The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
117
|
structure length |
113
|
Chain Sequence |
RPHERLDAWRDSMELVEMIYRLTEVFPDQERYGLTAQLRRAAVSIPSNIAEGAARDYSRFLSIARGSLSELDTQVQIAARLGYSRSEDDQSVRRQVDLVFAKLTALMNALRRR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of the conserved hypothetical cytosolic protein Xcc0516 from Xanthomonas campestris reveals a novel quaternary structure assembled by five four-helix bundles.
pubmed doi rcsb |
| molecule keywords |
Putative uncharacterized protein XCC0516
|
| molecule tags |
Unknown function
|
| source organism |
Xanthomonas campestris pv. campestris
|
| total genus |
46
|
| structure length |
113
|
| sequence length |
117
|
| chains with identical sequence |
B, C, D, E
|
| ec nomenclature | |
| pdb deposition date | 2006-04-26 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF05635 | 23S_rRNA_IVP | 23S rRNA-intervening sequence protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | 23S rRNA-intervening sequence |
#chains in the Genus database with same CATH superfamily 2RLD A; 2GSC A; #chains in the Genus database with same CATH topology 3FVV A; 4O1P A; 4Z7H A; 3DO9 A; 2V1C C; 5HGI A; 2ZRR A; 2YFB A; 2FEF A; 3AJF A; 2F6M B; 3IAM 1; 1JQO A; 2KKM A; 2A2C A; 3FBV A; 2JB3 A; 1U5K A; 4O1O A; 4G76 A; 4I1T A; 4PL5 A; 4PL3 A; 2JAE A; 2BL8 A; 3LJ2 A; 2P22 B; 4DWL A; 1TDP A; 3IAS 1; 2HGK A; 2RIO A; 3I9V 1; 3JSB A; 4HFV A; 2A2D A; 3SDJ A; 1W3S A; 5LNK 1; 2YFA A; 2MJF B; 3Q8D A; 2E8G A; 4AS2 A; 2CAZ B; 3DA3 A; 2L1L B; 2QSB A; 2JB2 A; 2XTQ A; 4JCV E; 4YZ9 A; 2JB1 A; 1SJ8 A; 2K19 A; 3B55 A; 3DA4 A; 2RLD A; 2V6E A; 2XMX A; 4Q9V A; 4OAV B; 3LJ0 A; 4HEA 1; 3KP9 A; 2JBW A; 2QZG A; 4G75 A; 4YZD A; 3FNB A; 2FUG 1; 3F4M A; 1YO7 A; 4GXT A; 2GSC A; 2IP6 A; 3UIT A; 3P23 A; 2FU2 A; 4NV5 A; 2F66 B; 4OAU C; 2RAD A; 3LJ1 A; 4YZC A; 4U6R A; 2BL7 A; 3L0I A; 2XTR A; 2ZW3 A; 3VA9 A; 2QGM A; 4Z7G A; 4NV2 A; 2ETD A; 4PL4 A; 4AS3 A; #chains in the Genus database with same CATH homology 2RLD A; 2GSC A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
