3UITA

Overall structure of patj/pals1/mals complex
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
256
structure length
256
Chain Sequence
b'EKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQLKGQLSHIPLEVLFQGPVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMGGGLEVLFQGPALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD-like protein, MAGUK p55 subfamily member 5, Protein lin
publication title Structure of an L27 domain heterotrimer from cell polarity complex Patj/Pals1/Mals2 reveals mutually independent L27 domain assembly mode
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 92
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09045 L27_2 L27_2
A PF09060 L27_N L27_N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.460 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3uitA02
1.20.1440.360 Mainly Alpha Up-down Bundle de novo design (two linked rop proteins) de novo design (two linked rop proteins) 3uitA01
3UITA
chains in the Genus database with same CATH superfamily
2YIBA 4FZSA 4F01A 2QFFA 2YFBA 4IWOA 2JB3A 2OZNB 2P22B 4JCVE 4O1PA 2F66B 1DKYA 3BUDA 4JL9A 2D4CA 3FVVA 1GNLA 3IAM1 1W9MA 1X03A 2QKWA 2F7PA 2Q13A 2V6EA 3P23A 4DWLA 3OHXM 3DYTA 1LQ7A 3QNIA 2CAZB 3B51X 3DO9A 2QZGA 3F4MA 4UDXX 4Z7HA 5LNK1 2YI9A 2MJFB 1TQTA 4OAVB 4YZCA 2MI7A 4F00A 2YL6A 4EZXA 4KIKB 3JSBA 1SU6A 1HXKA 2YLLA 1OAOA 2F1AA 1ZYLA 3ER9B 4I1TA 3I39X 4H6HA 2RIOA 1GN9A 3A98A 1R34A 3KP9A 1HWWA 2YIVX 2YIAA 3D51A 3EJRA 2BL8A 4JWCA 2FICA 1O7DB 1GNTA 1DKXA 2RAKA 4R5KA 3CKDA 2V1CC 1MJGA 4BNEA 4HYBA 2OW7A 4AZCA 3DA4A 3FD9A 3B53X 3EJTA 3DPPA 1TQUA 3G9GA 3CV5A 4JNFA 5FIGA 4AKVA 4Q9VA 2L1LB 3D4YA 3EJPA 3LVTA 1W3SA 3BVTA 4NSWA 2KKMA 2QSBA 1I49A 3ER8C 1E2UA 2QXLA 2F7OA 4NQIA 4FZOA 1YO7A 4I1QA 5KBPA 1JQKA 2GSCA 3ABHA 3QNJA 2FEFA 2RLDA 3T49A 4IWPA 1E1DA 4FM3A 1TQVA 4H6IA 3SOGA 4EZVA 4HR1B 1I4DA 2BL7A 3ZEDA 3BVUA 1DKZA 2OW6A 3D4ZA 3LJ0A 2Z0NA 1HTYA 3BUQA 1TQWA 4R5LA 2OBMA 2N3KA 4AZGA 4M0MA 3VEAA 3F7WA 2JB1A 4YZDA 4Z7GA 4HFVA 1U5KA 2JAEA 4AZ7A 2V0OA 3OWGA 2YFAA 4E3CA 3GI7A 2XMXA 4JWEA 3UITA 4AZ6A 2F1BA 3I01A 2EFLA 4R5GA 3LLLA 3HAJA 3VKHA 4PO2A 5C5BA 2GF4A 4EZWA 3EJQA 3EJSA 2FU2A 4EZTA 1I4TA 3O3OB 4IM2A 4R5IA 1R5EA 5TKYA 4UDYX 4G75A 4NV5A 