3UITA

Overall structure of patj/pals1/mals complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
EKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLSHIPLEVLFQGPVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMGGGLEVLFQGPALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD-like protein, MAGUK p55 subfamily member 5, Protein lin
publication title Structure of an L27 domain heterotrimer from cell polarity complex Patj/Pals1/Mals2 reveals mutually independent L27 domain assembly mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
A PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.460 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3uitA02
1.20.1440.360 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3uitA01
3UITA
chains in the Genus database with same CATH superfamily
4PL3A 4NQIA 4EZPA 2KHOA 2F1AA 2Z0NA 2GSCA 3OWGA 3BLBA 2OW6A 1SU7A 2YFBA 2YIAA 3JSBA 4R5JA 4JN4A 3BUBA 3DPOA 2BL7A 5E84A 3FD9A 2A2CA 4EZUA 4F00A 2ZRRA 3LMFA 2D4CA 4I1TA 2YLLA 3CAZA 2MI7A 1TQUA 4NV2A 4HYBA 1TQTA 2NCZA 3RV0A 3I04A 4AZ7A 4M0MA 3DX0A 3BVUA 4PL5A 3G9GA 3CV5A 3O3MB 3VEBA 3F4MA 4HEA1 2JNKA 3DA3A 1SU6A 2C08A 2F7OA 4EZSA 4B9QA 4GXTA 3KDRA 4IW0A 3C7NA 4R5IA 4JNEA 3QA8A 3CZSA 4UDXX 3D4YA 1HWWA 1R5EA 4F01A 3L3OM 1O7DB 2Z0OA 2RADA 1DKXA 3I9V1 2V0OA 2ELBA 4NPHA 4H6HA 1I4LA 1GNLA 2QXLA 4NV5A 4O1PA 3FNBA 3BUQA 3LJ0A 4JNFA 4PO2A 1W3SA 3SDJA 4EZOA 4FM3A 2ND1A 2OZNB 3B53X 3EJSA 2OBMA 2YIVX 2YL6A 3D50A 1SJ8A 2YI8A 2JB2A 1QWNA 2QFFA 4G76A 1JQOA 2X3XA 5HGIA 2PY6A 4FZSA 1I4TA 1E1DA 4AZBA 4EZQA 1OA1A 3ABHA 4JWIA 4AZ6A 3BUPA 2YL8A 4JCVE 4JLCA 3LVTA 2JB3A 4H6IA 4JL9A 2V6EA 2D1LA 3B52X 4IWOA 4EZZA 2EWFA 2YL9A 4FZOA 4BNEA 3RV1A 5TKYA 4YZCA 2WINM 2GA9D 2PMRA 3T4AG 2F7RA 1QX1A 2ALWA 3BVWA 3D2EA 4AZ5A 3VEAA 2Z8YA 2GF4A 4AZHA 1TDPA 2YL5A 3I01A 2JAEA 4AS2A 2WYHA 3Q0KA 4HR1B 3QNIA 2FU2A 2LXYA 4O1OA 2RIOA 3T49A 3LJ2A 3D4ZA 2GAFD 4I1QA 1I4DA 4AZCB 3QNJA 3BVXA 2YIBA 3O3OB 1U5KA 2LM0A 4YZ9A 4G75A 3D51A 3RPMA 2QZGA 4KIKB 3KAVA 3QWEA 4AKVA 5FIGA 3L3PA 4EZWA 3A98A 1I49A 4EZNA 2YFAA 2FUG1 2QGMA 2YI9A 3QE6A 2F7PA 3EJRA 2F7QA 3Q8DA 1E9VA 1X03A 2WYIA 3LJ1A 1OA0A 4IWPA 3DX1A 3BVVA 4JWCA 2EFKA 1SUFA 3SYVA 3DYTA 