3UITA

Overall structure of patj/pals1/mals complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
EKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLSHIPLEVLFQGPVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMGGGLEVLFQGPALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD-like protein, MAGUK p55 subfamily member 5, Protein lin
publication title Structure of an L27 domain heterotrimer from cell polarity complex Patj/Pals1/Mals2 reveals mutually independent L27 domain assembly mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
A PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.460 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3uitA02
1.20.1440.360 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3uitA01
3UITA
chains in the Genus database with same CATH superfamily
4IM0A 4JNFA 3IAS1 1TQVA 3BUPA 1GNTA 1U5KA 3BUQA 1TQWA 2F18A 3KDRA 2QFFA 3D2EA 3O3MB 3EJUA 3BUIA 1HXKA 3DYTA 2XTRA 4B9QA 2JB2A 1PS3A 1I49A 2YL9A 4U6RA 4AS2A 3QNJA 1SU8A 2GSCA 4FZSA 4IWQA 2KKMA 3VA9A 1O7DB 2MJFB 3BLBA 1W9MA 4IW0A 4GXTA 3B51X 3BUDA 2V1CC 3DX3A 4AZ6A 2JAEA 4YZ9A 2JB1A 2D4CA 2YLAA 1R33A 4H6HA 4EZUA 2CAZB 2YIBA 3T4AG 2X3XA 3D4YA 2EX3B 3BVXA 4EZXA 3OHXM 2FYVA 2ZW3A 3O3OB 2ALWA 4IM2A 2YKTA 3PLTA 1LQ7A 2YL5A 2RAKA 2OW7A 1SUFA 3B53X 3LJ2A 2Q13A 3L3PA 2YL8A 4R5KA 3DA3A 4E3CA 2XMXA 3M3WA 3EJSA 3LJ0A 1TQSA 4JWIA 3IAM1 3ERCC 3CZSA 1X03A 3CV5A 1TQUA 3ABHA 4YZCA 4JNEA 3VKHA 3F7WA 3JSBA 2EFLA 4DYLA 3OWGA 2F7QA 4PL4A 2JBWA 3VEAA 3EJRA 4IWOA 1DKYA 3KAVA 1SU7A 2PY6A 4DCNC 3VEBA 4I1QA 1DKXA 2EFKA 1URUA 5E84A 4D8JA 4F00A 3LLLA 3CZNA 4PO2A 2A2DA 5LNK1 2OW6A 4FZPA 2FICA 2Q12A 5KBPA 2QXLA 2XTQA 3Q84A 3GI7A 1HWWA 1R34A 2NCZA 3A98A 2Z8YA 4AZHA 4EZNA 4KIKB 2JNSA 3EJQA 4HFVA 2YL6A 3DO9A 1TDPA 4JLCA 2F1AA 4UDYX 4JCVE 2GF4A 4WPEA 2A2CA 2K19A 3EJTA 3B52X 3QA8A 3Q0KA 2LXYA 4BNEA 3G9GA 4KIKA 4AKVA 3D50A 4R5JA 3CKDA 1ZWWA 4O1PA 4G75A 1TQTA 1U00A 4EZYA 3DA4A 4G6QA 1X04A 2QSBA 3QNIA 4DWLA 3ER9B 3ACOA 1QWUA 1I4TA 4H8SA 1SJ8A 4G76A 3RPMA 5C5BB 3F4MA 2WYHA 2GA9D 3RV1A 2FUG1 5FIGA 3D51A 5TKYA 2BL7A 2OBLA 2BL8A 4EZQA 2F7OA 3FD9A 2F1BA 1E2UA 3HAHA 4NSWA 2F7RA 3LJ1A 1O7DC 4IM3A 4AZ7A 2YIVX 3BVTA 5C5BA 4JWCA 