1QX1A 4D8JA 2FYVA 1I4LA 3BUPA 4EZOA 3CVRA 3ACOA 3I9V1 4ATMA 4IM3A 2RADA 2WYHA 4YZ9A 3DX4A 2RAJA 4AS2A 2Q12A 2JB2A 3BUIA 2F7RA 2A2CA 2JBWA 4O1OA 4NPHA 2ZXQA 4PL5A 1URUA 2X5CA 3SDJA 2GA9D 3D52A 2HGKA 4PL3A 2FUG1 3Q84A 2QGMA 3DA3A 2ETDA 3T47A 2XTRA 3O3NB 3D2EA 2WYIA 2O0I1 3DPQA 2F18A 3IAS1 2LM0A 4EZNA 4NV2A 3BVWA 1R33A 3DX0A 2A2DA 3BUBA 1E9VA 3DX2A 1OA0A 2PY6A 3KAVA 3PLTA 3Q8DA 1SU8A 1UPXA 1WDZA 3Q0KA 2ALWA 3KAWA 1QWNA 4IWQA 4GXTA 2RAIA 4EZRA 3DX1A 4EZZA 1JQOA 4HEA1 4OAUC 3C7NA 3DX3A 1QWUA 3D50A 2ND0A 3L3PA 2GAFD 1YWMA 2X3WA 3DDFA 3QWEA 3I2WA 4AZCB 4R5JA 2XTQA 2ND1A 2EX3B 5E84A 3RV0A 2X3VA 4E81A 4H8SA 1TDPA 2RT6A 4AS3A 3CZSA 3QE6A 2C08A 2D1LA 4EZYA 4G76A 2E8GA 4AZIA 2Z0OA 4PL4A 3HAHA 4FZPA 4HY9A 2YL8A 3CZNA 2WINM 3KDRA 3D2FA 3RPMA 4AVMA 4AZHA 3QA8A 4EZSA 3B55A 3LJ2A 2YL5A 1PS3A 4WPEA 2X3XA 4JN4A 2ZRRA 3B52X 3DPOA 4HR1A 1U00A 4IW0A 4DCNC 2KHOA 4WPCA 3BVVA 3I04A 3LJ1A 1O7DC 3AJFA 4IM0A 2JNKA 3OK8A 1OA1A 3L3OM 5FLEX 3VEBA 1SUFA 3SYVA 1SJ8A 2ELBA 3FNBA 1Y2OA 3T4AG 3O3MB 5HGIA 1SU7A 2F6MB 2LXYA 2YLAA 2OO2A 4B9QA 3DDGA 4G6QA 2YL9A 3HAIA 2F7QA 1X04A 2IP6A 1ZWWA 3L0IA 2PMRA 2YKTA 3CAZA 4AZ5A 5C5BB 2OBLA 1TQSA 4KIKA 3T48A 3M3WA 3BVXA 2NCZA 3BLBA 2K19A 4EZPA 2Z0VA 4DYLA 2ZW3A 2YI8A 4JNEA 4JLCA 3T46A 4JWIA 3ERCC 4EZQA 4EZUA 2EFKA 2EWFA 2Z8YA 4AZBA 3LMFA 3VA9A 2JNSA 3RV1A 4U6RA 4JWDA 3FBVA 3EJUA
chains in the Genus database with same CATH topology
2YIBA 4F01A 2QFFA 2YFBA 4IWOA 4PL5A 1YO7A 2X5CA 2JB3A 3SDJA 2WINM 1JQKA 2GA9D 4PL3A 3KDRA 2FUG1 3D2FA 2P22B 3QNJA 4EZSA 3QA8A 4JCVE 4O1PA 2F66B 1DKYA 3DA3A 3LJ2A 3T49A 4IWPA 4JL9A 3T47A 1E1DA 4FM3A 2XTRA 4JN4A 3O3NB 2ZRRA 1GNLA 3D2EA 4H6IA 3IAM1 3B52X 3DPOA 1W9MA 4HR1A 4EZVA 1U00A 3DPQA 4HR1B 3P23A 3IAS1 2V6EA 2LM0A 4IW0A 4EZNA 4NV2A 4DWLA 2KHOA 3OHXM 3LJ1A 3I04A 3ZEDA 1DKZA 3AJFA 2CAZB 3B51X 4IM0A 3DO9A 3LJ0A 2A2DA 1E9VA 1OA0A 2PY6A 3KAVA 4R5LA 4UDXX 1OA1A 2OBMA 3L3OM 5FLEX 3F4MA 4Z7HA 3VEBA 2N3KA 2YI9A 2MJFB 1SUFA 3Q8DA 4OAVB 1SU8A 4M0MA 4YZCA 1UPXA 3VEAA 4F00A 3F7WA 4EZXA 1SJ8A 4KIKB 2JB1A 3JSBA 1SU6A 4YZDA 3KAWA 4Z7GA 4HFVA 4IWQA 1U5KA 3T4AG 3O3MB 2JAEA 4GXTA 1OAOA 5HGIA 1SU7A 1ZYLA 2F6MB 3FBVA 4EZRA 3ER9B 3OWGA 2YFAA 4I1TA 3I39X 4H6HA 2RIOA 1GN9A 3A98A 4E3CA 4EZZA 3GI7A 2XMXA 4JWEA 