2A2DA 1URUA 2ZW3A 3DX2A 3BUIA 2O0I1 1R33A 3ER8C 2QKWA 3FBVA 4EZXA 4UDYX 3D2FA 4AZGA 1GNTA 2KKMA 1TQWA 3I39X 3DO9A 3ACOA 3KAWA 4YZDA 5C5BB 2Z0VA 2FICA 4EZRA 1WDZA 4H8SA 4JWDA 2IP6A 4R5LA 3KP9A 3P23A 2JBWA 3DDGA 4D8JA 2P22B 4R5KA 3HAHA 1QWUA 1SU8A 3EJQA 1HTYA 1R34A 5LNK1 4E3CA 3FVVA 2YLAA 1O7DC 4HFVA 3DA4A 3VKHA 2FEFA 4DCNC 1PS3A 3DX4A 2CAZB 4Z7GA 2Q12A 1OAOA 2N3KA 2X3VA 4EZVA 4HR1A 3ER9B 3M3WA 3IAM1 1ZWWA 2ZXQA 2F66B 2RLDA 2OO2A 2EX3B 3L0IA 1LQ7A 4AZCA 2QSBA 2XMXA 3PLTA 3Q84A 1W9MA 2K19A 3T47A 4PL4A 3CZNA 4G6QA 1Y2OA 4KIKA 4AS3A 4FZPA 4WPEA 4EZTA 3F7WA 4IM3A 3UITA 2V1CC 3O3NB 1MJGA 1UPXA 3HAJA 3CVRA 2RAIA 1DKYA 2XTQA 3IAS1 2YKTA 2ETDA 1TQVA 3BUDA 4AZIA 4Z7HA 3GI7A 4DYLA 3B55A 1E2UA 4IM0A 3EJUA 2F1BA 4U6RA 4Q9VA 3I2WA 4HY9A 1YWMA 4JWEA 3DDFA 2ND0A 4IWQA 3EJTA 4R5GA 2F6MB 3T46A 1X04A 2JB1A 5KBPA 2EFLA 2XTRA 2OBLA 5FLEX 1DKZA 3OHXM 1GN9A 4NSWA 4DWLA 3BVTA 4OAUC 3DPPA 4IM2A 1U00A 3CKDA 3EJPA 5C5BA 4WPCA 4ATMA 2OW7A 3DX3A 3DPQA 1TQSA 3ZEDA 4AVMA 3B51X 3D52A 1HXKA 2FYVA 2HGKA 1JQKA 2X5CA 2L1LB 4EZYA 1ZYLA 3LLLA 3VA9A 3SOGA 3T48A 2RAJA 2MJFB 2X3WA 2RT6A 3AJFA 4OAVB 4E81A 1YO7A 2Q13A 2E8GA 2JNSA 2BL8A 2RAKA 3HAIA 3ERCC 2F18A 3OK8A
chains in the Genus database with same CATH topology
4PL3A 4EZPA 5HGIA 2PY6A 1W9MA 3LJ1A 1OA0A 2KHOA 2K19A 3T47A 4IWPA 1E1DA 3OWGA 4PL4A 4EZQA 1OA1A 4G6QA 1SU7A 4JWCA 2YIAA 4JWIA 4KIKA 2YFBA 3JSBA 4R5JA 4JN4A 4JCVE 4JLCA 3DPOA 1SUFA 4AS3A 4EZTA 2JB3A 3F7WA 4H6IA 4IM3A 4JL9A 2V6EA 5E84A 3UITA 2V1CC 2A2DA 3FD9A 3O3NB 1MJGA 2A2CA 1UPXA 4EZUA 4F00A 2ZRRA 1DKYA 3LMFA 2XTQA 4I1TA 3IAS1 3B52X 4IWOA 4EZZA 3ER8C 2EWFA 4NV2A 3FBVA 4EZXA 3RV1A 4HYBA 4UDYX 5TKYA 2NCZA 3D2FA 4Z7HA 1GNTA 3RV0A 3GI7A 4YZCA 3I04A 4M0MA 2KKMA 2WINM 3I39X 3DO9A 2GA9D 3KAWA 4PL5A 1E2UA 4YZDA 3O3MB 4IM0A 3T4AG 3VEBA 3F4MA 4U6RA 4Q9VA 4HEA1 4HY9A 3DA3A 1SU6A 3D2EA 4EZSA 4JWEA 4B9QA 3VEAA 2ND0A 4IWQA 2Z8YA 4EZRA 4GXTA 3KDRA 4IW0A 3C7NA 4R5GA 4JWDA 3T46A 4R5LA 2F6MB 2IP6A 4R5IA 2JB1A 3KP9A 3P23A 3I01A 4JNEA 2JAEA 4AS2A 3QA8A 4D8JA 2XTRA 4HR1B 4UDXX 2P22B 2OBLA 4R5KA 5FLEX 4F01A 4O1OA 3OHXM 1DKZA 3L3OM 1GN9A 3T49A 2RIOA 4DWLA 1SU8A 3LJ2A 4OAUC 3DPPA 4IM2A 4E3CA 5LNK1 1U00A 2GAFD 1DKXA 3I9V1 4HFVA 3DA4A 