4AZGA 3ER8C 1OA1A 4HY9A 3FNBA 4PL5A 2Z0OA 2HGKA 3T47A 2FU2A 3DPPA 4HYBA 4AVMA 2N3KA 3T49A 2X3WA 3LVTA 4EZSA 4PL3A 4EZTA 4JL9A 2P22B 2YI9A 2KHOA 3DX4A 3I01A 2C08A 2EWFA 1I4LA 4I1TA 4M0MA 4YZDA 1JQOA 3QWEA 3D52A 3BVUA 3DDGA 3UITA 1Y2OA 2MI7A 2LM0A 1JQKA 3D4ZA 3DX0A 1GN9A 3L3OM 2RAJA 1I4DA 1E9VA 1R5EA 3HAIA 1HTYA 3FVVA 4NQIA 2OBMA 2D1LA 3DX1A 4Z7GA 2F66B 4FZOA 2PMRA 4EZOA 3I39X 4HR1B 4O1OA 3CVRA 5HGIA 4UDXX 2F6MB 4AZCB 4OAVB 2E8GA 2FEFA 4HEA1 2IP6A 3SYVA 1W3SA 4OAUC 3C7NA 3B55A 2ND1A 4NV2A 3RV0A 1QWNA 2OO2A 4Q9VA 2RLDA 3T46A 4NV5A 2QKWA 1QX1A 4HR1A 3SOGA 4EZWA 2ZXQA 3I9V1 3SDJA 4AZCA 1YO7A 2F7PA 4ATMA 3OK8A 3HAJA 2X3VA 3BVWA 3ZEDA 4EZPA 4EZZA 1OA0A 2YI8A 4EZRA 3CAZA 4Z7HA 2RT6A 4IWPA 1E1DA 1GNLA 2YLLA 4R5IA 3KAWA 1OAOA 3DX2A 4H6IA 2X5CA 2Z0VA 4AZ5A 2ETDA 2RADA 4JWEA 3D2FA 2V6EA 2JB3A 3I2WA 1ZYLA 2JNKA 3I04A 2ND0A 1MJGA 3KP9A 1SU6A 3DPOA 4FM3A 3LMFA 2L1LB 3BUBA 3Q8DA 4AZIA 2ZRRA 2OZNB 2YIAA 3T48A 4WPCA 4AZBA 4NPHA 4R5LA 2WINM 2YFAA 4EZVA 3O3NB 3L0IA 5FLEX 3QE6A 3AJFA 4F01A 1DKZA 2QGMA 3EJPA 3DPQA 2RAIA 2V0OA 1WDZA 2O0I1 2GAFD 4JN4A 3BVVA 2WYIA 4JWDA 4AS3A 3DDFA 1YWMA 2RIOA 2Z0NA 2ELBA 3P23A 1UPXA 2QZGA 4E81A 2YFBA 4R5GA 3FBVA
chains in the Genus database with same CATH topology
3VKHA 3F7WA 1W3SA 4OAUC 3F4MA 3C7NA 3JSBA 2ND1A 4IM0A 4JNFA 2GA9D 3RV0A 3RV1A 2FUG1 3IAS1 4NV2A 5FIGA 4Q9VA 5TKYA 3T46A 4NV5A 3OWGA 4HR1A 2OBLA 4EZWA 1GNTA 4PL4A 3I9V1 3SDJA 1U5KA 4EZQA 1YO7A 3FD9A 3VEAA 1E2UA 4IWOA 1DKYA 3LJ1A 3ZEDA 3KAVA 1SU7A 2PY6A 4IM3A 4EZZA 4EZPA 3KDRA 1OA0A 2YIVX 2QFFA 2YI8A 3D2EA 3O3MB 4EZRA 4JWCA 3VEBA 2XTRA 4B9QA 1OA1A 3ER8C 2JB2A 2RT6A 4HY9A 4IWPA 1DKXA 4Z7HA 5E84A 1E1DA 1GNLA 4D8JA 4R5IA 3KAWA 4PL5A 1OAOA 4F00A 4U6RA 4AS2A 4H6IA 3T47A 4PO2A 2X5CA 3DPPA 3QNJA 4HYBA 2A2DA 5LNK1 2N3KA 3T49A 4EZSA 1SU8A 4PL3A 4JWEA 3D2FA 4JL9A 4EZTA 2JB3A 2QXLA 2P22B 4IWQA 2KKMA 2V6EA 2XTQA 3VA9A 1ZYLA 2YI9A 2MJFB 1W9MA 3I04A 2ND0A 1MJGA 3GI7A 4IW0A 3KP9A 4GXTA 1SU6A 2KHOA 3B51X 2V1CC 2NCZA 3A98A 3I01A 2JAEA 2Z8YA 3DPOA 4FM3A 4EZNA 2JB1A 3LMFA 4YZ9A 2EWFA 4KIKB 2L1LB 2JNSA 4H6HA 4EZUA 4HFVA 3Q8DA 3DO9A 4I1TA 2CAZB 4M0MA 2ZRRA 2YIBA 4JLCA 4YZDA 4UDYX 3T4AG 2YIAA 4JCVE 3T48A 2EX3B 4NPHA 4EZXA 2A2CA 3OHXM 