5LNK1 3UITA 4B9QA 3KP9A 2YIVX 4HEA1 2YIAA 3I01A 4G6QA 4OAUC 3C7NA 4R5GA 3VKHA 2IP6A 3L0IA 2ND0A 4JWCA 4PO2A 2GAFD 4EZWA 2OBLA 1GNTA 1DKXA 4R5KA 2V1CC 1MJGA 4EZTA 4KIKA 4HYBA 3O3OB 3T48A 4IM2A 4R5IA 5TKYA 4UDYX 4G75A 3DA4A 4NV5A 2NCZA 3FD9A 4R5JA 3B53X 2XTQA 2ND1A 4D8JA 2EX3B 3DPPA 4EZPA 2K19A 5E84A 3RV0A 4E81A 4EZOA 2YI8A 4JNFA 4JNEA 5FIGA 2RT6A 4JLCA 4AS3A 3T46A 4JWIA 3ERCC 4Q9VA 2L1LB 3I9V1 4IM3A 1W3SA 4EZYA 4EZQA 4G76A 4YZ9A 2E8GA 4EZUA 2KKMA 4AS2A 2EWFA 2Z8YA 2JB2A 3ER8C 4PL4A 3LMFA 1E2UA 2QXLA 2JNSA 3VA9A 2A2CA 3RV1A 4U6RA 4JWDA 4O1OA 4NPHA 4HY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIT A; 
#chains in the Genus database with same CATH topology
 2YIB A;  4FZS A;  4F01 A;  2QFF A;  2YFB A;  4IWO A;  2JB3 A;  2OZN B;  2P22 B;  4JCV E;  4O1P A;  2F66 B;  1DKY A;  3BUD A;  4JL9 A;  2D4C A;  3FVV A;  1GNL A;  3IAM 1;  1W9M A;  1X03 A;  2QKW A;  2F7P A;  2Q13 A;  2V6E A;  3P23 A;  4DWL A;  3OHX M;  3DYT A;  1LQ7 A;  3QNI A;  2CAZ B;  3B51 X;  3DO9 A;  2QZG A;  3F4M A;  4UDX X;  4Z7H A;  5LNK 1;  2YI9 A;  2MJF B;  1TQT A;  4OAV B;  4YZC A;  2MI7 A;  4F00 A;  2YL6 A;  4EZX A;  4KIK B;  3JSB A;  1SU6 A;  1HXK A;  2YLL A;  1OAO A;  2F1A A;  1ZYL A;  3ER9 B;  4I1T A;  3I39 X;  4H6H A;  2RIO A;  1GN9 A;  3A98 A;  1R34 A;  3KP9 A;  1HWW A;  2YIV X;  2YIA A;  3D51 A;  3EJR A;  2BL8 A;  4JWC A;  2FIC A;  1O7D B;  1GNT A;  1DKX A;  2RAK A;  4R5K A;  3CKD A;  2V1C C;  1MJG A;  4BNE A;  4HYB A;  2OW7 A;  4AZC A;  3DA4 A;  3FD9 A;  3B53 X;  3EJT A;  3DPP A;  1TQU A;  3G9G A;  3CV5 A;  4JNF A;  5FIG A;  4AKV A;  4Q9V A;  2L1L B;  3D4Y A;  3EJP A;  3LVT A;  1W3S A;  3BVT A;  4NSW A;  2KKM A;  2QSB A;  1I49 A;  3ER8 C;  1E2U A;  2QXL A;  2F7O A;  4NQI A;  4FZO A;  1YO7 A;  4I1Q A;  5KBP A;  1JQK A;  2GSC A;  3ABH A;  3QNJ A;  2FEF A;  2RLD A;  3T49 A;  4IWP A;  1E1D A;  4FM3 A;  1TQV A;  4H6I A;  3SOG A;  4EZV A;  4HR1 B;  1I4D A;  2BL7 A;  3ZED A;  3BVU A;  1DKZ A;  2OW6 A;  3D4Z A;  3LJ0 A;  2Z0N A;  1HTY A;  3BUQ A;  1TQW A;  4R5L A;  2OBM A;  2N3K A;  4AZG A;  4M0M A;  3VEA A;  3F7W A;  2JB1 A;  4YZD A;  4Z7G A;  4HFV A;  1U5K A;  2JAE A;  4AZ7 A;  2V0O A;  3OWG A;  2YFA A;  4E3C A;  3GI7 A;  2XMX A;  4JWE A;  3UIT A;  4AZ6 