A05A 3QVGA 4WBSA 3VSEA 1CR2A 2OXIA 4QBKA 5I3CA 4F2DA 1QJCA 2ZOSA 1OASA 1PFVA 1RAAA 2VQ3A 4MP6A 1LF5A 5L7WA 1G8MA 1N6RA 2YFHA 3EXHA 4LXUA 4ZO6A 4ESOA 4P3OA 2XB2A 1BGVA 1J0BA 1JXMA 5FBWB 2A7QA 2IZZA 4S1VA 4JU8A 4KE8A 4MX8A 5IDWA 2OXEA 3B2QA 1V37A 4U2DA 4Q01A 1T9HA 1UQRA 2OSVA 3SBOA 4DEXA 2PMWB 3UUWA 3UM9A 2C0CA 4BHTA 3T7CA 4Q6BA 3S2UA 1Y5LA 4B3CA 1QGUA 2PGNA 4ENVA 1ISFA 2VF5X 4FX2A 5G3YA 1ZMXA 1G2OA 3QXSA 4FJ1A 3Q10A 2C77A 4QELA 2WV7A 1C9JA 4UJ3A 3QVWA 4U9UA 3RUEA 4BLSA 3EDQA 4PZAA 4XOUA 3K5PA 4PYQA 3Q7RA 3TCXB 4KR7A 1GZUA 1I3OA 5FBQB 5T64A 1VCIA 1KYZA 4Y98A 4F3NA 1J7KA 1H1LA 1U6IA 3ITEA 4JUCA 4MOWA 3V80A 3VZRA 2XJ9A 4G8BA 4C3VA 1A4RA 4BC1A 2J0EA 2R6JA 4IF6A 2F4NA 3LAWA 3EVBA 3SIRA 3GHHA 3NORA 2HRBA 4TSFD 3LBYA 4LQLA 4W5RA 4X63A 2NUPB 4TRJA 1BYUA 2V7QD 4WBNF 4X9XA 1CUUA 5CLHA 2DQZA 4QGAA 1NLFA 1Z6XA 3GYBA 3U40A 2Q07A 1E3WA 1VSVA 1V2GA 3RVLA 3SJZA 4MWSA 2COUA 1GTL1 2ZPTX 4GGPA 4FCVA 4YDRA 2W2MA 4HBZA 4P84A 1ZH8A 1D2RA 3GB9A 4ZYLA 1F51E 3E58A 2HLHA 3IBSA 4LBWA 2O52A 3JWJA 2EGGA 3EZ7A 4M53A 3T3PB 3CSUA 4AG5A 2XNKA 3IPCA 1XCOA 5IK2A 4C4PA 1M67A 2JGJA 3DVLA 1IY1A 3LCUA 2WIGA 2G7MC 3NW9A 4E30A 2A0FA 1QCDA 5A7FA 2E9SA 4B6PA 1WU7A 1ZD1A 2XA1A 2O4UX 3ECSA 4FXOA 3WNQA 1KI7A 3C0KA 4Q05A 5KCMA 2RK4A 5EUCA 3CKKA 2BE7A 3KU1A 3BE8A 1SXJB 4KWEA 4QBIA 5IF9A 4Y2UA 2FAXA 3ECCA 3L7MA 4EHHA 3I62A 5AKGA 3I9OA 3ZZTA 3U1TA 1FP7A 2AFVA 4GLLA 4WOBA 4QBGB 2ZW9A 4EPWA 2ZREA 3ZDRA 4BJ1A 1X1DA 3D8RA 2C2OA 2VZ8A 2ZRQA 4A8JB 1L3CA 4DXHA 1NJ2A 3ZDFA 1XZAA 1F14A 5JHHB 3FCEA 1VHJA 3I8OA 3IURA 3L6RA 4UBKA 4AJ4A 2PXHA 4RVHA 2W2VA 4X45A 2AFIE 2B1IA 3DMPA 1PWYE 4GI3A 4N3AA 4XIIA 3T3HA 3UT6A 3JYHA 1T0PA 3L6CA 4HQFA 1U7UA 3RUCA 1DJOA 2V96A 1H3EA 1E7MA 1EWTA 1IULA 4R8VA 4LZLA 3UOGA 5AT1A 4DRXA 4MLDA 4WDQA 2RKOA 3Q12A 5TR9A 3BFKA 1R9MA 1BU8A 4RKWA 3MBKA 5HIMA 1T8TA 5DWVA 4YI3A 1AF7A 3RC1A 2O5RA 1C7FA 2WFLB 1I1NA 4NENB 3EYAA 1C7IA 2BEJA 4D5GA 1Z8DA 2UYYA 2RDMA 1GNRA 4B3JA 1Y8QA 2OE2A 2XW6A 3I6IA 5T41A 1YR7A 3QWHA 3CU5A 4PLVA 3CT6A 1R0WA 2KE5A 4JXJA 3R5TA 5FL7D 2JFXA 1RBMA 2QLMA 5JI3E 5LQNA 2YDYA 1AG9A 4FFNA 4BJ6A 5B58C 1RYZA 2WEKA 2YN4A 2YWFA 4FZRA 4GM0A 2EW8A 4R51A 4EVQA 5LP6A 4B2YA 3IXLA 1TJ3A 1I0ZA 4YAFA 3WHIA 1UPUA 1MAVA 1NJ1A 1ODSA 2CVZA 4X20A 5AOVA 4RPKA 4OATA 1YHZA 2F2TA 4NDAA 1DTEA 2XDQA 3TUJC 4W1SA 3ILSA 4E08A 1M7BA 3HP1A 3PHJA 2F66B 4FKMA 3DYBA 2QSZA 3ULKA 2QXUA 2EGHA 3P2MA 1XQWA 3TGWA 3WHLA 1VL6A 1FNSA 1VKRA 4PLPA 2C59A 4ZT3A 3VISA 4O1HA 4AF6A 4FZVA 1VM6A 2W48A 5HFAA 1UR5A 1W36C 1OZ0A 2W58A 3CN7A 4K2AA 1E3MA 3TLGB 2M9MA 2HJVA 3T61A 3KLNA 2HU5A 3FKQA 4OQQA 1D6SA 2WFZA 3JCZA 4GP6A 5CLIA 3H84A 1YS2X 3UXYA 4BYGA 2XNDA 3O0DA 1J2YA 3L5OA 1JLLB 4LXTA 1V5FA 1SCIA 4BFLA 1Q2UA 3QBDA 2FOIA 2XSZA 2TYSB 3WV5A 1U5KA 4WXMA 4BNDB 3ZCSA 4R9UC 3TAHA 2CYCA 1F8FA 3NDRA 4EENA 5BSMA 4K0KB 2IVZA 4IHAA 2ZCUA 4AQYB 4Q4JA 2ZYIA 3A27A 4GU5A 4UMEA 1IEWA 3X43A 4G76A 4PICA 1D9XA 2FCRA 2ZTMA 1HYHA 3A6ZA 5JAMA 5K0ZA 3O4HA 3QG1A 3HU1A 1VYUA 5F98A 3E53A 5E7MA 4BVJA 3PE6A 1H2YA 5IWCA 3IOEA 2JIZA 4IDCA 1CDDA 1OYWA 1GVNB 2EFDB 3L7AA 4E22A 3LV8A 1JR4A 2GWHA 2A5DA 4FK8A 4QARA 4X85A 1TM7E 5JJKA 5I9IA 3ZI4A 1GFZA 1TYZA 4DSTA 2XUDA 4AZ3A 1SZJG 2J3MA 2KSQA 3H19A 4L85A 5BSKA 4IUYA 2GBGA 4WKBA 2H59A 5A3VA 1PUIA 1TTTA 3DR3A 1PT5A 3GLKA 4HSEA 4WHMA 3VMMA 3D1VA 4JEIA 2C2WA 2WE7A 3LYAA 2AHOA 3H7IA 5MDHA 2FPRA 1RAIA 4CTMA 2XUPA 3F7TA 1IBLB 1LA2A 3UKJA 5E1DA 5HILA 3ZHRA 3CTMA 5IYZF 1OE0A 1ZA1A 4AXBA 4C89A 1FCJA 1FDTA 5HEKA 5I45A 3WIUA 4C7BA 4RIGA 1O8BA 4BCDA 4FONA 5E4JA 5GTDA 2DEUA 4MA5A 4ROTA 1ZJWA 1H9CA 4B3MB 3CNHA 3NQ41 3IHKA 4RTSA 3DTNA 5KO2A 4MZXA 1M7GA 5HIIA 1U28A 2A5LA 1NPDA 2IW3A 3PF8A 2DFNA 2QRKA 3WGNA 3T1QA 1TZ2A 2C82A 2VBCA 1IIRA 1I01A 2QRVB 4O4IB 1X2BA 4HRVA 4REQA 4V2UA 4ZQIA 3IB3A 3AM1A 1ZX1A 3ZYZA 1NVXQ 1XGKA 3QX8A 1XDUA 4OYRA 3SEFA 3WNZA 4BU0A 1KVUA 3UJBA 3WMGA 2E18A 2XAAA 4FD2A 5T7BA 2ACEA 3AEQA 2SBTA 3TEMA 2PRKA 3RTEA 5F3RA 2WF8A 2I4MA 5EKSA 2BFAA 5CA0A 4ZYVA 5CNIA 1I6KA 3VPBA 2RH5A 4TMVA 3UPDA 1KMCA 2BGRA 2XB8A 3MLEA 4UCFA 4PO8A 1Y6QA 3NTVA 4MGZR 3S81A 2GUGA 1KARA 3A6GA 4X6UA 2D0PB 2AN4A 3EY9A 3M4YA 4NJMA 2QP4A 3DKIA 1KJ9A 3J7TA 1LRKA 1HL3A 3EVFA 4G0MA 5C80A 3JQBC 3QOYA 3H0KA 4K5QA 4TKZA 2CZGA 3CSSA 3UTCA 1ESDA 4QICA 1UZLA 1G4HA 3H5NA 4Z2YA 4EG3A 2KHZA 2K7FA 2OAQ1 3CX6A 3F67A 4GGMX 3L6DA 1V0JA 2G04A 4MUHA 5IJ9A 2QVYX 5CXSA 3JWGA 3QFFA 1CQIB 5I7AA 