3VKHA 4NPHA 4H6HA 1GNLA 3DPQA 3QNJA 2QXLA 4NV5A 3ZEDA 2CAZB 3B51X 4O1PA 4Z7GA 2YIBA 3O3OB 1OAOA 3LJ0A 1JQKA 2X5CA 1U5KA 2LM0A 2N3KA 4JNFA 4PO2A 1W3SA 2L1LB 4EZYA 4YZ9A 4G75A 1ZYLA 3SDJA 4EZOA 4FM3A 4KIKB 3KAVA 4HR1A 4EZVA 2ND1A 3ER9B 3VA9A 5FIGA 3T48A 3B53X 4EZWA 3IAM1 2MJFB 3A98A 2RT6A 2OBMA 2YIVX 4EZNA 2F66B 3AJFA 2YFAA 4OAVB 4E81A 1YO7A 2FUG1 2E8GA 2JNSA 2EX3B 2YI9A 3L0IA 1SJ8A 2YI8A 3ERCC 2JB2A 2QFFA 3Q8DA 1E9VA 4G76A 2XMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIT A; 
#chains in the Genus database with same CATH topology
 4PL3 A;  4NQI A;  4EZP A;  2KHO A;  2F1A A;  2Z0N A;  2GSC A;  3OWG A;  3BLB A;  2OW6 A;  1SU7 A;  2YFB A;  2YIA A;  3JSB A;  4R5J A;  4JN4 A;  3BUB A;  3DPO A;  2BL7 A;  5E84 A;  3FD9 A;  2A2C A;  4EZU A;  4F00 A;  2ZRR A;  3LMF A;  2D4C A;  4I1T A;  2YLL A;  3CAZ A;  2MI7 A;  1TQU A;  4NV2 A;  4HYB A;  1TQT A;  2NCZ A;  3RV0 A;  3I04 A;  4AZ7 A;  4M0M A;  3DX0 A;  3BVU A;  4PL5 A;  3G9G A;  3CV5 A;  3O3M B;  3VEB A;  3F4M A;  4HEA 1;  2JNK A;  3DA3 A;  1SU6 A;  2C08 A;  2F7O A;  4EZS A;  4B9Q A;  4GXT A;  3KDR A;  4IW0 A;  3C7N A;  4R5I A;  4JNE A;  3QA8 A;  3CZS A;  4UDX X;  3D4Y A;  1HWW A;  1R5E A;  4F01 A;  3L3O M;  1O7D B;  2Z0O A;  2RAD A;  1DKX A;  3I9V 1;  2V0O A;  2ELB A;  4NPH A;  4H6H A;  1I4L A;  1GNL A;  2QXL A;  4NV5 A;  4O1P A;  3FNB A;  3BUQ A;  3LJ0 A;  4JNF A;  4PO2 A;  1W3S A;  3SDJ A;  4EZO A;  4FM3 A;  2ND1 A;  2OZN B;  3B53 X;  3EJS A;  2OBM A;  2YIV X;  2YL6 A;  3D50 A;  1SJ8 A;  2YI8 A;  2JB2 A;  1QWN A;  2QFF A;  4G76 A;  1JQO A;  2X3X A;  5HGI A;  2PY6 A;  4FZS A;  1I4T A;  1E1D A;  4AZB A;  4EZQ A;  1OA1 A;  3ABH A;  4JWI A;  4AZ6 A;  3BUP A;  2YL8 A;  4JCV E;  4JLC A;  3LVT A;  2JB3 A;  4H6I A;  4JL9 A;  2V6E A;  2D1L A;  3B52 X;  4IWO A;  4EZZ A;  2EWF A;  2YL9 A;  4FZO A;  4BNE A;  3RV1 A;  5TKY A;  4YZC A;  2WIN M;  2GA9 D;  2PMR A;  3T4A G;  2F7R A;  1QX1 A;  2ALW A;  3BVW A;  3D2E A;  4AZ5 A;  3VEA A;  2Z8Y A;  2GF4 A;  4AZH A;  1TDP A;  2YL5 A;  3I01 A;  2JAE A;  4AS2 A;  2WYH A;  3Q0K A;  4HR1 B;  3QNI A;  2FU2 A;  2LXY A;  4O1O A;  2RIO A;  3T49 A;  3LJ2 A;  3D4Z A;  2GAF D;  4I1Q A;  1I4D A;  4AZC B;  3QNJ A;  3BVX A;  2YIB A;  3O3O B;  1U5K A;  2LM0 A;  4YZ9 A;  4G75 A;  3D51 A;  3RPM A;  2QZG A;  4KIK B;  3KAV A;  3QWE A;  4AKV A;  5FIG A;  3L3P A;  4EZW A;  3A98 A;  1I49 A;  4EZN A;  2YFA A;  2FUG 1;  2QGM A;  2YI9 A;  3QE6 A;  2F7P A;  3EJR A;  2F7Q A;  3Q8D A;  1E9V A;  1X03 A;  2WYI A;  3LJ1 A;  1OA0 A;  4IWP A;  3DX1 A;  3BVV A;  4JWC A;  2EFK A;  1SUF A;  3SYV A;  3DYT A;  2A2D A;  1URU A;  2ZW3 A;  3DX2 A;  3BUI A;  2O0I 1;  1R33 A;  3ER8 C;  2QKW A;  3FBV A;  4EZX A;  4UDY X;  3D2F A;  4AZG A;  1GNT A;  2KKM A;  1TQW A;  3I39 X;  3DO9 A;  3ACO A;  3KAW A;  4YZD A;  5C5B B;  2Z0V A;  2FIC A;  4EZR A;  1WDZ A;  4H8S A;  4JWD A;  2IP6 A;  4R5L A;  3KP9 A;  3P23 A;  2JBW A;  3DDG A;  4D8J A;  2P22 B;  4R5K A;  3HAH A;  1QWU A;  1SU8 A;  3EJQ A;  1HTY A;  1R34 A;  5LNK 1;  4E3C A;  3FVV A;  2YLA A;  1O7D C;  4HFV A;  3DA4 A;  3VKH A;  2FEF A;  4DCN C;  1PS3 A;  3DX4 A;  2CAZ B;  4Z7G A;  2Q12 A;  1OAO A;  2N3K A;  2X3V A;  4EZV A;  4HR1 A;  3ER9 B;  3M3W A;  3IAM 1;  1ZWW A;  2ZXQ A;  2F66 B;  2RLD A;  2OO2 A;  2EX3 B;  3L0I A;  1LQ7 A;  4AZC A;  2QSB A;  2XMX A;  3PLT A;  3Q84 A;  1W9M A;  2K19 A;  3T47 A;  4PL4 A;  3CZN A;  4G6Q A;  1Y2O A;  4KIK A;  4AS3 A;  4FZP A;  4WPE A;  4EZT A;  3F7W A;  4IM3 A;  3UIT A;  2V1C C;  3O3N B;  1MJG A;  1UPX A;  3HAJ A;  3CVR A;  2RAI A;  1DKY A;  2XTQ A;  3IAS 1;  2YKT A;  2ETD A;  1TQV A;  3BUD A;  4AZI A;  4Z7H A;  3GI7 A;  4DYL A;  3B55 A;  1E2U A;  4IM0 A;  3EJU A;  2F1B A;  4U6R A;  4Q9V A;  3I2W A;  4HY9 A;  1YWM A;  4JWE A;  3DDF A;  2ND0 A;  4IWQ A;  3EJT A;  4R5G A;  2F6M B;  3T46 A;  1X04 A;  2JB1 A;  5KBP A;  2EFL A;  2XTR A;  2OBL A;  5FLE X;  1DKZ A;  3OHX M;  1GN9 A;  4NSW A;  4DWL A;  3BVT A;  4OAU C;  3DPP A;  4IM2 A;  1U00 A;  3CKD A;  3EJP A;  5C5B A;  4WPC A;  4ATM A;  2OW7 A;  3DX3 A;  3DPQ A;  1TQS A;  3ZED A;  4AVM A;  3B51 X;  3D52 A;  1HXK A;  2FYV A;  2HGK A;  1JQK A;  2X5C A;  2L1L B;  4EZY A;  1ZYL A;  3LLL A;  3VA9 A;  3SOG A;  3T48 A;  2RAJ A;  2MJF B;  2X3W A;  2RT6 A;  3AJF A;  4OAV B;  4E81 A;  1YO7 A;  2Q13 A;  2E8G A;  2JNS A;  2BL8 A;  2RAK A;  3HAI A;  3ERC C;  2F18 A;  3OK8 A; 