A;  2F1B A;  3I01 A;  2EFL A;  4R5G A;  3LLL A;  3HAJ A;  3VKH A;  4PO2 A;  5C5B A;  2GF4 A;  4EZW A;  3EJQ A;  3EJS A;  2FU2 A;  4EZT A;  1I4T A;  3O3O B;  4IM2 A;  4R5I A;  1R5E A;  5TKY A;  4UDY X;  4G75 A;  4NV5 A;  1QX1 A;  4D8J A;  2FYV A;  1I4L A;  3BUP A;  4EZO A;  3CVR A;  3ACO A;  3I9V 1;  4ATM A;  4IM3 A;  2RAD A;  2WYH A;  4YZ9 A;  3DX4 A;  2RAJ A;  4AS2 A;  2Q12 A;  2JB2 A;  3BUI A;  2F7R A;  2A2C A;  2JBW A;  4O1O A;  4NPH A;  2ZXQ A;  4PL5 A;  1URU A;  2X5C A;  3SDJ A;  2GA9 D;  3D52 A;  2HGK A;  4PL3 A;  2FUG 1;  3Q84 A;  2QGM A;  3DA3 A;  2ETD A;  3T47 A;  2XTR A;  3O3N B;  3D2E A;  2WYI A;  2O0I 1;  3DPQ A;  2F18 A;  3IAS 1;  2LM0 A;  4EZN A;  4NV2 A;  3BVW A;  1R33 A;  3DX0 A;  2A2D A;  3BUB A;  1E9V A;  3DX2 A;  1OA0 A;  2PY6 A;  3KAV A;  3PLT A;  3Q8D A;  1SU8 A;  1UPX A;  1WDZ A;  3Q0K A;  2ALW A;  3KAW A;  1QWN A;  4IWQ A;  4GXT A;  2RAI A;  4EZR A;  3DX1 A;  4EZZ A;  1JQO A;  4HEA 1;  4OAU C;  3C7N A;  3DX3 A;  1QWU A;  3D50 A;  2ND0 A;  3L3P A;  2GAF D;  1YWM A;  2X3W A;  3DDF A;  3QWE A;  3I2W A;  4AZC B;  4R5J A;  2XTQ A;  2ND1 A;  2EX3 B;  5E84 A;  3RV0 A;  2X3V A;  4E81 A;  4H8S A;  1TDP A;  2RT6 A;  4AS3 A;  3CZS A;  3QE6 A;  2C08 A;  2D1L A;  4EZY A;  4G76 A;  2E8G A;  4AZI A;  2Z0O A;  4PL4 A;  3HAH A;  4FZP A;  4HY9 A;  2YL8 A;  3CZN A;  2WIN M;  3KDR A;  3D2F A;  3RPM A;  4AVM A;  4AZH A;  3QA8 A;  4EZS A;  3B55 A;  3LJ2 A;  2YL5 A;  1PS3 A;  4WPE A;  2X3X A;  4JN4 A;  2ZRR A;  3B52 X;  3DPO A;  4HR1 A;  1U00 A;  4IW0 A;  4DCN C;  2KHO A;  4WPC A;  3BVV A;  3I04 A;  3LJ1 A;  1O7D C;  3AJF A;  4IM0 A;  2JNK A;  3OK8 A;  1OA1 A;  3L3O M;  5FLE X;  3VEB A;  1SUF A;  3SYV A;  1SJ8 A;  2ELB A;  3FNB A;  1Y2O A;  3T4A G;  3O3M B;  5HGI A;  1SU7 A;  2F6M B;  2LXY A;  2YLA A;  2OO2 A;  4B9Q A;  3DDG A;  4G6Q A;  2YL9 A;  3HAI A;  2F7Q A;  1X04 A;  2IP6 A;  1ZWW A;  3L0I A;  2PMR A;  2YKT A;  3CAZ A;  4AZ5 A;  5C5B B;  2OBL A;  1TQS A;  4KIK A;  3T48 A;  3M3W A;  3BVX A;  2NCZ A;  3BLB A;  2K19 A;  4EZP A;  2Z0V A;  4DYL A;  2ZW3 A;  2YI8 A;  4JNE A;  4JLC A;  3T46 A;  4JWI A;  3ERC C;  4EZQ A;  4EZU A;  2EFK A;  2EWF A;  2Z8Y A;  4AZB A;  3LMF A;  3VA9 A;  2JNS A;  3RV1 A;  4U6R A;  4JWD A;  3FBV A;  3EJU A; 