2K19A 4R5LA 2WINM 2YFAA 3O3OB 4EZVA 3O3NB 4IM2A 3UITA 3L0IA 3B52X 2LM0A 3QA8A 1JQKA 1GN9A 4KIKA 3L3OM 5FLEX 3AJFA 4R5JA 4F01A 1DKZA 1E9VA 3DPQA 1SUFA 3B53X 3LJ2A 4O1PA 2GAFD 4JN4A 4JWDA 2OBMA 4R5KA 3DA3A 4G75A 4AS3A 4E3CA 2RIOA 4EZYA 1U00A 2XMXA 3DA4A 4Z7GA 4G6QA 3P23A 2F66B 3LJ0A 4EZOA 3I39X 4HR1B 4O1OA 1UPXA 5HGIA 4DWLA 4UDXX 2F6MB 3ER9B 4JWIA 3IAM1 4OAVB 4E81A 3ERCC 2E8GA 2YFBA 4HEA1 4YZCA 2IP6A 1SJ8A 4R5GA 3FBVA 4G76A 4JNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIT A; 
#chains in the Genus database with same CATH topology
 4IM0 A;  4JNF A;  3IAS 1;  1TQV A;  3BUP A;  1GNT A;  1U5K A;  3BUQ A;  1TQW A;  2F18 A;  3KDR A;  2QFF A;  3D2E A;  3O3M B;  3EJU A;  3BUI A;  1HXK A;  3DYT A;  2XTR A;  4B9Q A;  2JB2 A;  1PS3 A;  1I49 A;  2YL9 A;  4U6R A;  4AS2 A;  3QNJ A;  1SU8 A;  2GSC A;  4FZS A;  4IWQ A;  2KKM A;  3VA9 A;  1O7D B;  2MJF B;  3BLB A;  1W9M A;  4IW0 A;  4GXT A;  3B51 X;  3BUD A;  2V1C C;  3DX3 A;  4AZ6 A;  2JAE A;  4YZ9 A;  2JB1 A;  2D4C A;  2YLA A;  1R33 A;  4H6H A;  4EZU A;  2CAZ B;  2YIB A;  3T4A G;  2X3X A;  3D4Y A;  2EX3 B;  3BVX A;  4EZX A;  3OHX M;  2FYV A;  2ZW3 A;  3O3O B;  2ALW A;  4IM2 A;  2YKT A;  3PLT A;  1LQ7 A;  2YL5 A;  2RAK A;  2OW7 A;  1SUF A;  3B53 X;  3LJ2 A;  2Q13 A;  3L3P A;  2YL8 A;  4R5K A;  3DA3 A;  4E3C A;  2XMX A;  3M3W A;  3EJS A;  3LJ0 A;  1TQS A;  4JWI A;  3IAM 1;  3ERC C;  3CZS A;  1X03 A;  3CV5 A;  1TQU A;  3ABH A;  4YZC A;  4JNE A;  3VKH A;  3F7W A;  3JSB A;  2EFL A;  4DYL A;  3OWG A;  2F7Q A;  4PL4 A;  2JBW A;  3VEA A;  3EJR A;  4IWO A;  1DKY A;  3KAV A;  1SU7 A;  2PY6 A;  4DCN C;  3VEB A;  4I1Q A;  1DKX A;  2EFK A;  1URU A;  5E84 A;  4D8J A;  4F00 A;  3LLL A;  3CZN A;  4PO2 A;  2A2D A;  5LNK 1;  2OW6 A;  4FZP A;  2FIC A;  2Q12 A;  5KBP A;  2QXL A;  2XTQ A;  3Q84 A;  3GI7 A;  1HWW A;  1R34 A;  2NCZ A;  3A98 A;  2Z8Y A;  4AZH A;  4EZN A;  4KIK B;  2JNS A;  3EJQ A;  4HFV A;  2YL6 A;  3DO9 A;  1TDP A;  4JLC A;  2F1A A;  4UDY X;  4JCV E;  2GF4 A;  4WPE A;  2A2C A;  2K19 A;  3EJT A;  3B52 X;  3QA8 A;  3Q0K A;  2LXY A;  4BNE A;  3G9G A;  4KIK A;  4AKV A;  3D50 A;  4R5J A;  3CKD A;  1ZWW A;  4O1P A;  4G75 A;  1TQT A;  1U00 A;  4EZY