1WZCA 1JQAA 3F5FA 1AY0A 4OSEA 5H3HA 5I7VA 3OZ7A 3REGA 3C16C 4NY1A 4ODIA 3NANA 2QL7A 3OJLA 2PE5A 1JBEA 1H4QA 2JJYA 2GZ3A 4C3ZA 2NSLA 3CLTC 4H18A 3I2IA 2ZWIA 4FNGA 4G09A 2DUNA 1ATZA 5E3HA 4LYFA 2OVBA 2PK3A 5JMTA 3A4MA 5L7TA 4XYMA 1CZKA 5DCUA 3BRQA 3M2TA 3H1PA 5EE9A 4UPVA 3QITA 5EWLB 1P7ZA 3CXUA 5FR2A 5GP1A 5IT0A 1EFRA 1CQJA 1EZ1A 3DOCA 1FF9A 1D4ZA 2QTZA 3DEAA 3ANTA 1A96A 3OJWA 3T7KA 2YHUA 3VZBA 4OAUC 2BFEB 1ZD5A 2F3SA 2OZLA 1OI7A 1LF0A 4E2XA 2INGX 2V45A 1EFUA 1P4HA 1RW4A 5AIBA 5I7OA 4KXMA 2XVMA 4NJEA 3AKCA 3LLCA 4Q9DA 1T4DA 4K9SA 3FLMA 1V8PA 3ACCA 5FI5A 3UMVA 3TDMA 3VXKA 4KR2A 1BXZA 3DE0X 3H3FA 4M38A 2O1WA 3AQIA 2QMHA 2RG7A 4G01B 4NARA 4ZQGA 5JTTA 3MCZA 5JZMA 4D4MA 1NXXA 1CRQA 3AIMA 4H6WA 1IBRA 3ABSB 4B71A 4E7OA 2O54A 1L7XA 3KD3A 2YWRA 1I6LA 1VZ2A 2GA8A 1FX0A 3SXUB 3IEVA 1D7AA 4RKYA 3CEJA 5JBIA 5L6MB 2EDCA 2HDOA 2AQHA 1GGMA 4ZC1A 3RRBA 4RD3A 3H97A 2HDWA 2AB0A 2FDXA 3RD5A 3JZMA 5E1MA 1AD2A 4L0CA 1XVVA 4I6EA 1OVGA 2YY6A 4GKBA 5EXDA 2PO5A 2B94A 3Q2OA 1NVBA 4IHJF 3A6DA 3AH8A 3HXMA 1EB9A 2X9QA 4KNVA 3DLIA 3RVJA 3K1JA 2IPXA 1XRLA 1Z0IA 2J3DA 3BXOA 3GFQA 3S1AA 4F4IA 1XKTA 3OH8A 3QOXA 2O7RA 3D7LA 1W35A 5JANA 5IEBA 3AI7A 1SCUA 1SN7A 2G9NA 2DWUA 3LOPA 1W0JA 2ZI9A 3DXFA 5IHXA 1WZUA 3WKDA 2IXGA 4G1UC 5E8RA 4J49A 3AJ8A 1UKEA 3EA5A 3E3AA 1J56A 1E1YA 1QFJA 2GRJA 1W5BA 3L8EA 4YONB 1WAMA 2OM6A 2R8ZA 3NUZA 3F6SA 5NLLA 3P23A 4PIMA 4LGYA 4ZI5A 2EFHB 1VG0B 3VDRA 4BVFA 1PNRA 3NT5A 3UITA 2WZDA 4J0EA 4E5YA 2PUHA 5FWNA 2OMEA 2XE7A 3MQ2A 3WDMA 2GAFA 4FQ5A 1IC6A 2WU0A 4B7CA 2A9KA 4AZVA 3UOWA 4EI7A 1I3KA 4LF6B 4MR7B 4J0JA 1F4LA 2VF2A 2H16A 1AMUA 4MCHA 1F1BA 2X40A 3K9BA 1ODKA 3R3VA 1M33A 1WMSA 5BN5B 3TBFA 1Q7CA 2IYQA 3P9XA 3T94A 2FPKA 4KCGA 1A9YA 2R1VA 5J59A 4BNUA 4PN7A 3P4UA 2XMSA 3SDBA 2YYSA 2O5VA 1GAQA 4S05A 3RTAA 3U7HB 1BG6A 3CFYA 1I4OA 2ODPA 2YYAA 3V1NA 4D46A 3ZCUA 3Q40A 5E9QA 5I9SA 3V7WA 4E13A 2Z1DA 2YOHA 1XAHA 3OZIA 4ZOAA 4GAEA 4PZEA 3PV0A 4O4JF 1MV5A 1HM5A 1SU8A 3AP2A 5KU1A 1RHUA 3K0SA 1X3SA 2BH9A 1LPBB 2P6PA 3OIWA 4W63A 2OV8A 2XNJA 1TJ4A 2D1QA 3V00A 5AVQA 3UK6A 1NWCA 3UQZA 2EWWA 3ZZNA 4RLSA 2JB1A 1Z6TA 4KTVE 4DCPA 2WJ4A 2R8XA 5AVZA 3NASA 1KU0A 5ALLA 4N3NA 3PNVA 3PT5A 4W8OA 1QH8A 1VBNA 3ETHA 2J4DA 3QWBA 1M5RA 1MOSA 1ZN8A 4AWXA 1U2PA 3GC6A 3O93A 3UCFA 3NP9A 2W43A 4PTYA 3EGDB 3K1TA 1SVIA 1G5FA 4B8WA 4EWLA 3DTVA 4O6VA 2JL1A 4M7RA 1DBPA 4RLHA 2RHRA 4D45A 2ISCA 3DAHA 1CY8A 1FS6A 4BO7A 1K2VN 1XPOA 3ZLJA 2WB4A 1H5UA 2BBOA 3IE2A 4RD6A 5ALOA 4J90A 1XTQA 2QYSA 1QF9A 3AM3A 2VDUE 2C1XA 2O0MA 5HGIA 1DX6A 3BK2A 1J8DA 2APJA 4OXRA 1EUQA 2Z95A 2RH9B 1RXUA 1ULAA 2BONA 4IZ6A 4MR7A 5JS6A 3COYA 2ZR7A 2GZHA 3HKEA 4LJSA 5C52B 5FWYB 3G6WA 4IIJA 1FL9A 3A2MA 3DLAA 3GRCA 3KUKA 4JCOA 5JFTA 1GKUB 3ORQA 4XTCS 4D3SA 2XMPA 4AZSA 5I7HA 4BNHA 4R7ZA 4YJ2A 1TDJA 2CLEB 1K0FA 2GN1A 2O7NA 2RMKA 3CF6R 4WCVA 2PL3A 2IXBA 1KGSA 3SFVA 2DWCA 5AW3A 2EBHX 4D3DA 2A0UA 4OFWA 3L0ZA 3ON5A 4PU0A 3FKJA 4TLMB 2FZVA 3E22A 2QJWA 4I5FA 3O8RA 4CZ2A 1S3SA 4H1WA 2YOGA 1ZISA 4CGZA 3S28A 3RWOA 3BSSA 2PJZA 2BFBB 3HB7A 2WSYB 4IINA 5CGZA 5A4DA 2WBLC 2VQ6A 1SELA 3SYMA 2B82A 1DQSA 1WF3A 1OREA 4MI9A 4Y6QA 3WI7A 1CKEA 3V8RA 2NYVA 3TO5A 5LD2C 4A16A 3D0KA 4Z7JA 1Z35A 2ST1A 2IQIA 4WRRA 2JFOA 2WWRA 3ODGA 5DGDA 1L7MA 3RLFA 1PR4A 3FVTA 5BV1A 1EWKA 3BMQB 3NIBA 3DGFC 4XKJA 5B7QA 3PVSA 4GBGA 1DWPA 2DLNA 1YDGA 2C99A 2JFHA 4ER5A 8ADHA 3WR5A 3OKPA 4Z1MA 5EIOA 3VC3A 4B79A 3PP8A 5LMCA 4EMTA 1K4KA 5CK5A 5K8TA 3L6OO 2QRZA 2PH3A 2W2XA 2A3NA 2AR9A 5BMVB 3DLBA 2JD1A 5KYUB 2GHTA 2PXCA 4IGEA 4HDKA 3PK0A 2XZPA 4MV7A 3OECA 4CT0A 3TW4A 4CGYA 5K1ZA 1JKXA 1SCQA 1OXUA 4DWJA 4LSMA 4HL6A 3AUSA 1U0GA 4CCSA 1P1HA 1VKHA 4QEDA 4FYPA 1G9XA 4B40A 2P2SA 2F9MA 5JSFA 1P6XA 1NI5A 2C94A 5EWJA 3TX2A 3UYLA 3HEMA 2OORC 1Z7EA 5FAXA 1XLUA 4Y2SA 4EPRA 1L5HA 1XFAA 2P9YA 3PFIA 3SZOA 5BV0A 1JU3A 1R5JA 2GLTA 2XGSA 1E7RA 1NW8A 1H69A 3C1UA 4DF3A 4QUGA 3QW2A 4POOA 5KREA 4ZYZA 2LTAA 1SOVA 2ODEA 3FBTA 3FNIA 5DULA 5E6UB 3UK2A 3QMMA 1EVJA 2C54A 5IN5A 3JPYA 1A5ZA 4HHEA 1OYOA 3G9UA 4IOKA 2BGLA 2SNIE 3PZRA 4NOLA 3UQYS 2O07A 2WT4A 1JFSA 2XIQA 3Q7IA 4A91A 4D4LA 4MPPA 4FCWA 4ZQHA 4K87A 4ZHQF 1BA2A 3BGSA 1FYXA 5B6JA 5KVQA 1TYEB 5LYJB 5H16A 2IUFA 4C08A 1PLKA 2F43B 2Q5JA 1E3QA 1R6VA 3LOQA 4RVDA 3K0EA 4RTJA 4OX9B 3HCNA 1UM9A 1M8PA 4AECA 4C7KA 3QEBZ 4GLFA 2JD0A 2WT8A 1FFSA 3CRQA 3TLCA 2F3RA 4A0RA 1G3RA 4F0JA 4KNYA 4KIWA 1TQ8A 3TK1A 