#chains in the Genus database with same CATH homology
 2YIB A;  4F01 A;  2QFF A;  2YFB A;  4IWO A;  4PL5 A;  1YO7 A;  2X5C A;  2JB3 A;  3SDJ A;  2WIN M;  1JQK A;  2GA9 D;  4PL3 A;  3KDR A;  2FUG 1;  3D2F A;  2P22 B;  3QNJ A;  4EZS A;  3QA8 A;  4JCV E;  4O1P A;  2F66 B;  1DKY A;  3DA3 A;  3LJ2 A;  3T49 A;  4IWP A;  4JL9 A;  3T47 A;  1E1D A;  4FM3 A;  2XTR A;  4JN4 A;  3O3N B;  2ZRR A;  1GNL A;  3D2E A;  4H6I A;  3IAM 1;  3B52 X;  3DPO A;  1W9M A;  4HR1 A;  4EZV A;  1U00 A;  3DPQ A;  4HR1 B;  3P23 A;  3IAS 1;  2V6E A;  2LM0 A;  4IW0 A;  4EZN A;  4NV2 A;  4DWL A;  2KHO A;  3OHX M;  3LJ1 A;  3I04 A;  3ZED A;  1DKZ A;  3AJF A;  2CAZ B;  3B51 X;  4IM0 A;  3DO9 A;  3LJ0 A;  2A2D A;  1E9V A;  1OA0 A;  2PY6 A;  3KAV A;  4R5L A;  4UDX X;  1OA1 A;  2OBM A;  3L3O M;  5FLE X;  3F4M A;  4Z7H A;  3VEB A;  2N3K A;  2YI9 A;  2MJF B;  1SUF A;  3Q8D A;  4OAV B;  1SU8 A;  4M0M A;  4YZC A;  1UPX A;  3VEA A;  4F00 A;  3F7W A;  4EZX A;  1SJ8 A;  4KIK B;  2JB1 A;  3JSB A;  1SU6 A;  4YZD A;  3KAW A;  4Z7G A;  4HFV A;  4IWQ A;  1U5K A;  3T4A G;  3O3M B;  2JAE A;  4GXT A;  1OAO A;  5HGI A;  1SU7 A;  1ZYL A;  2F6M B;  3FBV A;  4EZR A;  3ER9 B;  3OWG A;  2YFA A;  4I1T A;  3I39 X;  4H6H A;  2RIO A;  1GN9 A;  3A98 A;  4E3C A;  4EZZ A;  3GI7 A;  2XMX A;  4JWE A;  5LNK 1;  3UIT A;  4B9Q A;  3KP9 A;  2YIV X;  4HEA 1;  2YIA A;  3I01 A;  4G6Q A;  4OAU C;  3C7N A;  4R5G A;  3VKH A;  2IP6 A;  3L0I A;  2ND0 A;  4JWC A;  4PO2 A;  2GAF D;  4EZW A;  2OBL A;  1GNT A;  1DKX A;  4R5K A;  2V1C C;  1MJG A;  4EZT A;  4KIK A;  4HYB A;  3O3O B;  3T48 A;  4IM2 A;  4R5I A;  5TKY A;  4UDY X;  4G75 A;  3DA4 A;  4NV5 A;  2NCZ A;  3FD9 A;  4R5J A;  3B53 X;  2XTQ A;  2ND1 A;  4D8J A;  2EX3 B;  3DPP A;  4EZP A;  2K19 A;  5E84 A;  3RV0 A;  4E81 A;  4EZO A;  2YI8 A;  4JNF A;  4JNE A;  5FIG A;  2RT6 A;  4JLC A;  4AS3 A;  3T46 A;  4JWI A;  3ERC C;  4Q9V A;  2L1L B;  3I9V 1;  4IM3 A;  1W3S A;  4EZY A;  4EZQ A;  4G76 A;  4YZ9 A;  2E8G A;  4EZU A;  2KKM A;  4AS2 A;  2EWF A;  2Z8Y A;  2JB2 A;  3ER8 C;  4PL4 A;  3LMF A;  1E2U A;  2QXL A;  2JNS A;  3VA9 A;  2A2C A;  3RV1 A;  4U6R A;  4JWD A;  4O1O A;  4NPH A;  4HY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...