3UITA

Overall structure of patj/pals1/mals complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
EKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLSHIPLEVLFQGPVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMGGGLEVLFQGPALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords InaD-like protein, MAGUK p55 subfamily member 5, Protein lin
publication title Structure of an L27 domain heterotrimer from cell polarity complex Patj/Pals1/Mals2 reveals mutually independent L27 domain assembly mode
pubmed doi rcsb
source organism Mus musculus
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
A PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.460 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3uitA02
1.20.1440.360 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3uitA01
3UITA
chains in the Genus database with same CATH superfamily
3D2EA 4KIKB 3O3NB 3BVVA 2FICA 1OA1A 3B52X 4F01A 2RIOA 2YI9A 4H8SA 1TQVA 2V0OA 3FNBA 2A2CA 1ZYLA 4DCNC 2OW7A 4EZWA 4AZGA 3CZNA 4JWDA 1U5KA 1OAOA 5E84A 4DYLA 3FD9A 5LNK1 4HY9A 4E81A 3KAWA 5C5BA 3L0IA 4JNFA 4EZSA 4AZ7A 3SDJA 2Q13A 2BL8A 2WINM 4HR1A 3BLBA 3LVTA 1MJGA 3LJ2A 2V1CC 4AZ6A 4FZPA 1X03A 2RADA 1SJ8A 4R5LA 4F00A 2EFLA 3ZEDA 2XMXA 2YL6A 1X04A 3CZSA 2EX3B 3ACOA 3EJQA 1URUA 3L3PA 3OK8A 3DO9A 2F7OA 3LLLA 3DX3A 4EZXA 3QNJA 4PL5A 4I1QA 1QWNA 2O0I1 3DYTA 1E9VA 3CVRA 3T48A 4WPEA 3BVXA 3VEAA 1TQSA 4D8JA 4HEA1 5C5BB 3I04A 2K19A 4IW0A 3SOGA 1Y2OA 4JWEA 3KDRA 4PL3A 4HR1B 2Z8YA 2OZNB 1PS3A 4NQIA 4EZPA 3BVUA 3UITA 3DX0A 4EZUA 3HAIA 2YL8A 2HGKA 2F7QA 2YIAA 4JLCA 3B55A 3EJTA 3HAHA 4ATMA 5TKYA 4EZVA 3JSBA 4YZDA 5FIGA 1DKZA 4BNEA 3ER9B 4R5IA 3F4MA 4JCVE 3BVTA 4HYBA 4IWOA 2ZRRA 3LJ1A 2OBMA 4R5GA 2KKMA 4FZOA 2N3KA 3PLTA 2X5CA 2PY6A 4AVMA 2EFKA 2Z0NA 2FUG1 2JNKA 3A98A 2JB2A 2ND0A 3RV0A 3ER8C 3FVVA 2YL5A 2D4CA 3QE6A 4EZQA 2GA9D 3T46A 2RLDA 1R34A 1OA0A 3D51A 1UPXA 3EJPA 2YLAA 3O3OB 4AKVA 4IM3A 1WDZA 4NV2A 4O1PA 2JAEA 2XTQA 4IWQA 1ZWWA 2ND1A 1GN9A 2QFFA 3KP9A 4OAVB 5KBPA 4FZSA 4AS3A 3D4YA 3DPPA 1DKYA 2EWFA 2ETDA 1SU8A 2YFBA 1QWUA 3B53X 4Z7GA 3M3WA 2XTRA 1JQOA 2C08A 3OHXM 3IAM1 4G6QA 2JBWA 3AJFA 1HXKA 4FM3A 4WPCA 3I2WA 4YZCA 3DA4A 4G75A 4PL4A 1QX1A 2YIVX 