5M7EA 3LS2A 2A1IA 1S2OA 1UMCB 3GG9A 3AC0A 1Y80A 3PHCA 1KS2A 1P0PA 1U5BB 1WY5A 1YI0A 2V6IA 2ZBEA 4QASA 4RPJA 4XVUA 2J3QA 2HHAA 1FTSA 1O95D 4OM8A 2NYAA 2B7BA 2W11A 2BL7A 1P62B 2FKNA 5CX1A 2P6OA 2I1LA 1XTBA 3IIKA 5BQ5A 2H1CA 2QR5A 4PSAA 4UE3S 1JJAA 2CHQA 2FX2A 4RFSA 3KAKA 2OLKA 3DWIA 1JEAA 2Q6OA 1SIUA 1Q17A 5JS1A 1KR2A 3LQRA 4KOAA 3VPFA 2VAXA 1OFVA 2Y05A 4GDMA 4ZVPA 4DY6A 1R8QA 4G5HA 4JDPA 3K1ZA 3FPGA 2FFBA 3A9WA 3V4OA 2IEZA 1O5IA 1SB8A 1D6MA 3MJSA 5AXBA 3DUFA 3PQDA 1MAAA 1USKA 4MW2A 5LA6F 4CPDA 1R9GA 1RWVA 4FGJA 3Q7TA 2QTNA 5G2OA 2IV3A 2J45A 3V46A 1IVYA 1KK0A 1TCBA 2ORIA 2DYKA 3DS8A 4JBNA 3RH0A 4KZPA 2XE4A 1G2PA 2FPXA 3CQ9A 4JLNA 4BKQA 1QWOA 4WMLA 4ERNA 6ABPA 1RI3A 4MVJM 1EFVA 3KPJA 2PTGA 4MIEA 2J6CA 4CL2A 4MHSA 4DV4B 1WTCA 2B8EA 3P9QA 4EKDA 2IOFK 4TL7A 3KDAA 4MMYB 2BAGA 1GN8A 2XVYA 4KSYA 3AW9A 2TMGA 3IRUA 5KYKA 1CIPA 4OQDA 2WUWE 4WZBA 1NHWA 4R7GA 2D0DA 2GHIA 4DLBA 2B21A 5HUJA 3MMZA 3OLQA 3ZV3A 1TFRA 2RKWA 3HABA 4PXSA 4RH0A 4X00A 4BNMA 5BORA 4B85A 5A02A 4YA6A 2C88A 4RFVA 4Z49A 3JAKA 3W6OA 1QHEA 1RIFA 3THSA 3PNOA 3X1YA 4B43A 1CQWA 1CERA 3S2IA 5DM60 5HKBA 1X14A 3VPCA 4V39A 2PYDA 1NI4A 1YR1A 1QKJA 4LF8B 4BNTA 1ZXLA 3H7AA 2YJ5A 4CQLB 1GILA 4I1VA 3NAMA 3FZNA 1A5SB 2O8NA 2ZK7A 1JTEA 3HFJA 3OE7D 4Z0NA 3ZN2A 4J0FA 2FUG6 4DTIA 2DVMA 3CPJB 1SHLA 1KSHA 4RTKA 4Q4DA 2BH2A 1EQUA 1T8UA 5K7SA 1CUWA 4KH1A 1E60A 4UXHA 4NBVA 4CDNA 1K75A 4IX9A 4DG8A 5MFPA 2OBMA 1XDSA 5C1BA 1OHHA 2WU8A 1DCFA 1JLLA 2FW6A 2LR0A 4RGBA 3QELA 4DJTA 1SBTA 4P53A 1U11A 5IKPA 2A1TR 2ZIZA 3KZKA 2YCBA 1RLMA 3RG2A 4CLXA 5LOVF 3P9YA 5J4YA 1WSBA 5EUBA 4V3BA 5KTSA 2ZU6A 5LMUB 1W2GA 4BS9A 1C3VA 4AX4A 3UUGA 2P65A 2XUAA 3NWPA 4H2DA 4INZA 9LDBA 5F7JA 4ZMBA 2YICA 1CC1S 3KV1A 5CDSA 2ZVPX 5A3RA 3SVLA 4P54A 2EKPA 3CVOA 5AW6A 1DT3A 1USUA 1V3UA 3LT1A 1VYTA 5DRTA 3L0OA 4JBHA 5DHUA 2JIDA 2IYRA 2X2PA 3F6EX 2IDJA 5BYAA 2R9VA 4ARCA 3HJHA 2CMKA 4NCIA 3DXXA 3JR3A 4OGWA 5CIQA 3TKLA 4TRRA 5KJEA 4ED9A 3ADDA 4PQEA 1IWOA 4ETMA 2C98A 4MVJA 4LGMA 1U9IA 4N3GA 4U4AA 3GU3A 4ENUA 5BWOA 1JG6A 3H17A 1FVFA 3IQEA 3BTVA 4MS3B 4FYKA 1JLSA 4C29A 4EHDA 2EJBA 1XELA 4IV0A 3NYQA 5LXTF 1XX6A 4RF2A 5LQSA 1PTKA 3VSDA 1TA0A 3ZZUA 1P5RA 4CODB 4FINA 2QU8A 4FT2A 1C2TA 3WFZA 1QQ6A 1ADJA 4IHKA 2SKCA 4KQMA 3VH2A 1C7EA 1RQPA 1XA3A 3I0NA 3O94A 4H6XA 4OKIA 1KDTA 5GVSA 3G0OA 3ZDAA 4BKRA 3E7PA 3F6RA 2VNSA 1YR6A 3LDAA 1OLSA 4YJFA 2CDRA 4UATA 2WF6A 4NBRA 5IKEA 5SV2A 1DUSA 1MG5A 1UBTS 2XMXA 2YH2A 4RWEA 1PJ3A 5JZVA 4NULA 4IAOA 5A62A 4HXGA 1TO1E 3MWGA 3AJRA 3DE3X 3LKZA 1NA5A 2PUEA 1LDGA 3KVYA 4W5HA 2I4OA 4IQGA 2C3PA 4L4RA 1EP2B 3K9NA 1UJ4A 1ESEA 3JQCA 1TJ5A 3GDHA 3TD2A 3REQB 4QVGA 3KQHA 3KQUA 1WCWA 4AO8A 3BC1A 1OBOA 4A8JA 3DA8A 3PXCX 4LOAA 5NULA 4FHFA 3AFGA 1LTHR 3TQQA 3QOWA 3LDFA 2QTGA 3T3GA 2CUNA 1V35A 2RGDA 1FQWA 2FSVC 4J75A 4J4BA 1JVBA 1DKUA 4QDTA 5K4AA 3AEUB 2JB3A 2V4UA 4JJIA 4X44A 1E6WA 4WNAB 2QYOA 1G20B 1KZ7B 4G4GA 4RD0A 3C41J 2X86A 2XRZA 4Y2GA 1Z26A 2ZRNA 3CRRA 4ZJUA 1DEOA 4GIBA 2PZEA 3LQYA 1EG7A 4YJ3F 3ITNA 4DV3B 3EXFA 3U16A 1J2RA 2XMRA 2IWHA 3X2SA 1YZVA 1RXEA 4JI6B 4E4RA 3DMGA 1WNTA 1AQNA 2J3HA 4R8LA 4MKFA 4HWGA 3CEPB 3GFRA 3L4BA 1N0IA 1ZYUA 3JQ9A 3FSGD 5CH5A 1QRDA 4OXYA 5IFLA 1NBMA 1KXJA 5CHYA 3UB4A 1FJGB 4MAAA 5DTMA 3UHAA 1TKAA 4P31A 2GNOA 4FUQA 3LUKA 4MO2A 3AESB 3HU3A 2X2FA 4LGVA 1R66A 1PGOA 1SHKA 2DULA 3KWJA 2VPPA 3TN7A 5DP1A 2BM8A 4OFBA 4JV5B 1G98A 1CU1A 1AQIA 2HO4A 2VYVD 4AZTA 5KNDA 1EFRD 2E48A 2AJTA 4PLTA 1VE1A 1GKKA 4WGGA 2EOAA 5DNCA 4YXWA 1E6KA 2DQKA 4FIZA 4E4TA 4L4UA 4AAYA 4EG0A 5LNK6 2HA7A 1ZY2A 4DM7A 2B78A 3O1HB 3VR4D 3LVRE 2QN1A 4HYYA 4DA4A 3LUBA 1P4RA 3M34A 1NUPA 2F17A 3L7DA 4AK9A 5F7ZA 4G97A 3KKPA 4WFKA 2FEPA 3IBCA 3C8HA 3IDZA 1LKZA 2W6ZA 5M2QA 3ROPA 4LI0A 4NPHA 5LYJA 3ZWKA 2XECA 3BTSA 3FUCA 1K08A 1QOQB 1WSDA 1Q6ZA 4BAGA 2OBLA 3S40A 4HR7A 5HTOA 1SC1A 2MYPA 3KSUA 3WWCA 1FW6A 4UQPA 5CM8B 5B58T 4FOSA 5T4HA 1G9TA 4W6ZA 2WNIA 3T3EA 2A5FA 4ZT7A 4KDRA 2B1GA 4FMCF 3STHA 3EB9A 3T7TA 3KUUA 3WIOA 1HK7A 4J94A 5A2QA 5JRDS 3L0PA 2WTAA 1FSPA 1NVFA 4LJYA 4RTMA 2C2KA 2C42A 1ZIPA 3DEFA 5KYXB 1JKJA 1MO2A 3HCEA 1U1IA 2OQIA 3HXPA 1Q2XA 2OESA 1D5WA 1EUDA 1XZJA 2ODBA 1NOJA 2DKOA 1OWPA 2CHUA 1C41A 3AINA 2HT1A 4N18A 3N6VA 3WZMA 1IMOA 3ZVMA 4GVXA 1CYDA 2ZRRA 5FBVB 1KJIA 1BZYA 4G67A 3EZFA 1BFKA 1IBKB 4M54A 3R20A 1FDRA 4LEIA 1KMQA 2XKKA 2CFCA 1G8FA 1BWSA 1E58A 4CE6A 2GEJA 2QRJA 1HFKA 1L5OA 