#chains in the Genus database with same CATH homology
 4PL3 A;  4EZP A;  5HGI A;  2PY6 A;  1W9M A;  3LJ1 A;  1OA0 A;  2KHO A;  2K19 A;  3T47 A;  4IWP A;  1E1D A;  3OWG A;  4PL4 A;  4EZQ A;  1OA1 A;  4G6Q A;  1SU7 A;  4JWC A;  2YIA A;  4JWI A;  4KIK A;  2YFB A;  3JSB A;  4R5J A;  4JN4 A;  4JCV E;  4JLC A;  3DPO A;  1SUF A;  4AS3 A;  4EZT A;  2JB3 A;  3F7W A;  4H6I A;  4IM3 A;  4JL9 A;  2V6E A;  5E84 A;  3UIT A;  2V1C C;  2A2D A;  3FD9 A;  3O3N B;  1MJG A;  2A2C A;  1UPX A;  4EZU A;  4F00 A;  2ZRR A;  1DKY A;  3LMF A;  2XTQ A;  4I1T A;  3IAS 1;  3B52 X;  4IWO A;  4EZZ A;  3ER8 C;  2EWF A;  4NV2 A;  3FBV A;  4EZX A;  3RV1 A;  4HYB A;  4UDY X;  5TKY A;  2NCZ A;  3D2F A;  4Z7H A;  1GNT A;  3RV0 A;  3GI7 A;  4YZC A;  3I04 A;  4M0M A;  2KKM A;  2WIN M;  3I39 X;  3DO9 A;  2GA9 D;  3KAW A;  4PL5 A;  1E2U A;  4YZD A;  3O3M B;  4IM0 A;  3T4A G;  3VEB A;  3F4M A;  4U6R A;  4Q9V A;  4HEA 1;  4HY9 A;  3DA3 A;  1SU6 A;  3D2E A;  4EZS A;  4JWE A;  4B9Q A;  3VEA A;  2ND0 A;  4IWQ A;  2Z8Y A;  4EZR A;  4GXT A;  3KDR A;  4IW0 A;  3C7N A;  4R5G A;  4JWD A;  3T46 A;  4R5L A;  2F6M B;  2IP6 A;  4R5I A;  2JB1 A;  3KP9 A;  3P23 A;  3I01 A;  4JNE A;  2JAE A;  4AS2 A;  3QA8 A;  4D8J A;  2XTR A;  4HR1 B;  4UDX X;  2P22 B;  2OBL A;  4R5K A;  5FLE X;  4F01 A;  4O1O A;  3OHX M;  1DKZ A;  3L3O M;  1GN9 A;  3T49 A;  2RIO A;  4DWL A;  1SU8 A;  3LJ2 A;  4OAU C;  3DPP A;  4IM2 A;  4E3C A;  5LNK 1;  1U00 A;  2GAF D;  1DKX A;  3I9V 1;  4HFV A;  3DA4 A;  3VKH A;  4NPH A;  4H6H A;  1GNL A;  3DPQ A;  3QNJ A;  2QXL A;  4NV5 A;  3ZED A;  2CAZ B;  3B51 X;  4O1P A;  4Z7G A;  2YIB A;  3O3O B;  1OAO A;  3LJ0 A;  1JQK A;  2X5C A;  1U5K A;  2LM0 A;  2N3K A;  4JNF A;  4PO2 A;  1W3S A;  2L1L B;  4EZY A;  4YZ9 A;  4G75 A;  1ZYL A;  3SDJ A;  4EZO A;  4FM3 A;  4KIK B;  3KAV A;  4HR1 A;  4EZV A;  2ND1 A;  3ER9 B;  3VA9 A;  5FIG A;  3T48 A;  3B53 X;  4EZW A;  3IAM 1;  2MJF B;  3A98 A;  2RT6 A;  2OBM A;  2YIV X;  4EZN A;  2F66 B;  3AJF A;  2YFA A;  4OAV B;  4E81 A;  1YO7 A;  2FUG 1;  2E8G A;  2JNS A;  2EX3 B;  2YI9 A;  3L0I A;  1SJ8 A;  2YI8 A;  3ERC C;  2JB2 A;  2QFF A;  3Q8D A;  1E9V A;  4G76 A;  2XMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...