A;  3DA4 A;  4G6Q A;  1X04 A;  2QSB A;  3QNI A;  4DWL A;  3ER9 B;  3ACO A;  1QWU A;  1I4T A;  4H8S A;  1SJ8 A;  4G76 A;  3RPM A;  5C5B B;  3F4M A;  2WYH A;  2GA9 D;  3RV1 A;  2FUG 1;  5FIG A;  3D51 A;  5TKY A;  2BL7 A;  2OBL A;  2BL8 A;  4EZQ A;  2F7O A;  3FD9 A;  2F1B A;  1E2U A;  3HAH A;  4NSW A;  2F7R A;  3LJ1 A;  1O7D C;  4IM3 A;  4AZ7 A;  2YIV X;  3BVT A;  5C5B A;  4JWC A;  4AZG A;  3ER8 C;  1OA1 A;  4HY9 A;  3FNB A;  4PL5 A;  2Z0O A;  2HGK A;  3T47 A;  2FU2 A;  3DPP A;  4HYB A;  4AVM A;  2N3K A;  3T49 A;  2X3W A;  3LVT A;  4EZS A;  4PL3 A;  4EZT A;  4JL9 A;  2P22 B;  2YI9 A;  2KHO A;  3DX4 A;  3I01 A;  2C08 A;  2EWF A;  1I4L A;  4I1T A;  4M0M A;  4YZD A;  1JQO A;  3QWE A;  3D52 A;  3BVU A;  3DDG A;  3UIT A;  1Y2O A;  2MI7 A;  2LM0 A;  1JQK A;  3D4Z A;  3DX0 A;  1GN9 A;  3L3O M;  2RAJ A;  1I4D A;  1E9V A;  1R5E A;  3HAI A;  1HTY A;  3FVV A;  4NQI A;  2OBM A;  2D1L A;  3DX1 A;  4Z7G A;  2F66 B;  4FZO A;  2PMR A;  4EZO A;  3I39 X;  4HR1 B;  4O1O A;  3CVR A;  5HGI A;  4UDX X;  2F6M B;  4AZC B;  4OAV B;  2E8G A;  2FEF A;  4HEA 1;  2IP6 A;  3SYV A;  1W3S A;  4OAU C;  3C7N A;  3B55 A;  2ND1 A;  4NV2 A;  3RV0 A;  1QWN A;  2OO2 A;  4Q9V A;  2RLD A;  3T46 A;  4NV5 A;  2QKW A;  1QX1 A;  4HR1 A;  3SOG A;  4EZW A;  2ZXQ A;  3I9V 1;  3SDJ A;  4AZC A;  1YO7 A;  2F7P A;  4ATM A;  3OK8 A;  3HAJ A;  2X3V A;  3BVW A;  3ZED A;  4EZP A;  4EZZ A;  1OA0 A;  2YI8 A;  4EZR A;  3CAZ A;  4Z7H A;  2RT6 A;  4IWP A;  1E1D A;  1GNL A;  2YLL A;  4R5I A;  3KAW A;  1OAO A;  3DX2 A;  4H6I A;  2X5C A;  2Z0V A;  4AZ5 A;  2ETD A;  2RAD A;  4JWE A;  3D2F A;  2V6E A;  2JB3 A;  3I2W A;  1ZYL A;  2JNK A;  3I04 A;  2ND0 A;  1MJG A;  3KP9 A;  1SU6 A;  3DPO A;  4FM3 A;  3LMF A;  2L1L B;  3BUB A;  3Q8D A;  4AZI A;  2ZRR A;  2OZN B;  2YIA A;  3T48 A;  4WPC A;  4AZB A;  4NPH A;  4R5L A;  2WIN M;  2YFA A;  4EZV A;  3O3N B;  3L0I A;  5FLE X;  3QE6 A;  3AJF A;  4F01 A;  1DKZ A;  2QGM A;  3EJP A;  3DPQ A;  2RAI A;  2V0O A;  1WDZ A;  2O0I 1;  2GAF D;  4JN4 A;  3BVV A;  2WYI A;  4JWD A;  4AS3 A;  3DDF A;  1YWM A;  2RIO A;  2Z0N A;  2ELB A;  3P23 A;  1UPX A;  2QZG A;  4E81 A;  2YFB A;  4R5G A;  3FBV A; 