2Z4SA 2YW9A 3JASB 4YAUA 4ZOQI 1AXEA 1VL0A 4LZZA 4AYWA 4C9BA 1G17A 5DM70 4GI2A 4L72A 4YJGA 1T8RA 4MW7A 1QLWA 2AR7A 4R16A 4TTIA 4D9NA 4B4WA 3AJDA 2VRBA 3PLAE 4ROSA 5AM4A 2WTNA 4XH9B 1W93A 1E9RA 4IJ5A 3LNCA 4RY2A 1MRZA 5IN4A 4C87A 3KQNA 1IZ8A 2Y71A 3JATB 3ZE9A 3ZCQA 4M1OA 3RF7A 3G5UA 1Y9DA 2ILTA 4L9SA 5HWSA 4M88A 1R1DA 1OFGA 5LPNA 4IF4A 2QNIA 4YN3A 4R01A 3DF9A 2JFNA 1NVUQ 2L0XA 1I7PA 1K6JA 1JMKC 1L5WA 2I62A 4HMPA 4UD2A 4WCFB 3MT8A 3QENA 2A9VA 4YECA 3IMCA 2FG7C 3RS9A 3V7NA 3ZY3A 8ATCA 2O8VA 1O96A 1E8DA 3B82A 3PC8A 3SSNA 5MGBA 2VL7A 2AJBA 1QG4A 4JXXA 1ZCFA 4P98A 2FN8A 2OK7A 1Z0KA 1Z4OA 1A7AA 1O6CA 1ORDA 2J9XB 1E66A 1W1IA 4IIYA 5BNTA 2B0CA 1FFEA 1RIIA 1XEAA 2G4CA 3JYOA 3KQOA 3NJRA 3PB3A 5HCNA 3RKSA 4PL4A 2XA2A 3EARA 3LBIA 3K20A 3T52A 2PUGA 2JJ1A 2Q2OA 2DAPA 1LPMA 4Q9NA 3MTAA 1KJQA 1ULTA 1CUZA 1XZLA 2DFVA 3L07A 2HQ1A 2ZP1A 1DV1A 3HEAA 1LX7A 3ND5A 3LT2A 4N82A 4R6WA 3GIWA 2I54A 3MSCA 1R27A 1BXRB 4LE1A 4MA4A 5LZ8A 1E62A 4E03A 5JASA 3HADA 3B3AA 5KINB 2FGKA 2PBLA 1ZNZA 2H1HA 4NMMA 2WC1A 3QA9A 1QDEA 3CTPA 4MVXA 1ZJJA 1ZEMA 3PE4A 1O5TA 4YWHA 4YZDA 4OHWA 4MUJA 4D9CA 1FFCA 3ZGLA 5CLJA 1VE7A 1IZ0A 4ZCMA 2QTCA 3N6XA 1EUYA 3TLMA 4D92A 5CVDA 3CO5A 2EBFX 2FMXA 3QWAA 5K8JB 1E0JA 4UCXA 3SU8A 3BCRA 4J0DA 1XD2A 1N2OA 4E1BA 2H4YA 2ZT5A 4XLLA 3H0EA 3VNSA 2ZRFA 4HNRA 4B0OA 4CDMA 4NBNA 5AVWA 3NHZA 1V5WA 2B35A 2QTVB 1T1GA 4EVIA 5KCZA 1RR6A 3IMKA 5H68A 1RYMA 3EUAA 2FN9A 5B6PA 1N6PA 3T34A 2OCKA 3KHKA 4I55F 1NUHA 2NUTB 4O02B 4HLUC 4Q4CA 2D3WA 2W42A 2GJSA 4Y7DA 5F4BA 4GX5A 5F1KA 1XZKA 2LPMA 4PC2A 4J8PA 4J9VA 1E1DA 4CUKA 4LFAB 4E6PA 3EXEB 1F5NA 1YVUA 1LJ8A 4XLZA 3LPMA 1V5EA 3AFOA 3ZHUA 3B36A 5KVCA 2XE8A 5EQFA 3DZHA 3U7QA 3EEFA 5T3UA 1OV4A 1SKMA 5JJ5A 1A2OA 1WEHA 3FGZA 3DBLA 2QUBA 4KTTE 1YHNA 3KP9A 2XTAA 3CZ4A 3ZWVA 1Z5VA 4GC9A 4C0AC 1VSUA 5ALPA 1KFKB 1L5KA 4BEVA 1WW3A 4BMCA 1LRLA 1FP1D 2BFFA 3VVBA 1F7VA 1JF8A 2YWGA 4FE3A 2UUCB 5J23A 1E1KA 4D80A 1V39A 2FTKE 1L8QA 1A0OA 3T7DA 1VCOA 1RMQA 2DHRA 3G3EA 3OJXA 1R3DA 4I1IA 1MNAA 4FR0A 1VLVA 3VDXA 3KVOA 2XVZA 3BQMB 4OXQA 4KJZA 2DR0A 2ZCVA 2XB4A 1E6LA 4WDRA 3H13A 3PNPA 4X61A 3LSYA 3UMJA 2A86A 2PVPA 4J7CA 2DUJA 2IYUA 1CETA 1VZ3A 3Q3VA 2BR5A 4IIDA 5KWSA 3AJFA 3KOWA 4L27A 2WIDA 5C7YA 1PEDA 5AW4A 3B5IA 1Z9BA 1Z36A 4ZP1A 3GZNB 4U6RA 1OUMA 5BVGB 1DEAA 2EATA 3D2CA 1DAKA 2NO1A 1ONSA 5FI0B 3M6UA 3RRZA 2RGBA 4IIJB 2A1TS 1O6FA 4PWYA 3DFZA 4OLHA 1S2NA 4EG6A 3UWOA 5JI2E 1ZGBA 5K4HA 4IGFA 3GFOA 4U2EA 1CJCA 4D8XA 4B32A 3PDUA 3NUQA 3ZWCA 4C7XA 3K8QA 4AZWA 1N5MA 5SYAA 5BUCA 2ZULA 1C1HA 1GV0A 1GTG1 3L4BC 4ZEXA 1RZRA 1ULHA 3FYCA 1TJNA 2OUIA 3OHSX 3Q15C 3ROZA 3VJLA 2QORA 1GL7A 1II8A 5ELLA 1JA9A 3KZMA 1FMTA 5CYPA 4I4LA 5AJVB 1L8LA 2DECA 3GLTA 4FGUA 2BMFA 3URKA 1T24A 4DR7B 3RWMB 2X8AA 4DAEA 1KRXA 4LVOA 1P2DA 2VJMA 1XNRB 1QB7A 2GK4A 4ZT6A 1JB1A 1Y8CA 4YP9A 2RK6A 4G24A 4G5RA 5J3JA 1J33A 4CBVA 3M83A 5KSOA 4BO1A 1KKLA 4LX8A 4HK4A 1G6HA 2JDID 3OTIA 4MSUA 4NEGA 4QFCA 3DBVO 3WP1B 1W73A 3A26A 2Z2JA 3PJEA 1RC1A 4Z4EA 3LUCA 4O2RA 1G3MA 2Z56A 4LDPA 4TTAA 5GM2A 3WK4A 3WNDA 2J5BA 1E2UA 1LBSA 5DM2A 3QKSA 4HMOA 1OXVA 2EKDA 4RTOA 1G59A 1ENZA 2V1XA 1YUNA 2YQZA 1ND6A 1RRKA 1E3LA 2VAVA 4HDAA 4JMPA 3U3OA 4YV2A 4LN1A 4TSFA 3DDWA 4EHFA 2G77B 2UYQA 1G8HA 4PL5A 2QTMA 2Y1XA 3BMXA 3NC1C 3U49A 1BGXT 2X7HA 3NT2A 5F76A 3THOA 2GM4A 3LA6A 1HT2E 3HDQA 3GT4A 3I9V6 3CZMA 4HAWA 2ZU0C 2GPBA 2EEPA 1SJ9A 3FFTA 5BNIA 2PMKA 3MC1A 4O1OA 1GZHB 3FYSA 4JKOA 1ZHFA 4W1RA 1ADFA 2PR2A 3EW9A 2UYGA 2HD4A 4E32A 5COBA 3UT5B 1SUPA 4CI0B 3L2OB 2Y1GA 4EQ6A 4V02A 1C3OA 5AOBA 2VDJA 2OKCA 3EGXB 4XFKA 1KI6B 3UOAB 4P4UA 2B98A 3EIHA 5JT1A 4U7JA 3RNOA 4RK0A 2VK2A 3I0MA 2R84A 3I9MA 2JPDA 2ZQ5A 1UBLS 2A8YA 1KZ1A 1RWWA 4DJJA 1P2UA 1NYLA 3GRZA 3M1LA 1NX6A 4N7MA 4YCCA 1SMKA 1XWIA 4OY3A 2CXTA 3I9KA 2PUTA 2XOXA 1J0EA 4YRRA 3KZVA 5ES3A 1CYEA 4QDJA 1FZQA 3TNDA 3TGPA 4YRKA 1KK2A 5CMLA 1XWWA 3UMGA 4TYQA 1TUIA 1ZI9A 3EMDA 4AO7A 5DLPA 4A7PA 1A5TA 1XPJA 1B14A 1IVSA 2WVJA 1KVSA 2Q0XA 2HUPA 2VWQA 4OQFA 2ZETA 1H5QA 1ZU5A 2O14A 3WOVA 1E6CA 2PZLA 1RI1A 2REQA 4IJVA 4EVRA 2R6R1 2PKQP 1X39A 1ZUHA 2NNLD 1JQKA 3F46A 5DWDA 2WYHA 1W6UA 3MUNA 4HDRB 4K6OA 1GZ5A 1ISGA 4P7FA 1A4UA 1R0ZA 4Q19A 2C9MA 2KQUA 1T9GR 4RZUA 4J7UA 4MW0A 4B3HA 1KJYA 5ANRB 3QF4B 2O3RA 1IAQA 4M7PA 4MLPA 3PBKA 5E3IA 2AE2A 4N4AA 1SKAA 3SR3A 2ZSBA 1Z29A 2IYNA 4L5IA 1LTKA 1D8AA 4BKOA 3CZQA 2PTHA 2ZUEA 1A71A 1JV2B 1IHDA 