The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
42
|
sequence length |
141
|
structure length |
141
|
Chain Sequence |
MREDKIAAKKKLHQDKRVHELARVKFMQDVVNSDTFKGQPIFDHAHTREFIQSFIERDDTELDELKKKRRSNRPPSNRQVLLQQRRDQELKEFKAGFLCPDLSDAKNMEFLRNWNGTFGLLNTLRLIRINDKGEQVVGGNE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution NMR structure of yeast protein YOR252W
rcsb |
molecule tags |
Translation
|
source organism |
Saccharomyces cerevisiae
|
molecule keywords |
Translation machinery-associated protein 16
|
total genus |
42
|
structure length |
141
|
sequence length |
141
|
ec nomenclature | |
pdb deposition date | 2009-06-26 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | de novo design (two linked rop proteins) |
#chains in the Genus database with same CATH superfamily 2KKM A; #chains in the Genus database with same CATH topology 1YO7 A; 2MJF B; 2JAE A; 3AJF A; 3Q8D A; 1TDP A; 2YFA A; 4JCV E; 4Z7H A; 3FNB A; 4U6R A; 3L0I A; 2F66 B; 2XTQ A; 2ZRR A; 3FBV A; 2CAZ B; 4I1T A; 4HEA 1; 2RLD A; 4YZC A; 2BL7 A; 3DA4 A; 3F4M A; 2K19 A; 4AS2 A; 3VA9 A; 4PL3 A; 2JB1 A; 2QSB A; 1U5K A; 4NV2 A; 3I9V 1; 5HGI A; 3IAS 1; 2A2C A; 4GXT A; 3LJ1 A; 4OAV B; 2XMX A; 3LJ2 A; 2F6M B; 3P23 A; 2KKM A; 4G76 A; 3UIT A; 2IP6 A; 4OAU C; 2E8G A; 4AS3 A; 3B55 A; 3DO9 A; 4O1O A; 2XTR A; 2QZG A; 4HFV A; 1SJ8 A; 3KP9 A; 4YZD A; 2ETD A; 2GSC A; 3JSB A; 2FU2 A; 4O1P A; 4Z7G A; 4DWL A; 2YFB A; 3SDJ A; 2FUG 1; 2A2D A; 2P22 B; 2JB3 A; 3IAM 1; 4G75 A; 1W3S A; 4NV5 A; 3LJ0 A; 2QGM A; 2HGK A; 4PL4 A; 4YZ9 A; 4PL5 A; 2V6E A; 2RAD A; 5LNK 1; 2RIO A; 2JB2 A; 2BL8 A; 2JBW A; 3DA3 A; 4Q9V A; 1JQO A; 2FEF A; 2V1C C; 3FVV A; 2ZW3 A; 2L1L B; #chains in the Genus database with same CATH homology 1YO7 A; 2MJF B; 2JAE A; 3AJF A; 3Q8D A; 2YFA A; 4JCV E; 4Z7H A; 4U6R A; 3L0I A; 2F66 B; 2XTQ A; 2ZRR A; 3FBV A; 2CAZ B; 4I1T A; 4HEA 1; 4YZC A; 3DA4 A; 3F4M A; 2K19 A; 4AS2 A; 3VA9 A; 4PL3 A; 2JB1 A; 1U5K A; 4NV2 A; 3I9V 1; 5HGI A; 3IAS 1; 2A2C A; 4GXT A; 3LJ1 A; 4OAV B; 2XMX A; 3LJ2 A; 2F6M B; 3P23 A; 2KKM A; 4G76 A; 3UIT A; 2IP6 A; 4OAU C; 2E8G A; 4AS3 A; 3DO9 A; 4O1O A; 2XTR A; 4HFV A; 1SJ8 A; 3KP9 A; 4YZD A; 3JSB A; 4O1P A; 4Z7G A; 4DWL A; 3SDJ A; 2YFB A; 2FUG 1; 2A2D A; 2P22 B; 2JB3 A; 3IAM 1; 4G75 A; 1W3S A; 4NV5 A; 3LJ0 A; 4PL4 A; 4YZ9 A; 4PL5 A; 2V6E A; 5LNK 1; 2RIO A; 2JB2 A; 3DA3 A; 4Q9V A; 2V1C C; 2L1L B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...