The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
112
|
sequence length |
288
|
structure length |
281
|
Chain Sequence |
LTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQPFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGAARDSLREQGETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRLLDYLGAAALGLTSASEETFHPRPFGQLRAFFEESDAQALAPYLQSQYREFFQLSPKAQKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The Crystal Structure of Protein PA2201 from Pseudomonas aeruginosa
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Pseudomonas aeruginosa
|
molecule keywords |
hypothetical protein PA2201
|
total genus |
112
|
structure length |
281
|
sequence length |
288
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2005-12-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF08929 | DUF1911 | Domain of unknown function (DUF1911) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | PA2201 C-terminal domain-like | PA2201 C-terminal domain-like | ||
Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | PA2201 N-terminal domain-like |
#chains in the Genus database with same CATH superfamily 2FEF A; #chains in the Genus database with same CATH topology 1JQO A; 1W3S A; 3FBV A; 1U5K A; 4PL3 A; 2IP6 A; 2CAZ B; 2RLD A; 2L1L B; 4G75 A; 4Z7G A; 4DWL A; 4Z7H A; 3AJF A; 2QZG A; 2BL7 A; 4YZ9 A; 2JBW A; 2XMX A; 4AS3 A; 2P22 B; 3DO9 A; 2QGM A; 3I9V 1; 3L0I A; 5HGI A; 4Q9V A; 3VA9 A; 3FNB A; 4O1P A; 2V1C C; 4U6R A; 2F6M B; 4OAV B; 3IAS 1; 4YZD A; 1TDP A; 1SJ8 A; 2YFB A; 2XTQ A; 3KP9 A; 2MJF B; 2XTR A; 2FU2 A; 2JB1 A; 2RAD A; 3JSB A; 3B55 A; 4YZC A; 2BL8 A; 1YO7 A; 4HFV A; 4AS2 A; 2ETD A; 2V6E A; 3LJ1 A; 2A2D A; 5LNK 1; 4I1T A; 2F66 B; 4OAU C; 4NV2 A; 4O1O A; 4JCV E; 4PL5 A; 2JB3 A; 4GXT A; 3SDJ A; 4G76 A; 2K19 A; 2A2C A; 2ZRR A; 4HEA 1; 2JAE A; 2KKM A; 2FEF A; 3F4M A; 2RIO A; 3UIT A; 2FUG 1; 2YFA A; 2HGK A; 2QSB A; 3DA3 A; 2GSC A; 3LJ0 A; 3FVV A; 2JB2 A; 2ZW3 A; 3Q8D A; 4PL4 A; 3LJ2 A; 2E8G A; 4NV5 A; 3DA4 A; 3IAM 1; 3P23 A; #chains in the Genus database with same CATH homology 2FEF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...