1V45E 1VKJA 2N3ZA 2VWHA 3SCZA 1WPXA 3HA7A 4L9AA 4R2JA 3BH7A 4DSOA 1MJHA 4PYMA 2DFLA 2PIDA 3DAOA 4ILKA 3TLYA 3X3HA 3F7OA 4WADA 2IY9A 1KR5A 5EHGA 2ETDA 2NG1A 2FMHA 2E5FA 4I6JA 4EL0A 3VAAA 1NT4A 3A9VA 3DNFA 4ZFNA 1Y3BE 5HRAA 2UUBB 5B53A 1E3TA 3ZVLA 2P69A 5J58A 4MMXB 1X1BA 1UFRA 4NXNB 2EQAA 1NLZA 3TVDA 5JRZA 3I9V1 1RZ3A 2V03A 4DY4A 4C22A 1K7EB 1N57A 3EG9A 2CVOA 2R0QC 1SBIA 4OAQA 1RYEA 3IP7A 4E5DA 3G0GA 2HBQA 1KFCB 4L28A 4RZIA 1PJZA 3FE2A 1GG5A 2R7NA 3NH6A 3P0IA 4JJFA 3D3QA 4DXAA 2FMKA 4LXQA 4EHKA 1AQLA 3SZ3A 2P9EA 4JGGA 5DTRA 1ZJ6A 4FNAA 2H5JA 3SHQA 1R88A 1T13A 2DE0X 5DXFA 2G36A 2CHEA 4MS1A 5HX7A 2IGTA 3LP6A 1EE2A 5LQDA 4BB0A 2MU1A 1SIOA 1P9OA 1V95A 2IUEA 3KXDA 4LHZA 4RD1A 3KFLA 3E27A 1TA4A 4UUBA 2O8CA 1DAGA 3GPDG 3B2EA 1I8TA 1M6NA 2UYOA 2DR3A 4LQCA 5JCOC 5C4GB 1TLFA 2I7XA 4P7GA 5TQ0A 4WGFA 1CRZA 3D3JA 5G1NA 3WLEA 1HUQA 2PFGA 4L3WA 2XEXA 1MV8A 3IHTA 3RVDA 5KBYA 3K70D 4MGYR 4YLGA 1RYHA 3I8XA 5IDXA 4N48A 3PFHA 1B6RA 1LX6A 4WBNA 2D4AA 3QA3E 1WXWA 3WBKA 3L7KA 5HK9A 1BJKA 4O59O 1RSZA 1Y4ZA 2P9JA 3UJPA 3T1TA 4RX1A 4E5MA 3MTGA 3KYBA 2IUUA 4MWEA 4Q02A 4QULA 2OHOA 4PV7A 3NC4A 3WVNA 3C1OA 3RU9A 2NXCA 4HGQA 4P22A 3TLXA 4Q4LA 3CGWA 2XUZA 3ND9A 1WNFA 2VEOA 3M6AA 3Q8WA 3PC2A 4GW3A 5B1EA 4DDUA 2PFKA 1NHGA 4V1CA 1Y1SA 4NYMQ 3TCNA 5ALSA 4FYYA 3IJRA 3KZCA 1APBA 4N5IX 1BEUB 1QIMA 1WMBA 2PYZA 4YDHB 3PIRA 3R7WA 4ALLA 1X9GA 4EF4A 1NYRA 1W6RA 2ECPA 4XM1A 3V48A 4EYSA 5LP6B 1YOBA 4QFMA 4P0QB 1XCGB 2G06A 5IASA 4ZGGA 4BE9A 4I0WB 3SEAA 3FPKA 3SD7A 4YRLA 5EZ6B 3ST7A 3I2FA 4L0MA 3ZY2A 2VPXA 2EL7A 3U61B 1IFXA 1U7XA 3OQJA 3PNMA 1WB9A 1ZSYA 2GN8A 3VDMA 1M72A 2JK0A 4EHLA 3BEOA 3K16A 2ZG6A 3G5TA 2X2OA 4RV9A 5K8LA 4A15A 2I6TA 4UEQA 2D7JA 3WNCA 4IQ4A 4OXKA 4QREA 4E21A 4IDOA 5ERGB 4P5DA 2JBAB 2PFSA 2ZYHA 3AM5A 4JQYA 5EZYB 2ZRPA 4RK1A 1X7XA 1IXZA 1BE0A 1HKHA 1PDVA 1SC6A 1M1YE 3BTOA 4O1MA 3RAGA 1R6AA 3TIIA 5CXUA 4JR0A 4EG7A 3WIBA 2R5FA 3UMRA 2EJWA 3VR6H 4Y2VA 2ZE6A 3OUZA 4GE0A 1PR1A 3I32A 2PBFA 2BUBA 2GEKA 5HS4A 1QO7A 3U9LA 2IX3A 3PGLA 5AW7A 3U81A 3DLCA 4AS3A 2RGRA 1CULC 1EJ0A 3FPLA 2HGZA 2RHOA 1VDMA 4IW3B 1GRNA 3WJ1A 4MLZA 3FLAA 4P5PA 1Z12A 1F48A 4M0DA 1CY4A 3D5TA 4NCXA 1ZM2A 2QOEA 2I8AA 1VYVA 3IUEA 2FP4B 5EAIA 1WB4A 3H5TA 1K3UB 1J8YF 1YMVA 1L6RA 2QLLA 5FOQA 3FNEA 3P9RA 4J16A 1CUEA 3NPAA 1ML4A 4KXVA 3ZWNA 4KK3A 1CJTC 2FSUA 3HKCA 4IWYA 4R5MA 3WL3A 5KNBH 3GZJA 1NBAA 3QPWA 1BD4A 2CD9A 1GPBA 2O1SA 4Q3NA 4R2HA 4RPHA 4AIRA 2WVHA 4B84A 4CIBA 4S0XA 2BFMA 5FX2A 1DBWA 3DO6A 3IELA 3AXSA 2JDIA 4C7OA 3DFIA 4MEAA 1JHQA 2QENA 2B9EA 2G9VA 2D74A 4HDNB 1C80A 3L8DA 2PD6A 4RHEA 4EB3A 1T2FA 5C2JB 5AI0A 1PX0A 1PGPA 2YC2C 2PV7A 3M1IA 2W0MA 3OE4A 3GD5A 5C34B 5AQ1A 1LUAA 4BQEA 3Q8LA 2J0SA 3FMOB 4G1MB 5E1BA 2GJKA 2F00A 4M9UA 3NGMA 4OMUA 2G9UA 2YVAA 3EZXA 3H2HA 4QWMA 7ABPA 1Z6ZA 1FUYB 2XDAA 4X3OA 1SZDA 4GOOD 2VPQA 3HV2A 1RXYA 2FN4A 1F2TA 1ZRSA 2IT1A 2X23A 5D5QA 5H3LA 4ZZIA 2JLYA 1GGKA 1NM5C 1OPXA 1WXGA 4R1LA 3FWPA 1HMPA 2A4MA 2I3BA 4GR5A 2MJLA 3OICA 4EABA 1P7YA 5CB4A 3QWFA 5E1OA 4ZV9A 3OQ6A 1QKIA 5T8KA 2RLDA 2ZTHA 4DIMA 2WKRA 2W37A 2DQSA 1KFEB 4B9EA 3ZKWB 1U02A 1PR9A 4H4EA 4GKJB 3PHIA 4RZSA 1F8GA 3R4VA 4DMUB 1FFDA 4Q9LA 5CT8A 1DDOA 1JQDA 1P1KA 3OX4A 5AJTA 1XZHA 2IEIA 2Q2VA 4HLUA 4Q6WA 3MMSA 2FWNA 2VAMA 3OBIA 4GPEA 1DLJA 1JYEA 5CH3A 3QLEA 4UVGA 1JN0A 1II0A 1E0SA 3RS3A 4TKLA 5B3KA 4D4HA 3FWZA 3DD1A 3CIFA 3ESAA 4PCUA 2QN7A 3F74A 4ZAZA 5A2GA 3T4PA 2WJHA 1KE2A 4M8KA 5F1OA 4GXRA 4DIBA 2J46A 3C8ZA 1XMVA 3A6JA 4QYMA 2FY8A 2YY5A 3NBYC 5DHSA 2F43A 3IP6A 3U7QB 3GN1A 2HT6A 2NO0A 4CU2A 4AKSA 3BRSA 3QVVA 3GAAA 3PDIB 5SYMA 1M83A 3C3PA 3EXEA 3PVZA 4ZOEA 5JDIC 3VTZA 1CF4A 1UPXA 2KLHA 1FXWF 3RUAA 1US8B 1QX4A 1ORTA 2JIBA 3LZCA 4HD8A 1PT7A 1Y3FE 4EVSA 4AUKA 3W5SA 4ETWA 1XB2A 2ZS8A 1EVQA 1KJNA 1L4UA 1SKUA 3OJ0A 1C0IA 3WLPA 2I7DA 1L2TA 5TEWA 4DLLA 1EWQA 4CTJA 5EINA 1UKAA 1AX9A 2W2TA 5JPIA 3USZA 1G3IA 1V25A 2RFLA 3I4CA 4KI7A 5F21A 3TDNA 4CV0A 4AKHA 1I0IA 1NWHA 3A58B 5JNTA 1UK8A 5B1YA 3EVGA 3D7RA 4EATA 3A06A 4KYVA 4YAGA 4QNRA 4UCWA 4N47A 1M7HA 4H60A 4YV7A 1QGED 2IOHA 1B3RA 4PZ0A 2LZ0A 5CVTA 4JASB 5AW9A 5TNXA 2VPZA 4CMJA 4Z0TA 5DWQA 1VCHA 1YCDA 3GRRA 5CA1B 3RVBA 2J0QA 2ZAYA 3FSRA 1EBUA 3LL4A 1C4OA 1JI0A 3D4IA 3DLTA 4P4SB 1Q44A 1JBKA 4OJQA 5C8YB 3SQWA 4X8LA 4A26A 5DE3A 2Q3HA 1AKEA 1K66A 1UPFA 2ZSUA 3E81A 3PC8C 3S2EA 5EIEA 5JFOA 5D51S 5BR1A 3A9SA 3L05A 5HRCA 2JLUA 1SXJE 