The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
127
|
structure length |
127
|
Chain Sequence |
ISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
NES consensus redefined by structures of PKI-type and Rev-type nuclear export signals bound to CRM1.
pubmed doi rcsb |
molecule tags |
Nuclear protein
|
source organism |
Homo sapiens
|
molecule keywords |
cAMP-dependent protein kinase inhibitor alpha
|
total genus |
39
|
structure length |
127
|
sequence length |
127
|
ec nomenclature | |
pdb deposition date | 2010-07-29 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | de novo design (two linked rop proteins) |
#chains in the Genus database with same CATH superfamily 2L1L B; #chains in the Genus database with same CATH topology 4PL4 A; 2IP6 A; 3UIT A; 2XTR A; 5HGI A; 4JCV E; 3FNB A; 3JSB A; 2E8G A; 2YFB A; 2JB2 A; 2RLD A; 4O1O A; 3KP9 A; 4G76 A; 2K19 A; 4YZ9 A; 2QZG A; 2JB1 A; 4AS2 A; 4Z7G A; 2KKM A; 2F66 B; 4I1T A; 3P23 A; 1YO7 A; 5LNK 1; 2JBW A; 2MJF B; 2BL8 A; 2JB3 A; 2JAE A; 2A2C A; 2RAD A; 3AJF A; 1W3S A; 1TDP A; 3L0I A; 3SDJ A; 2FEF A; 4HEA 1; 4O1P A; 3FBV A; 2A2D A; 3I9V 1; 3B55 A; 4GXT A; 4PL5 A; 2BL7 A; 3VA9 A; 2V6E A; 2FU2 A; 2L1L B; 4OAV B; 2P22 B; 4G75 A; 4YZC A; 4HFV A; 3DA4 A; 3LJ1 A; 4PL3 A; 3IAM 1; 4NV5 A; 3Q8D A; 2ZW3 A; 3DO9 A; 4YZD A; 1U5K A; 1SJ8 A; 2V1C C; 3IAS 1; 2ETD A; 3LJ0 A; 3DA3 A; 2FUG 1; 2HGK A; 4Z7H A; 2F6M B; 2CAZ B; 4OAU C; 2RIO A; 3F4M A; 2XMX A; 3LJ2 A; 2XTQ A; 3FVV A; 2GSC A; 4U6R A; 4Q9V A; 1JQO A; 2ZRR A; 2QSB A; 4AS3 A; 4DWL A; 4NV2 A; 2QGM A; 2YFA A; #chains in the Genus database with same CATH homology 4PL4 A; 2IP6 A; 3UIT A; 2XTR A; 5HGI A; 2YFA A; 4JCV E; 3JSB A; 2E8G A; 2YFB A; 2JB2 A; 4O1O A; 3KP9 A; 4G76 A; 2K19 A; 2JB1 A; 4AS2 A; 4Z7G A; 2KKM A; 2F66 B; 4I1T A; 3P23 A; 1YO7 A; 5LNK 1; 2MJF B; 2JB3 A; 2JAE A; 2A2C A; 3AJF A; 1W3S A; 3L0I A; 3SDJ A; 4HEA 1; 4O1P A; 3FBV A; 2A2D A; 3I9V 1; 4GXT A; 4PL5 A; 3VA9 A; 2V6E A; 2L1L B; 4OAV B; 2P22 B; 4YZC A; 4G75 A; 4HFV A; 3DA4 A; 3LJ1 A; 4PL3 A; 3IAM 1; 4NV5 A; 3Q8D A; 3DO9 A; 4YZD A; 1U5K A; 1SJ8 A; 2V1C C; 3IAS 1; 3LJ0 A; 3DA3 A; 2FUG 1; 4Z7H A; 2F6M B; 2CAZ B; 4OAU C; 2RIO A; 3F4M A; 2XMX A; 3LJ2 A; 2XTQ A; 4U6R A; 4Q9V A; 2ZRR A; 4AS3 A; 4DWL A; 4NV2 A; 4YZ9 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...