#chains in the Genus database with same CATH homology
 3VKH A;  3F7W A;  1W3S A;  4OAU C;  3F4M A;  3C7N A;  3JSB A;  2ND1 A;  4IM0 A;  4JNF A;  2GA9 D;  3RV0 A;  3RV1 A;  2FUG 1;  3IAS 1;  4NV2 A;  5FIG A;  4Q9V A;  5TKY A;  3T46 A;  4NV5 A;  3OWG A;  4HR1 A;  2OBL A;  4EZW A;  1GNT A;  4PL4 A;  3I9V 1;  3SDJ A;  1U5K A;  4EZQ A;  1YO7 A;  3FD9 A;  3VEA A;  1E2U A;  4IWO A;  1DKY A;  3LJ1 A;  3ZED A;  3KAV A;  1SU7 A;  2PY6 A;  4IM3 A;  4EZZ A;  4EZP A;  3KDR A;  1OA0 A;  2YIV X;  2QFF A;  2YI8 A;  3D2E A;  3O3M B;  4EZR A;  4JWC A;  3VEB A;  2XTR A;  4B9Q A;  1OA1 A;  3ER8 C;  2JB2 A;  2RT6 A;  4HY9 A;  4IWP A;  1DKX A;  4Z7H A;  5E84 A;  1E1D A;  1GNL A;  4D8J A;  4R5I A;  3KAW A;  4PL5 A;  1OAO A;  4F00 A;  4U6R A;  4AS2 A;  4H6I A;  3T47 A;  4PO2 A;  2X5C A;  3DPP A;  3QNJ A;  4HYB A;  2A2D A;  5LNK 1;  2N3K A;  3T49 A;  4EZS A;  1SU8 A;  4PL3 A;  4JWE A;  3D2F A;  4JL9 A;  4EZT A;  2JB3 A;  2QXL A;  2P22 B;  4IWQ A;  2KKM A;  2V6E A;  2XTQ A;  3VA9 A;  1ZYL A;  2YI9 A;  2MJF B;  1W9M A;  3I04 A;  2ND0 A;  1MJG A;  3GI7 A;  4IW0 A;  3KP9 A;  4GXT A;  1SU6 A;  2KHO A;  3B51 X;  2V1C C;  2NCZ A;  3A98 A;  3I01 A;  2JAE A;  2Z8Y A;  3DPO A;  4FM3 A;  4EZN A;  2JB1 A;  3LMF A;  4YZ9 A;  2EWF A;  4KIK B;  2L1L B;  2JNS A;  4H6H A;  4EZU A;  4HFV A;  3Q8D A;  3DO9 A;  4I1T A;  2CAZ B;  4M0M A;  2ZRR A;  2YIB A;  4JLC A;  4YZD A;  4UDY X;  3T4A G;  2YIA A;  4JCV E;  3T48 A;  2EX3 B;  4NPH A;  4EZX A;  2A2C A;  3OHX M;  2K19 A;  4R5L A;  2WIN M;  2YFA A;  3O3O B;  4EZV A;  3O3N B;  4IM2 A;  3UIT A;  3L0I A;  3B52 X;  2LM0 A;  3QA8 A;  1JQK A;  1GN9 A;  4KIK A;  3L3O M;  5FLE X;  3AJF A;  4R5J A;  4F01 A;  1DKZ A;  1E9V A;  3DPQ A;  1SUF A;  3B53 X;  3LJ2 A;  4O1P A;  2GAF D;  4JN4 A;  4JWD A;  2OBM A;  4R5K A;  3DA3 A;  4G75 A;  4AS3 A;  4E3C A;  2RIO A;  4EZY A;  1U00 A;  2XMX A;  3DA4 A;  4Z7G A;  4G6Q A;  3P23 A;  2F66 B;  3LJ0 A;  4EZO A;  3I39 X;  4HR1 B;  4O1O A;  1UPX A;  5HGI A;  4DWL A;  4UDX X;  2F6M B;  3ER9 B;  4JWI A;  3IAM 1;  4OAV B;  4E81 A;  3ERC C;  2E8G A;  2YFB A;  4HEA 1;  4YZC A;  2IP6 A;  1SJ8 A;  4R5G A;  3FBV A;  4G76 A;  4JNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...