The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
98
|
structure length |
98
|
Chain Sequence |
MGKLKWFSGGKERSNQAENIITDLLDDLKTDLDNESLKKVLENYLEELKQKSASVPLILSRMNLDISKAIRNDGVTLSDYQSKKLKELTSISNIRYGY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Nuclear magnetic resonance solution structure of PisI, a group B immunity protein that provides protection against the type IIa bacteriocin piscicolin 126, PisA.
pubmed doi rcsb |
| molecule keywords |
Putative piscicolin 126 immunity protein
|
| molecule tags |
Antimicrobial protein
|
| source organism |
Carnobacterium maltaromaticum
|
| total genus |
25
|
| structure length |
98
|
| sequence length |
98
|
| ec nomenclature | |
| pdb deposition date | 2008-02-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF08951 | EntA_Immun | Enterocin A Immunity |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | de novo design (two linked rop proteins) |
#chains in the Genus database with same CATH superfamily 2IP6 A; 2ZRR A; 2K19 A; #chains in the Genus database with same CATH topology 4Z7G A; 2FUG 1; 2QSB A; 4JCV E; 2ETD A; 4HFV A; 2QZG A; 4HEA 1; 2BL7 A; 4Z7H A; 2KKM A; 2JB2 A; 2XMX A; 3JSB A; 4YZD A; 3L0I A; 3LJ2 A; 2K19 A; 3VA9 A; 1W3S A; 4GXT A; 2ZRR A; 2FU2 A; 2MJF B; 1JQO A; 2F66 B; 4NV2 A; 5HGI A; 4OAV B; 3DA4 A; 4YZC A; 4PL4 A; 1SJ8 A; 4NV5 A; 3FVV A; 5LNK 1; 2JBW A; 2ZW3 A; 3F4M A; 2JAE A; 2FEF A; 3DO9 A; 2E8G A; 4AS3 A; 4PL3 A; 3B55 A; 3UIT A; 4Q9V A; 2A2C A; 2RAD A; 1YO7 A; 2RIO A; 2XTR A; 2L1L B; 3FNB A; 3IAM 1; 3AJF A; 2F6M B; 2QGM A; 4PL5 A; 4AS2 A; 3I9V 1; 4O1P A; 3LJ0 A; 2XTQ A; 4YZ9 A; 2YFB A; 4G76 A; 1U5K A; 4I1T A; 3Q8D A; 4G75 A; 4U6R A; 1TDP A; 2V6E A; 2A2D A; 2JB3 A; 3KP9 A; 4DWL A; 2BL8 A; 3FBV A; 3P23 A; 2GSC A; 4OAU C; 3IAS 1; 2IP6 A; 2P22 B; 2YFA A; 3LJ1 A; 3SDJ A; 2RLD A; 2V1C C; 3DA3 A; 2HGK A; 4O1O A; 2CAZ B; 2JB1 A; #chains in the Genus database with same CATH homology 4Z7G A; 2FUG 1; 4JCV E; 4HFV A; 4HEA 1; 4Z7H A; 2KKM A; 2JB2 A; 2XMX A; 3JSB A; 4YZD A; 3L0I A; 3LJ2 A; 2K19 A; 3VA9 A; 1W3S A; 4GXT A; 2ZRR A; 2MJF B; 2F66 B; 4NV2 A; 5HGI A; 4OAV B; 3DA4 A; 4YZC A; 4PL4 A; 1SJ8 A; 4NV5 A; 5LNK 1; 3F4M A; 2JAE A; 3DO9 A; 2E8G A; 4AS3 A; 4PL3 A; 3UIT A; 4Q9V A; 2A2C A; 1YO7 A; 2RIO A; 2XTR A; 2L1L B; 3IAM 1; 3AJF A; 2F6M B; 4PL5 A; 4AS2 A; 3I9V 1; 4O1P A; 3LJ0 A; 2XTQ A; 4YZ9 A; 2YFB A; 4G76 A; 1U5K A; 4I1T A; 3Q8D A; 4G75 A; 4U6R A; 2V6E A; 2A2D A; 2JB3 A; 3KP9 A; 4DWL A; 3FBV A; 3P23 A; 4OAU C; 3IAS 1; 2IP6 A; 2P22 B; 2YFA A; 3LJ1 A; 3SDJ A; 2V1C C; 3DA3 A; 4O1O A; 2CAZ B; 2JB1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...