The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
85
|
structure length |
85
|
Chain Sequence |
VRVDQNLFNEVMYLLDELSQDITVPKNVRKVAQDSKAKLSQENESLDLRCATVLSMLDEMANDPNVPAHGRTDLYTIISKLEALS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of a protein from uncharacterized family UPF0147 from Thermoplasma acidophilum.
rcsb |
molecule tags |
Structural genomics, unknown function
|
source organism |
Thermoplasma acidophilum dsm 1728
|
molecule keywords |
UPF0147 protein Ta0600
|
total genus |
33
|
structure length |
85
|
sequence length |
85
|
ec nomenclature | |
pdb deposition date | 2007-07-30 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF03685 | UPF0147 | Uncharacterised protein family (UPF0147) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | Ta0600-like |
#chains in the Genus database with same CATH superfamily 1TDP A; 2QZG A; 2FU2 A; 2BL8 A; 2QSB A; 2BL7 A; #chains in the Genus database with same CATH topology 2ZRR A; 4I1T A; 3DA3 A; 4Z7G A; 3AJF A; 2XTR A; 2GSC A; 1SJ8 A; 3VA9 A; 2IP6 A; 2BL7 A; 3JSB A; 4HEA 1; 4HFV A; 4O1P A; 1YO7 A; 4OAU C; 4G76 A; 2HGK A; 3B55 A; 4AS3 A; 3P23 A; 3UIT A; 2RAD A; 4YZ9 A; 2A2D A; 2L1L B; 2QGM A; 2QZG A; 4Q9V A; 3FBV A; 3F4M A; 4YZC A; 4GXT A; 3LJ0 A; 3DO9 A; 2JB2 A; 4O1O A; 2E8G A; 2YFB A; 2ZW3 A; 4Z7H A; 2BL8 A; 2JAE A; 2XTQ A; 3DA4 A; 2JB3 A; 2JB1 A; 4U6R A; 2F6M B; 3FNB A; 3LJ1 A; 4AS2 A; 2ETD A; 2RIO A; 2FU2 A; 4YZD A; 2FUG 1; 2RLD A; 2FEF A; 4G75 A; 1W3S A; 1TDP A; 1JQO A; 2V6E A; 3FVV A; 4JCV E; 2CAZ B; 5HGI A; 2P22 B; 2JBW A; 2YFA A; 4DWL A; 2K19 A; 4PL3 A; 2QSB A; 2V1C C; 3IAM 1; 1U5K A; 5LNK 1; 2F66 B; 4NV5 A; 3LJ2 A; 3SDJ A; 2KKM A; 4PL5 A; 3I9V 1; 2MJF B; 4OAV B; 4NV2 A; 2XMX A; 3KP9 A; 3L0I A; 4PL4 A; 3Q8D A; 2A2C A; 3IAS 1; #chains in the Genus database with same CATH homology 1TDP A; 2QZG A; 2FU2 A; 2BL8 A; 2QSB A; 2BL7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...