2WPDD 2XUFA 3GCXA 3JWPA 4KUHA 3AHFA 3DCIA 2JIPA 2NP7A 1XMSA 1O9BA 1T6BY 1YNOA 2OAEA 1HEIA 4HAUA 2QX4A 2P1RA 2WUGA 1I6WA 3NIFB 1I3MA 3OCCA 4MRMB 3DSRA 1E9DA 3GA7A 5EOVA 1YZHA 1ZIOA 1EDZA 3ZQ4A 1ZEJA 4BMOB 1H4VB 1WW8A 1C8LA 2NZ8A 3SHFA 1DKLA 4YWJA 3LGSA 3T3MB 3WQBA 5UKDA 3R0XA 1PJ2A 5I8PA 1ACJA 4FYMA 4J2TA 3CLVA 2P6MA 3QKIA 4MVJI 1YS7A 1LZLA 1CJMA 2PRJA 4I6GA 5CFZA 2QLFA 3ZLUA 3H9CA 3KUCA 2C3OA 4RA6A 1M74A 5IC6A 2PH1A 1Q1EA 3GFSA 1JQJC 1XA4A 1LK0A 3AJ9A 3ESRA 1HE8B 1YB7A 2K2QB 2OL4A 3AUYA 1N5DA 4MGKR 2XGMA 4OK5A 3FMPB 3SVZA 1NASA 3WWZA 4E5VA 2F1JA 2WF7A 1CWUA 2FZCA 3HRIA 5AHOA 1XDZA 4F45A 1GM5A 3NYRA 3L1VA 2K6GA 1D2AA 1OYVA 4QE3A 4TVSA 4JFAA 2FMTA 2A2CA 1T1EA 1HZZA 3K8YA 3FROA 4QPJC 4UVEA 1LLUA 2H5EA 4TRMA 4QPPA 1ZRHA 3GFFA 4JB0A 2IZ7A 2IS2A 1VECA 2ZUVA 4DGQA 3RFXA 1M8FA 5BN4A 2FB9A 3A9RA 3AV0B 5TGDA 2YRWA 2VKTA 1QGOA 3EJ6A 2LIVA 3CLUD 1LK7A 2X9LA 4FEGA 4NR0A 2YC4C 4PSVA 3TAUA 4ZYTA 1U0FA 1LY1A 1D0VA 4KE7A 3FOWA 4L3OA 4R2IA 5EP3A 3C1AA 4YX9A 4YIKA 4GOXA 3A4VA 2ONJA 3O8LA 3JS5A 1GA6A 2HA2A 2M6SA 1QV7A 3EFOB 1UZNA 1KI4A 3OQIA 1ZBDA 4EG4A 2C2MA 3QU4A 2ZR9A 1D8TA 4NU0A 5EHIA 3GAFA 1G64A 2J31A 3GARA 4MDHA 4UAGA 5CFRA 1WXXA 4ZTBA 2BL8A 2WJYA 2VWGA 1R4ZA 1G8JA 1NI4B 3HA5A 3N59A 5F51A 4ZI3A 2Q4TA 2VNIA 4BMPB 3BL6A 4YAKA 5JR3A 3Q3JB 4H77A 4EGQA 3S3TA 5TS2A 1BO6A 1NYTA 4BB5A 1E8NA 2OCGA 3FYUC 1ZGAA 1DKPA 5CX4A 1JXAA 4P2GA 1W75A 4IDEA 5LZ9A 2YHIA 3KHTA 5AVVA 4Y2YA 3OZUA 5J40A 4EEZA 4MDEA 3WZ2A 2WWWA 1UQTA 3DJYA 1L3IA 4O4IF 3IHWA 1B3BA 1H94A 1NQUA 5EE3A 4K9DA 5IXJA 2V8OA 5CVCA 1GADO 1EFPB 2UUAB 1VPLA 4MVJG 4Q5IA 1ADGA 1K5DA 2JH3A 3PWSA 5BWLA 5ITSA 3K9CA 1RC8A 5GPBA 3AIOA 3ZW7A 5INTA 2BD0A 1QZ3A 1W94A 2AI3A 2JLCA 4PSKA 1ORRA 3RYIB 1ZK1A 4FE4A 3RUDA 3EQ8A 4R4JA 3UZUA 1BS1A 2C2GA 3IQGX 4J4HA 4YC7A 2V9ZA 3LK7A 2N46A 3O4JA 3JZAA 2CUZA 2I0FA 5ALQA 2BKVA 4EMSA 4E31A 3OPMA 4EOGA 5MFZA 4LOIA 1MT0A 3P9KA 3X2EA 2FXIA 3NS7A 3KQPA 4P4LA 3I6ZA 4TQUS 4MIYA 3N7TA 3CWCA 1GO2A 1K7FB 1PDOA 4YAJA 4EBBA 3ZHBA 4H3VA 1FTYA 4ZVQA 4DT1B 2QD2A 1YONA 4F7DA 1V48A 2BFDA 1NATA 1G8AA 3DO9A 3QP9A 3VR0A 1JEQA 1JLHA 1PTJC 1SBNE 3BIJA 2QIOA 3KB2A 3U3ZA 1YXMA 2QJOA 4EW2A 4OYYA 3EXFB 2QVLA 3KEMA 2K2WA 4ZICA 4LJ9A 3MIZA 1Q7TA 2VAPA 3MLAA 1V3VA 2IE0A 3RIHA 3O8DA 1GU0A 1Q1NA 2OO7A 1ZN7A 3DHEA 4NH0A 5AKKA 1Y8RB 4D44A 4NBSA 4Q3OA 2WOJA 4PG7A 4UCQA 1JAIA 2KM1A 1E63A 1AXRA 5D5HA 4ZV7A 4BN0A 2BZGA 1ZR2A 2WHEA 5FRDA 5BQOA 1G4AE 1GR1A 1Y5NA 2D0IA 2QVCA 4QYXA 1VG9B 3WO1A 4Q16A 5BOSB 3FHOA 3EDOA 3JYQA 3W2FA 4ZJZA 2CB0A 4CLRB 3ADKA 5LLTA 1TGVA 2GMWA 3W04A 1YR2A 2X8WA 1G7RA 1A5BB 4C30A 1HDGO 3VR5D 2QF7A 2P22B 4KMMA 1IN1A 4CM4B 4G9GA 2J0UB 1KQNA 1HRKA 1ENYA 4OMDA 3DTTA 4F56A 2DBVO 4DZZA 3IT1A 1T1RA 4JQOA 4RXMA 3E7WA 4UMFA 3A2KA 3NWJA 3W2HA 2QJTA 2I6UA 2AOUA 2ZBFA 3EF1A 3PR1A 1ZPDA 2RGGA 3IAAA 3RIYA 3L0IB 1CVIA 1S8AA 3BQNB 5GVRA 5J2UA 2FPIA 1Y98A 3CBGA 1YA4A 1VB3A 1Y82A 1QR2A 5KHOC 2WDPA 1C29B 4QYWA 5JCXA 4IGKA 4ISBA 2B8WA 3HUEA 1ZOPA 1WKBA 3ESBA 4CCWA 4IILA 3SJCA 3B1JA 1H85A 3DAGA 4HN9A 3UK7A 4B3SB 2FZKA 1RPZA 1MHTA 1T2DA 3V9AA 4CV2A 4NWIA 3ZX4A 1CP3A 1K89A 1BMTA 1O03A 4HDKB 4IH1A 3OT1B 1ZH4A 3N2NA 3K0FB 3ZQUA 1D4FA 1SU4A 3M2PA 5EUQB 1NNUA 1T2EA 4BMXA 4Y2HA 1VIYA 1J9EA 3QKRB 2Z8ZA 4G5GA 4BNGA 1NLUA 2VHWA 2VEDA 4G2TA 1TE2A 2NW6A 2VAWA 3H5IA 3O3MB 3Q11A 5FA8A 4WCFC 3SHWA 3ZZ1A 2MYUA 3V3TA 4BKUA 4B3TB 2PV0A 4W82A 4CQMB 5HXAA 1XTUA 3F3YA 7GPBA 1NJ6A 2P5TB 3G68A 2J9FA 4IDQA 4TWIA 5BSTA 2OFFA 4B6FA 4YRTA 2C5BA 4JITA 4UOEA 1EXMA 1BIFA 4TYWA 4R1OA 1H65A 1W88B 1NYQA 3TPFA 5EZYF 2RKBA 4QDOA 3WY9A 2NZVG 4DWLA 1JAYA 2OBBA 3KPWA 3G1UA 2BFBA 4HQKA 1N1DA 3YASA 1OGJA 4M1TA 3IE1A 1Q1BA 1QDUA 5GONB 1FSGA 2AYYA 3LW7A 4HLQB 2ACWA 2VJAA 2HH9A 3VTKA 3O21A 4O8ZA 3FZYA 3NB0A 5FBRB 5DF1A 3Q9SA 6YASA 1UBNA 3SC2B 4Q21A 3UNXA 1SFRA 3C3CA 4AD8A 1WPRA 5K3EA 1Z6YA 4ZEMA 1BA3A 1ITZA 2FR8C 1H8HD 4ENWA 2FFQA 3HA2A 3W5HA 1GQRA 1A2BA 1LSJA 1S8NA 4KRGA 3OTQA 4ZHQA 1VJTA 1N1GA 4BY9E 2XYQA 1KDPA 2WP0A 4P82A 1XXHB 2OILA 3AOGA 3MJCA 4I1UA 4MDYA 2N1BA 3KSBC 1GLNA 1ZR4A 1QFYA 2E2WA 2FRDA 2JFWA 2NPIA 2JEYA 4KQXA 4CRWB 3JALB 1YS1X 3DAFA 3SMVA 4AURA 2P78A 1Z0DA 2AC7A 2PSHA 2VJMB 4KQIA 5EE0A 5G0WA 1YC2A 3H9UA 4BNZA 1B8VA 4KHPB 3DLHA 1LJLA 3LHDA 3REOA 3M8KA 4HRAA 5IPFA 1M34E 3N0RA 4IKOA 5JE8A 1VIVA 5GJWC 4BQOA 2BN4A 4XB2A 4CG3A 1SM4A 5D84A 3IAS6 4WOKA 3RVOA 3GROA 4CM6A 2P1ZA 3PEYA 1SUBA 