1UOYA

The bubble protein from penicillium brevicompactum dierckx exudate.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
DTCGSGYNVDQRRTNSGCKAGNGDRHFCGCDRTGVVECKGGKWTEVQDCGSSSCKGTSNGGATC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BUBBLE PROTEIN
publication title Solving the Structure of the Bubble Protein Using the Anomalous Sulfur Signal from Single-Crystal in-House Cu Kalpha Diffraction Data Only
pubmed doi rcsb
molecule tags Exudate protein
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09227 DUF1962 Domain of unknown function (DUF1962)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.50 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 1uoyA01
1UOYA
chains in the Genus database with same CATH superfamily
3M6XA 3LJCA 4CI3B 2FRXA 1IT7A 1WK2A 3M4XA 1R3EA 4CI1B 2B78A 3IUWA 2CWWA 3MQKA 2ANEA 1ZE2A 1ZE1A 2AS0A 3C0KA 1UOYA 4CI2B 3HJYA 1ZL3A 2CX0A 2RFKA 4Q1TA 3HAXA 1IT8A 2APOA 3D79A 3M6VA 1R3FA 1TE7A 3M6UA 1XNEA 2KKUA 1SQWA 3UAIA 3LWRA 3LWVA 2CX1A 3M6WA 3LWPA 2AB4A 1T5YA 2Q07A 4TZ4C 1WXWA 2EY4A 1ZS7A 3LDFA 3M65A 3U28A 3LWOA 3HJWA 2P38A 3ZV0C 3LWQA 1K8WA 1IQ8A 2J5TA 1ZBOA 1S04A 2Z0TA 2AUSA 1Q7HA 1WXXA 2HVYA 4DMGA 2DP9A 3VSEA 1J2BA 2E5OA 1SGVA 2J5VA
chains in the Genus database with same CATH topology
3M6XA 2FRXA 3M4XA 3MQKA 3HJYA 1UOYA 2RFKA 3HAXA 2APOA 3M6VA 3M6UA 3LWVA 3LWRA 3LWPA 3M6WA 2EY4A 3U28A 3LWOA 3HJWA 3ZV0C 3LWQA 2AUSA 2HVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOY A; 
#chains in the Genus database with same CATH topology
 3M6X A;  3LJC A;  4CI3 B;  2FRX A;  1IT7 A;  1WK2 A;  3M4X A;  1R3E A;  4CI1 B;  2B78 A;  3IUW A;  2CWW A;  3MQK A;  2ANE A;  1ZE2 A;  1ZE1 A;  2AS0 A;  3C0K A;  1UOY A;  4CI2 B;  3HJY A;  1ZL3 A;  2CX0 A;  2RFK A;  4Q1T A;  3HAX A;  1IT8 A;  2APO A;  3D79 A;  3M6V A;  1R3F A;  1TE7 A;  3M6U A;  1XNE A;  2KKU A;  1SQW A;  3UAI A;  3LWR A;  3LWV A;  2CX1 A;  3M6W A;  3LWP A;  2AB4 A;  1T5Y A;  2Q07 A;  4TZ4 C;  1WXW A;  2EY4 A;  1ZS7 A;  3LDF A;  3M65 A;  3U28 A;  3LWO A;  3HJW A;  2P38 A;  3ZV0 C;  3LWQ A;  1K8W A;  1IQ8 A;  2J5T A;  1ZBO A;  1S04 A;  2Z0T A;  2AUS A;  1Q7H A;  1WXX A;  2HVY A;  4DMG A;  2DP9 A;  3VSE A;  1J2B A;  2E5O A;  1SGV A;  2J5V A; 
#chains in the Genus database with same CATH homology
 3M6X A;  2FRX A;  3M4X A;  3MQK A;  3HJY A;  1UOY A;  2RFK A;  3HAX A;  2APO A;  3M6V A;  3M6U A;  3LWV A;  3LWR A;  3LWP A;  3M6W A;  2EY4 A;  3U28 A;  3LWO A;  3HJW A;  3ZV0 C;  3LWQ A;  2AUS A;  2HVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...