1SUFA 2D1LA 1R33A 3O3MB 3QNIA 3LMFA 1U00A 3BVWA 4NV5A 4JL9A 4E3CA 1I4LA 4GXTA 3QA8A 4R5JA 4B9QA 3RV1A 3VKHA 3VEBA 2RAKA 4EZNA 4PO2A 3EJRA 2QZGA 4O1OA 3Q0KA 4AZIA 5HGIA 2X3XA 2JB3A 4Q9VA 4AZBA 1W9MA 2JNSA 3DX2A 2CAZB 1TDPA 4UDXX 2F1BA 3LJ0A 3T4AG 2OW6A 3ABHA 4R5KA 2GAFD 1GNTA 1E1DA 2YIBA 4JWIA 1LQ7A 4IWPA 2FU2A 4EZTA 2RT6A 3DX4A 2GSCA 1W3SA 3DPQA 1JQKA 4AS2A 2QGMA 3CV5A 2QKWA 3SYVA 4EZYA 3G9GA 3RPMA 4AZCA 3I39X 3I9V1 3I01A 1O7DB 4AZ5A 4H6HA 4IM2A 2F1AA 2ELBA 2F66B 1HWWA 3DDFA 2KHOA 3DA3A 2QSBA 4G76A 1YO7A 1HTYA 2Z0OA 2OBLA 2YKTA 4EZOA 2OO2A 3Q84A 3QWEA 2WYIA 1R5EA 2F7RA 2MJFB 3CKDA 2PMRA 1SU6A 3T49A 4HFVA 3F7WA 1SU7A 1O7DC 2IP6A 3Q8DA 2F6MB 4Z7HA 3BUIA 2NCZA 3DX1A 2F7PA 4JN4A 4AZCB 2WYHA 2MI7A 2JB1A 3FBVA 4H6IA 3DDGA 2RAIA 2L1LB 4UDYX 1TQTA 4EZRA 3EJSA 2Z0VA 2V6EA 3BUDA 3C7NA 3HAJA 2YI8A 2E8GA 2P22B 2RAJA 3GI7A 2LXYA 1I49A 1E2UA 2FEFA 3BUBA 2Q12A 3DPOA 1I4DA 3ERCC 2ALWA 3D50A 3VA9A 4KIKA 4NSWA 3T47A 2X3VA 3D4ZA 4DWLA 2YFAA 2QXLA 2YLLA 2GF4A 1GNLA 1YWMA 1TQUA 3KAVA 4I1TA 3D2FA 3EJUA 4M0MA 3D52A 4AZHA 2F18A 1TQWA 4NPHA 2A2DA 3OWGA 4JNEA 3BUQA 3P23A 3BUPA 4YZ9A 3IAS1 3CAZA 2LM0A 4EZZA 2FYVA 1I4TA 4JWCA 4OAUC 5FLEX 1DKXA 2ZXQA 4IM0A 2ZW3A 3B51X 2YL9A 4U6RA 3L3OM 2BL7A 2X3WA
chains in the Genus database with same CATH topology
2NCZA 4JLCA 3D2EA 4KIKB 3O3MB 3O3NB 3LMFA 4JN4A 1U00A 1OA1A 5TKYA 3B52X 4EZVA 4F01A 3JSBA 4JL9A 4NV5A 4E3CA 5FIGA 1DKZA 2JB1A 2RIOA 3FBVA 2YI9A 4GXTA 3ER9B 4H6IA 4R5IA 3F4MA 3QA8A 2A2CA 4JCVE 1ZYLA 4R5JA 4B9QA 3RV1A 4EZWA 3VKHA 3VEBA 4HYBA 4IWOA 4UDYX 2L1LB 4EZNA 2ZRRA 4PO2A 3LJ1A 4EZRA 2OBMA 4JWDA 4O1OA 4R5GA 2KKMA 5HGIA 1SUFA 2N3KA 1U5KA 2X5CA 2JB3A 4Q9VA 2PY6A 1OAOA 5E84A 2V6EA 1W9MA 2JNSA 2CAZB 3C7NA 2FUG1 2JB2A 3A98A 2ND0A 2YI8A 3RV0A 3ER8C 2E8GA 3FD9A 2P22B 4HY9A 4UDXX 5LNK1 4E81A 3KAWA 3L0IA 3LJ0A 4JNFA 4EZQA 2GA9D 3T46A 3T4AG 4EZSA 3GI7A 3SDJA 1OA0A 1E2UA 1UPXA 4R5KA 2GAFD 1GNTA 2WINM 1E1DA 2YIBA 4HR1A 4JWIA 1MJGA 3LJ2A 3DPOA 4IWPA 3ERCC 2V1CC 3O3OB 4EZTA 2RT6A 4IM3A 4NV2A 1SJ8A 4O1PA 1W3SA 4R5LA 3VA9A 3DPQA 4F00A 2JAEA 1JQKA 2XTQA 4IWQA 3ZEDA 2XMXA 4AS2A 4KIKA 2ND1A 1GN9A 2QFFA 4EZYA 3KP9A 2EX3B 3T47A 3I39X 3I9V1 3I01A 4OAVB 4DWLA 4H6HA 2YFAA 2QXLA 4AS3A 3DPPA 4IM2A 1DKYA 1GNLA 2F66B 2EWFA 3KAVA 4I1TA 3D2FA 2KHOA 4M0MA 4Z7HA 3DA3A 3DO9A 4YZDA 4G76A 1YO7A 4EZXA 3QNJA 2OBLA 1SU8A 2YFBA 4PL5A 3B53X 4EZOA 4Z7GA 2XTRA 1E9VA 3T48A 3OHXM 4NPHA 3VEAA 4D8JA 2A2DA 4HEA1 3OWGA 4JNEA 2MJFB 3I04A 3IAM1 2K19A 3P23A 4YZ9A 3IAS1 4G6QA 4IW0A 4JWEA 3AJFA 4FM3A 2LM0A 3KDRA 4EZZA 4PL3A 1SU6A 4HR1B 3T49A 2Z8YA 4YZCA 4JWCA 4HFVA 4OAUC 3F7WA 1DKXA 5FLEX 1SU7A 3DA4A 4EZPA 2IP6A 3UITA 4G75A 4PL4A 3Q8DA 4IM0A 4EZUA 2YIVX 3B51X 2F6MB 4U6RA 3L3OM 2YIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIT A; 
#chains in the Genus database with same CATH topology
 3D2E A;  4KIK B;  3O3N B;  3BVV A;  2FIC A;  1OA1 A;  3B52 X;  4F01 A;  2RIO A;  2YI9 A;  4H8S A;  1TQV A;  2V0O A;  3FNB A;  2A2C A;  1ZYL A;  4DCN C;  2OW7 A;  4EZW A;  4AZG A;  3CZN A;  4JWD A;  1U5K A;  1OAO A;  5E84 A;  4DYL A;  3FD9 A;  5LNK 1;  4HY9 A;  4E81 A;  3KAW A;  5C5B A;  3L0I A;  4JNF A;  4EZS A;  4AZ7 A;  3SDJ A;  2Q13 A;  2BL8 A;  2WIN M;  4HR1 A;  3BLB A;  3LVT A;  1MJG A;  3LJ2 A;  2V1C C;  4AZ6 A;  4FZP A;  1X03 A;  2RAD A;  1SJ8 A;  4R5L A;  4F00 A;  2EFL A;  3ZED A;  2XMX A;  2YL6 A;  1X04 A;  3CZS A;  2EX3 B;  3ACO A;  3EJQ A;  1URU A;  3L3P A;  3OK8 A;  3DO9 A;  2F7O A;  3LLL A;  3DX3 A;  4EZX A;  3QNJ A;  4PL5 A;  4I1Q A;  1QWN A;  2O0I 1;  3DYT A;  1E9V A;  3CVR A;  3T48 A;  4WPE A;  3BVX A;  3VEA A;  1TQS A;  4D8J A;  4HEA 1;  5C5B B;  3I04 A;  2K19 A;  4IW0 A;  3SOG A;  1Y2O A;  4JWE A;  3KDR A;  4PL3 A;  4HR1 B;  2Z8Y A;  2OZN B;  1PS3 A;  4NQI A;  4EZP A;  3BVU A;  3UIT A;  3DX0 A;  4EZU A;  3HAI A;  2YL8 A;  2HGK A;  2F7Q A;  2YIA A;  4JLC A;  3B55 A;  3EJT A;  3HAH A;  4ATM A;  5TKY A;  4EZV A;  3JSB A;  4YZD A;  5FIG A;  1DKZ A;  4BNE A;  3ER9 B;  4R5I A;  3F4M A;  4JCV E;  3BVT A;  4HYB A;  4IWO A;  2ZRR A;  3LJ1 A;  2OBM A;  4R5G A;  2KKM A;  4FZO A;  2N3K A;  3PLT A;  2X5C A;  2PY6 A;  4AVM A;  2EFK A;  2Z0N A;  2FUG 1;  2JNK A;  3A98 A;  2JB2 A;  2ND0 A;  3RV0 A;  3ER8 C;  3FVV A;  2YL5 A;  2D4C A;  3QE6 A;  4EZQ A;  2GA9 D;  3T46 A;  2RLD A;  1R34 A;  1OA0 A;  3D51 A;  1UPX A;  3EJP A;  2YLA A;  3O3O B;  4AKV A;  4IM3 A;  1WDZ A;  4NV2 A;  4O1P A;  2JAE A;  2XTQ A;  4IWQ A;  1ZWW A;  