The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
143
|
sequence length |
408
|
structure length |
408
|
Chain Sequence |
PYNTNQIAKWLEAHAKPLKTTNPTASLNDLKPLKNMVGSASIVGLGEATHGAHEVFTMKHRIVKYLVSEKGFTNLVLEEGWDRALELDRYVLTGKGNPSQHLTPVFKTKEMLDLLDWIRQYNANPKHKSKVRVIGMDIQSVNENVYNNIIEYIKANNSKLLPRVEEKIKGLIPVTKDMNTFESLTKEEKEKYVLDAKTISALLEENKSYLNGKSKEFAWIKQNARIIEQFTTMLATPPDKPADFYLKHDIAMYENAKWTEEHLGKTIVWGHNGHVSKTNMLSFIYPKVAGQHLAEYYGKRYVSIGTSVYEGQYNVKNSDGEFGPYGTLKSDDPNSYNYIFGQVKKDQFFIDLRKANGVTKTWLNEQHPIFAGITTEGPDIPKTVDISLGKAFDILVQIQKVSPSQVHQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the Q81BN2_BACCR protein from Bacillus cereus.
rcsb |
molecule tags |
Biosynthetic protein
|
source organism |
Bacillus cereus atcc 14579
|
molecule keywords |
Succinoglycan biosynthesis protein
|
total genus |
143
|
structure length |
408
|
sequence length |
408
|
ec nomenclature | |
pdb deposition date | 2007-10-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05139 | Erythro_esteras | Erythromycin esterase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | de novo design (two linked rop proteins) | Biosynthetic Protein domain | ||
Alpha Beta | 2-Layer Sandwich | EreA/ChaN-like, small alpha-beta sandwich | EreA-like; domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | EreA/ChaN-like fold | EreA-like (biosynthetic domain) |
#chains in the Genus database with same CATH superfamily 3B55 A; 2RAD A; 2QGM A; #chains in the Genus database with same CATH topology 2RLD A; 4Z7G A; 2CAZ B; 3DA4 A; 3AJF A; 4OAV B; 3LJ2 A; 2YFA A; 2ZW3 A; 3FVV A; 2A2D A; 4O1O A; 3DO9 A; 4AS3 A; 1YO7 A; 2P22 B; 3KP9 A; 4OAU C; 2JB1 A; 3F4M A; 3DA3 A; 3I9V 1; 3P23 A; 3LJ0 A; 2JAE A; 2JB2 A; 2BL8 A; 3SDJ A; 2QGM A; 3VA9 A; 4JCV E; 2JBW A; 3FBV A; 2RAD A; 2FEF A; 2V1C C; 3FNB A; 4HEA 1; 4AS2 A; 3UIT A; 1SJ8 A; 4GXT A; 3B55 A; 4YZD A; 3JSB A; 2KKM A; 5HGI A; 2XTQ A; 2F66 B; 5LNK 1; 2HGK A; 4NV5 A; 2MJF B; 2JB3 A; 2GSC A; 4G76 A; 2L1L B; 3IAM 1; 2QZG A; 2BL7 A; 4YZ9 A; 4YZC A; 2IP6 A; 3Q8D A; 2FUG 1; 3L0I A; 4O1P A; 1TDP A; 4U6R A; 2K19 A; 2YFB A; 2XMX A; 2QSB A; 4NV2 A; 2F6M B; 2E8G A; 3LJ1 A; 2FU2 A; 4PL3 A; 4I1T A; 2ETD A; 1U5K A; 3IAS 1; 2XTR A; 1JQO A; 4PL5 A; 4Q9V A; 2RIO A; 2ZRR A; 4HFV A; 1W3S A; 2A2C A; 4DWL A; 2V6E A; 4G75 A; 4PL4 A; 4Z7H A; #chains in the Genus database with same CATH homology 3B55 A; 2RAD A; 2QGM A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...