4O4LB 4D9MA 3KV3O 1UC5B 2KYRA 4CI9A 5F2EA 1I1HA 3I30X 3VTAA 4E5UA 3E3NA 2FFJA 1YS6A 4Z53A 5L4NA 2ZVQX 2IQ5A 2XDYA 3DC2A 2JGEA 3ENVA 2PX3A 3I2YX 4RKEA 4UNPA 4JJZA 1ZRMA 2IZ1A 1MVOA 2JK1A 3OFVA 4P38A 1QHXA 3L18A 3CUWA 1G8SA 3NBUA 2QL5A 3LOUA 3DPIA 3PQEA 4HNAA 5T4EA 4OLAA 1I2DA 1DQPA 4FX5A 1W4AA 5CVUA 1ECGA 1R18A 3F3KA 1CDZA 3THWB 3MGKA 1ZWLA 2ZAMA 5F9FA 1XZQA 3TLBA 1KAQA 4C14A 1IN5A 1C2YA 1PEKE 4FOLA 1EA7A 5F9HA 3K9WA 2O6LA 3AVOA 1T8PA 1LK5A 1UMCA 1JH8A 3ETNA 4HATA 5CNMA 1HE4A 5GONA 4A5OA 2V9PA 3EMBA 5ULLA 1AO0A 4AB1A 3EH1A 2OGWA 3GELA 3N76A 4LRWA 4TWRA 1AGNA 1A7KA 4MTLA 4R9SA 5H3CA 4BUZA 1M6WA 4HADA 1U7PA 4UHHA 4JK3A 3KFVA 4P3NA 2Q4BA 1F8XA 1U0SY 5IRCD 3AY7A 4PSUA 4KLZA 1P31A 2LWIA 2RAFA 2A1UB 2A94A 2XNDD 5CGQB 5HQ3B 1SK9A 3QVOA 2F8TA 5AM2A 3LSTA 4XWWA 2BHLA 3CVJA 1PT9A 4GMDA 4IIJF 6REQB 2GYWA 4BO3A 1ZMOA 5IJZA 3I64A 4AWBA 1I3CA 1VG8A 1W19A 2ZQZA 1SHTX 4GQBA 4M76B 4HXYA 4MV9A 3UT5A 4KQJA 2EKLA 4AP6A 1P80A 1VTKA 2H31A 3KPVA 1KZYC 3HCPA 3BK7A 4NBTA 4UEWA 4ZRNA 4CIXA 4L50A 3G8BA 2WMOB 4IHJA 4QVKA 3LZDA 2DM6A 2O50A 5JPDA 3WRVA 1ESNA 1XZEA 2AN3A 1E7QA 4KXXA 5HNKA 1XD9A 3C48A 3DHYA 1E1QA 2X0IA 3RJ9A 1DADA 5SZHB 3D1LA 2PUDA 3PGMA 4KQHA 4LV8B 2ZANA 5CDGA 1GTRA 3TTWA 2PKEA 1VGRA 3IAS1 3C6BA 3FUXA 3L0YA 1P75A 1VRWA 4RK6A 1KE1A 3HVKA 5G3ZA 1FP6A 3AR2A 4KK4A 3AF4A 1IXSB 4Y9SA 5BWCA 4C7MA 1ZK4A 4DQVA 1V96A 4B3GA 1NMEA 3VQTA 1C7ZA 4XLTA 5FWAA 4DR4B 1D0IA 1CS4C 3PJFA 3ZXYA 2ZJ4A 4RETA 4ZAYA 1IJFA 1KI8A 2RE8A 5KSWB 1Q57A 2YXNA 1ZK2A 3P2IA 5AJZA 3ZXSA 5LUAA 4NQRA 3D7KA 4KGVA 4BO8A 4EJFA 3QOFA 5JQGA 2GJ4A 1P0CA 2PT9A 3CW2A 3DOOA 5DHPA 3W4JA 4IX1A 3K72B 1DAMA 4XAQA 2MSWA 1K8XB 1IWPB 3R7LA 3ANXA 3ZTYA 1E2EA 4ZANA 5LBIA 4FC7A 2QM0A 2A9JA 3CE6A 4C4TA 4Y3UA 3U3MA 3DR5A 3SICE 1EGAA 2DFPA 3H5WA 1CJUC 4G86A 4PCAA 5A05A 2TMYA 1QV9A 3C1TA 4ZOLF 5HMLA 2GETA 4EY3A 2AFIB 1E69A 3WRYC 4LDRA 4RHUA 3E5NA 4PGHA 4DBZA 4BRWA 3ZVKA 2F59A 1LWNA 1JSZA 3K30A 3N0XA 1V26A 4RTPA 1OWNA 2HPVA 3OA0A 1YACA 1G7CA 3WYEA 2D1YA 5BW4A 1M6YA 2KI5A 2QVGA 2O2CA 1LI5A 5JALA 1DMRA 2FF7A 4DMGA 1YVRA 4AJPA 1LFAA 2P8SA 4Q7EA 3EISA 3HCDA 4UTZA 4GYYA 3IP5A 3QVSA 5HFNA 4W9RA 5EQJB 1DIGA 2WHPB 2Y67A 4NP6A 1QPGA 5GV8A 1IY8A 3R75A 1P4JA 3F4KA 4KKXB 4INJA 4G63A 5JY6A 1STOA 2YZMA 3ERCA 3C3DA 2WW8A 3C3YA 4UTOA 2Q1YA 2EIXA 3G9QA 2PKRA 2W70A 1TDPA 2GDZA 2O9JA 3OQ1A 4FGWA 1FFXA 2WIKA 1RTKA 4PANA 2L17A 4Y2XA 1I5RA 2DLDA 3CH4B 2JI4A 1NBWB 1TK3A 3ZDQA 4CCYA 4JSYA 3ELYA 2WVAA 5H1YA 3I61A 3L7OA 4KN6A 4G0UA 1YJ8A 4IIUA 5IAKA 3EBPA 3GJ3A 2OXCA 2HXYA 5AW8A 2CC2A 3MJRA 1QIDA 2PO7A 2CKDA 3ZI7A 2VSOA 2BFWA 1Y8AA 2GLUA 3A31A 4E1VA 5HOQA 1RJ9A 1VBMA 3HDJA 2IE8A 2YINC 4QU5A 4TL6A 2HX1A 1G8KA 2X1HA 1N0WA 1NSTA 1MABB 1QGUB 1V8DA 1QHIA 4RAQA 4TTPA 1DAHA 4FOPA 2ECFA 3HR8A 5JU6A 2XYRA 1I3NA 3RHFA 2XQGA 3OZRA 2HW8A 1WJGA 4M1ZA 4ALMA 4CL3A 4QBTA 4FVTA 1KSGA 2X13A 2OD9A 3WO0A 1JU9A 1PBTA 3GGCA 1PL0A 3OY7A 4IVNA 4N7JA 5EG5A 2BEWA 3WGHA 5BT8A 1KC3A 1G63A 2IF2A 2ZYRA 4NC9A 2V0CA 4OLBA 1PJLA 2JCXA 2YUTA 3U4DA 3CPSA 3LBFA 3CLUC 4HZUA 4A0FA 2C95A 2VHQA 5ICFA 1CIVA 1RLOA 2CBGA 2R1ZA 3A6KA 3L0BA 3ZBTA 1OAOA 2RGAA 1GNLA 3KXIA 5TS3A 4DCSA 4EIWA 1ACLA 3LFTA 1Y8RA 1B8NA 1WE2A 1BN6A 3TNJA 1QTNA 3OE7A 3GLFB 4EW6A 1JW9B 2P4EA 2YN0A 3HA3A 1UWCA 3VVLA 3B9PA 1DBIA 1Z38A 1NBME 4PHGA 5TGTA 4W5JA 3J80A 5FPKA 2JS7A 4YY3B 1SXPA 1I80A 2N75A 1UEXC 3CJTA 2C9YA 3FCOA 3GJTA 4CF6A 3ACBA 1JYFA 1TIPA 1OY1A 2WAOA 1XTPA 2D62A 4L6AA 3U31A 1I3LA 2HJRA 2VDWA 2GOYA 3TBHA 3GZNA 5ALVA 4EFDA 2J0VA 3FTNA 4INPA 4YCLA 1U2DC 3MG9A 4IIBA 2GKGA 4ILEA 2CNDA 3IV6A 3ZC3A 2BKXA 2FK7A 4HEHA 4EFLA 4ZARA 1P2FA 3OTOB 1NVEA 4EGCB 3G59A 4FGZA 4KBFA 3E18A 3SC2A 2PS0A 3TZQA 3S4YA 1N8NA 3JRWA 5JVDF 4RL6A 1QIJA 3F6YA 2I6XA 4OJNA 3GCDA 2BE9A 1FFGA 3IQHX 1BW9A 2BP7A 3HSSA 4WXPA 1JR3A 4TMWA 3TQRA 3UGJA 2V7VA 1R6BX 5EUMA 3MOIA 4LBVA 1OH7A 1ODIA 3HZOA 4Z54A 4EMUA 2G09A 4NJOA 5KQRA 1W4BA 4XJXA 4E3WA 4QXOA 5ESDA 1M8JA 1V7CA 3G2LA 1Z63A 1QYIA 1RBYA 3R1IA 5JXHA 4MWOA 2ZRHA 3DBLB 2HU7A 3DZCA 1Z5PA 3E48A 3L7JA 1P0MA 1B6TA 4RADA 5ENZA 2OC4A 4W8HA 1RRFA 3CBQA 4KGZA 1FYDA 3IUQA 1FMLA 4ZI7B 2V65A 5JY1A 4LJRA 1XTTA 3AF2A 2F55A 5K0FA 4PPYA 1HE5A 1A98A 2IX9A 3HUUA 1BU5A 1WS6A 2J33A 3FIJA 5TEVA 1YI1A 4C0LA 1Y8ZA 1E9SA 4IXDA 3RFTA 4DLZA 5AKZA 3KQVA 3PPWA 1W8DA 2UZIR 4PXYA 1O87A 2XXBA 3SEZA 5K6AA 1NE7A 5TC4A 2O06A 2QPTA 1GCIA 2IS4A 3QE2A 2ZUWA 4A2PA 1A8IA 