2ND1 A;  1GN9 A;  2QFF A;  3KP9 A;  4OAV B;  5KBP A;  4FZS A;  4AS3 A;  3D4Y A;  3DPP A;  1DKY A;  2EWF A;  2ETD A;  1SU8 A;  2YFB A;  1QWU A;  3B53 X;  4Z7G A;  3M3W A;  2XTR A;  1JQO A;  2C08 A;  3OHX M;  3IAM 1;  4G6Q A;  2JBW A;  3AJF A;  1HXK A;  4FM3 A;  4WPC A;  3I2W A;  4YZC A;  3DA4 A;  4G75 A;  4PL4 A;  1QX1 A;  2YIV X;  1SUF A;  2D1L A;  1R33 A;  3O3M B;  3QNI A;  3LMF A;  1U00 A;  3BVW A;  4NV5 A;  4JL9 A;  4E3C A;  1I4L A;  4GXT A;  3QA8 A;  4R5J A;  4B9Q A;  3RV1 A;  3VKH A;  3VEB A;  2RAK A;  4EZN A;  4PO2 A;  3EJR A;  2QZG A;  4O1O A;  3Q0K A;  4AZI A;  5HGI A;  2X3X A;  2JB3 A;  4Q9V A;  4AZB A;  1W9M A;  2JNS A;  3DX2 A;  2CAZ B;  1TDP A;  4UDX X;  2F1B A;  3LJ0 A;  3T4A G;  2OW6 A;  3ABH A;  4R5K A;  2GAF D;  1GNT A;  1E1D A;  2YIB A;  4JWI A;  1LQ7 A;  4IWP A;  2FU2 A;  4EZT A;  2RT6 A;  3DX4 A;  2GSC A;  1W3S A;  3DPQ A;  1JQK A;  4AS2 A;  2QGM A;  3CV5 A;  2QKW A;  3SYV A;  4EZY A;  3G9G A;  3RPM A;  4AZC A;  3I39 X;  3I9V 1;  3I01 A;  1O7D B;  4AZ5 A;  4H6H A;  4IM2 A;  2F1A A;  2ELB A;  2F66 B;  1HWW A;  3DDF A;  2KHO A;  3DA3 A;  2QSB A;  4G76 A;  1YO7 A;  1HTY A;  2Z0O A;  2OBL A;  2YKT A;  4EZO A;  2OO2 A;  3Q84 A;  3QWE A;  2WYI A;  1R5E A;  2F7R A;  2MJF B;  3CKD A;  2PMR A;  1SU6 A;  3T49 A;  4HFV A;  3F7W A;  1SU7 A;  1O7D C;  2IP6 A;  3Q8D A;  2F6M B;  4Z7H A;  3BUI A;  2NCZ A;  3DX1 A;  2F7P A;  4JN4 A;  4AZC B;  2WYH A;  2MI7 A;  2JB1 A;  3FBV A;  4H6I A;  3DDG A;  2RAI A;  2L1L B;  4UDY X;  1TQT A;  4EZR A;  3EJS A;  2Z0V A;  2V6E A;  3BUD A;  3C7N A;  3HAJ A;  2YI8 A;  2E8G A;  2P22 B;  2RAJ A;  3GI7 A;  2LXY A;  1I49 A;  1E2U A;  2FEF A;  3BUB A;  2Q12 A;  3DPO A;  1I4D A;  3ERC C;  2ALW A;  3D50 A;  3VA9 A;  4KIK A;  4NSW A;  3T47 A;  2X3V A;  3D4Z A;  4DWL A;  2YFA A;  2QXL A;  2YLL A;  2GF4 A;  1GNL A;  1YWM A;  1TQU A;  3KAV A;  4I1T A;  3D2F A;  3EJU A;  4M0M A;  3D52 A;  4AZH A;  2F18 A;  1TQW A;  4NPH A;  2A2D A;  3OWG A;  4JNE A;  3BUQ A;  3P23 A;  3BUP A;  4YZ9 A;  3IAS 1;  3CAZ A;  2LM0 A;  4EZZ A;  2FYV A;  1I4T A;  4JWC A;  4OAU C;  5FLE X;  1DKX A;  2ZXQ A;  4IM0 A;  2ZW3 A;  3B51 X;  2YL9 A;  4U6R A;  3L3O M;  2BL7 A;  2X3W A; 
#chains in the Genus database with same CATH homology
 2NCZ A;  4JLC A;  3D2E A;  4KIK B;  3O3M B;  3O3N B;  3LMF A;  4JN4 A;  1U00 A;  1OA1 A;  5TKY A;  3B52 X;  4EZV A;  4F01 A;  3JSB A;  4JL9 A;  4NV5 A;  4E3C A;  5FIG A;  1DKZ A;  2JB1 A;  2RIO A;  3FBV A;  2YI9 A;  4GXT A;  3ER9 B;  4H6I A;  4R5I A;  3F4M A;  3QA8 A;  2A2C A;  4JCV E;  1ZYL A;  4R5J A;  4B9Q A;  3RV1 A;  4EZW A;  3VKH A;  3VEB A;  4HYB A;  4IWO A;  4UDY X;  2L1L B;  4EZN A;  2ZRR A;  4PO2 A;  3LJ1 A;  4EZR A;  2OBM A;  4JWD A;  4O1O A;  4R5G A;  2KKM A;  5HGI A;  1SUF A;  2N3K A;  1U5K A;  2X5C A;  2JB3 A;  4Q9V A;  2PY6 A;  1OAO A;  5E84 A;  2V6E A;  1W9M A;  2JNS A;  2CAZ B;  3C7N A;  2FUG 1;  2JB2 A;  3A98 A;  2ND0 A;  2YI8 A;  3RV0 A;  3ER8 C;  2E8G A;  3FD9 A;  2P22 B;  4HY9 A;  4UDX X;  5LNK 1;  4E81 A;  3KAW A;  3L0I A;  3LJ0 A;  4JNF A;  4EZQ A;  2GA9 D;  3T46 A;  3T4A G;  4EZS A;  3GI7 A;  3SDJ A;  1OA0 A;  1E2U A;  1UPX A;  4R5K A;  2GAF D;  1GNT A;  2WIN M;  1E1D A;  2YIB A;  4HR1 A;  4JWI A;  1MJG A;  3LJ2 A;  3DPO A;  4IWP A;  3ERC C;  2V1C C;  3O3O B;  4EZT A;  2RT6 A;  4IM3 A;  4NV2 A;  1SJ8 A;  4O1P A;  1W3S A;  4R5L A;  3VA9 A;  3DPQ A;  4F00 A;  2JAE A;  1JQK A;  2XTQ A;  4IWQ A;  3ZED A;  2XMX A;  4AS2 A;  4KIK A;  2ND1 A;  1GN9 A;  2QFF A;  4EZY A;  3KP9 A;  2EX3 B;  3T47 A;  3I39 X;  3I9V 1;  3I01 A;  4OAV B;  4DWL A;  4H6H A;  2YFA A;  2QXL A;  4AS3 A;  3DPP A;  4IM2 A;  1DKY A;  1GNL A;  2F66 B;  2EWF A;  3KAV A;  4I1T A;  3D2F A;  2KHO A;  4M0M A;  4Z7H A;  3DA3 A;  3DO9 A;  4YZD A;  4G76 A;  1YO7 A;  4EZX A;  3QNJ A;  2OBL A;  1SU8 A;  2YFB A;  4PL5 A;  3B53 X;  4EZO A;  4Z7G A;  2XTR A;  1E9V A;  3T48 A;  3OHX M;  4NPH A;  3VEA A;  4D8J A;  2A2D A;  4HEA 1;  3OWG A;  4JNE A;  2MJF B;  3I04 A;  3IAM 1;  2K19 A;  3P23 A;  4YZ9 A;  3IAS 1;  4G6Q A;  4IW0 A;  4JWE A;  3AJF A;  4FM3 A;  2LM0 A;  3KDR A;  4EZZ A;  4PL3 A;  1SU6 A;  4HR1 B;  3T49 A;  2Z8Y A;  4YZC A;  4JWC A;  4HFV A;  4OAU C;  3F7W A;  1DKX A;  5FLE X;  1SU7 A;  3DA4 A;  4EZP A;  2IP6 A;  3UIT A;  4G75 A;  4PL4 A;  3Q8D A;  4IM0 A;  4EZU A;  2YIV X;  3B51 X;  2F6M B;  4U6R A;  3L3O M;  2YIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...