5FFFA 1JZSA 2QSJA 3TXYA 5JBNA 2QAGA 5JAHA 5JSKA 1ONOA 1T2NA 2BFEA 3FF4A 5CA1A 3OG9A 4KLAA 4KQ6A 4TTRA 1SVKA 2NVUB 4IJMA 2FWMX 4BN4A 3G5AA 4CQJA 3DL7A 3WWDA 1R5OA 2CJFA 1F8YA 4HQOA 4UFNA 3CCFA 1ZSNA 2BELA 3EEQA 2RHCA 2P2CA 4HS4A 3VBCA 5CXQA 1OROA 2ZDQA 1K6XA 2EAUA 3EQ6A 3MS2A 5HBRA 2O0HA 4YT4A 4FFWA 4ARBA 1A8PA 1UJMA 3K09A 4LVCA 3SLRA 3ZDBA 1N7HA 3ZE7A 2E4VA 1WCXA 1QAOA 1VIDA 1WPGA 1HBJA 3HYTA 2FYTA 1K5HA 2NZ2A 3NWEA 1ATIA 4LWZA 5B6IA 1AHNA 2PLFA 2R66A 3NFRA 2AWNA 2VBIA 2QHXA 3F2IA 2NZXA 3IUYA 2L19A 2VOEA 4WLEA 5DASA 3UICA 5BOSA 2QS9A 2XXAA 1PQWA 2OB1A 2IXEA 1XCJA 2QD1A 3N58A 1PYDA 1I5OA 2V5VA 4XUEA 1EZZA 1W36D 4R68A 4HDMA 4DMCA 3THXA 2GN4A 4KR0A 3QKTA 2ADMA 2CJWA 1Z4PX 3M6WA 4K40A 1T9AA 3OM1A 1W76A 1I4WA 4RYLA 3TAXA 4TYYA 1GPUA 4JYMA 4L4XA 4PVDA 2OKGA 4F4CA 2KBFA 4K88A 4CEIB 5ECDA 2OORA 2I87A 2O8DA 3Q3HA 5KKNB 2CXQA 1LFDB 1Q16A 1YBFA 1D4OA 3TSOA 1VIMA 2VYVA 3I04A 4JLDA 3G7SA 1L4FA 4TV8A 4XM2A 2BHRA 1PS9A 1JG2A 2BFDB 3AG5A 4AQDA 4OMFG 4LBYA 4YRNA 2VKQA 1T10A 3HVRA 1Z33A 1F2UA 1U0JA 1DRWA 2SHKA 1XXLA 4GRDA 4YRQA 3PC4A 2BOVA 2IYAA 1VA5A 2PUJA 3AERA 4UDNA 4F84A 2G1UA 2GF2A 2B0JA 2HF8A 2UUPA 1A2KC 4XVRA 3LT4A 2Y6VA 1OIXA 4CKBA 2VDWB 4BLUA 5B3LA 4AL4A 1XCMA 2H85A 1JDZA 1NOKA 4DXDA 1U1FA 3JQ8A 5CYGA 7REQA 2A67A 4DV1B 3KE9A 1H2AS 2X76A 4FMPA 4TXNA 4Z99A 3QHPA 1Z45A 3TE6A 4ALJA 1U9JA 2DHEA 4DM4A 3I34X 2REXB 3IKJA 3N74A 3EIUA 5H02A 2X19A 4LWOA 3MW8A 2Q6VA 1ZVKA 1DJQA 2J3LA 3CRVA 3VZQA 4G0ZA 3NHMA 1JIVA 1XJ5A 4KXNA 5E6RB 1MB4A 1Z5NA 3TB4A 2GCGA 2C3MA 2PZAA 1V1RB 3MS4A 3W8DA 4B3RB 1KP9A 1ZHHA 3O8NA 1UZMA 2OENG 1AHHA 1M1YB 2G9ZA 2BCGY 3JYLA 3NUGA 2FK8A 1XCBA 4MKZA 2RK3A 1CZRA 5FNVB 4GZMA 3ZE6A 2ICAA 4JLSA 3VO1A 3T1YB 2IPMA 3GLIE 1TJPB 3FNQA 2HLDD 4Z5XA 3DKPA 2Z5FA 3IAXA 4JVOA 3ZQJA 2VDVE 1F6DA 4B5LA 3GEPA 3HKCB 3MPUA 3N8NA 2Y1WA 4YBZA 2WWVD 2Z09A 2X0RA 3AMVA 2ISQA 1XQ6A 1YE8A 4UARA 4AT1A 4C04A 3RODA 1PYOA 2H8GA 4LMRA 5BP7A 3TG8A 3OIVA 1CD5A 3EGIA 1M0SA 4ABYA 2BFCB 3FA2A 2O19A 3WMEA 4ZK2A 2PEYA 4PX9A 3MYRA 4GF5A 1OAOC 3WZLA 4NYJQ 1C1YA 4WA7A 4ND4A 2QU7A 3S2YA 4DEVA 3HCBA 3O84A 1XTZA 1QB8A 2ONYA 4DR1B 8ABPA 1XR3A 1NUQA 3B55A 1WL8A 4N12A 1UK7A 4B75A 2ZSDA 4FFOA 1FLDA 1MQAA 4QLBA 2ERCA 4EYOA 3FVQA 4G2NA 1P0IA 1CY6A 2C2XA 2I1WA 5LIPA 2WUVA 1D3AA 2QUIA 4X6LA 3IJEB 3FMFA 3PHLA 3BFJA 4LKRA 4AVYA 3D8HA 4H7KA 3ZHZA 1KY2A 3SEQA 5A3QA 1NQ5A 1U4NA 2PN1A 3H2IA 3W0LB 2HRRA 2VPIA 2VSXA 3D4OA 3IDFA 4CHTA 5I9LA 4YALA 2ACVA 1LSUA 3E5RA 3V32A 1U5CA 2Q49A 3GL9A 4QEKA 1FLVA 1X6VA 1XZMA 2H52A 3AEKA 2P2YA 3K9HA 1Z25A 2GNAA 4KUGA 1I14A 4XJTA 1A3CA 5TARA 3GLGB 2Q4DA 5B37A 1Y34E 1E2JA 3EMVA 3KR1A 4C0WA 1GFSA 2WWYA 1X13A 2ZUSA 5AVJA 1KO7A 1Q7GA 5ESXA 3JARA 4KLRA 3NC0C 3SC3A 1WQ4A 3V7FA 1MX1A 5GZ1A 1WU8A 2I80A 4GH5A 4BCCA 4PL3A 1Q0HA 4FR5A 1TRHA 1GZDA 2JB9A 2EF0A 4ECEA 4RA9A 1VBKA 4YRDA 3LHIA 4NCKA 1PZHA 4OREX 5JW6A 5TF4A 4I50F 2BISA 5DOVA 2IXAA 3SHOA 3IT0A 3P9CA 3UMBA 3ZWXA 2G8NA 4ARZB 5HP4A 1VPTA 1XRRA 2PSDA 4ZC8A 4EF5A 1NDUA 1U0BB 3I58A 3E1KA 1LEHA 2IELA 1L7QA 2Z2XA 3LPNA 4H1VA 1B8UA 4W9MC 1U31A 1AKQA 1ZC3A 1ZGJA 5K4GA 1W4RA 4A9AA 1YDFA 3EULA 1IYZA 4X64B 1ONNA 3EC2A 2P9HA 2CF5A 1XZNA 3CRZA 3HBLA 3D54D 4EUFA 2PA0A 4DIOA 1RFLA 1XOIA 4J16C 4YASA 3MD9A 2Y0CA 4BO9A 1PL6A 5HDBB 3BD7A 3D4PA 3DHWC 4MIOA 2IBTA 1W8IA 4IFTA 1ECPA 4OOEA 1KVRA 1Q5PA 3JRXA 4OHKA 5J1SB 2JZOA 4OBWA 4R3UC 2Y4OA 2VDPB 1U0EA 4ND8A 1CPYA 1RCTE 1YUMA 2E87A 4KFTA 5D87A 3KQMA 2ETVA 2FSSA 2L18A 2LCIA 1BQ3A 3B8EA 1T4MA 4KVAA 3BAFA 4QO7A 4UPEA 2ONKA 1R16A 2ZBQA 4TYMA 1L4LA 1O6GA 5DCLA 2AT1A 4EA8A 2FWRA 4DQKA 2DBRA 2AEFA 3M49A 3RJ5A 1JEYB 1UDRA 4TMZA 2ATXA 2PU7A 3MQ4A 4AI6A 1RPJA 4Q3KA 4LRQA 5CT9A 4G75A 3O90A 1KPIA 1XRSB 1L1RA 1LBEA 2G17A 3EG5A 3QX7A 1JDNA 4DJ5X 1Z2OX 1GITA 1Z8NA 3LUPA 4LHSA 4NZ9A 4ZREA 3W5AA 4CEJB 1HO3A 2R48A 4M9CA 4ZIRA 4PQRA 1MTOA 1LDBA 1HE2A 1YJBA 1GPLA 2R79A 5EIHA 4RULA 4LV5B 4FIDA 1YZ3A 3CPHA 2DQ4A 3V4LA 3WSTA 3H6KA 4C3UA 2ES4A 1Z18A 4DREA 5B7PA 5K03A 2MSLA 1TT5A 5K01A 1XLWA 2QE7A 1KDZA 3L92A 2BTEA 1U1CA 4AIIA 2GD1O 3HI4A 2G4VA 1RJDA 3HUTA 3NBAA 1N2EA 3D4BA 4LXXA 1E4OA 2A1UA 4BGVA 1DMSA 2GERA 1PNQA 2Q4RA 3U44A 4YAWA 3AEKB 4OG2A 2IEYA 3B3GA 4LPKA 2AC4A 1GV1A 2ZQYA 3LX8A 4G26A 1HETA 1OJ7A 3JU3A 1NLMA 2WRZA 3JVDA 4C6RA 5JCJA 4XVHA 1WQ3A 2VT7A 4OHPA 1E18A 1PHPA 1UOEA 2V6EA 3CZ9A 3KU4A 4PFSA 4X7RA 5E6SB 4YRPA 3TZCA 2H2WA 3DOHA 2AG6A 1IQ0A <