1UOYA

The bubble protein from penicillium brevicompactum dierckx exudate.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
DTCGSGYNVDQRRTNSGCKAGNGDRHFCGCDRTGVVECKGGKWTEVQDCGSSSCKGTSNGGATC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Exudate protein
molecule keywords BUBBLE PROTEIN
publication title Solving the Structure of the Bubble Protein Using the Anomalous Sulfur Signal from Single-Crystal in-House Cu Kalpha Diffraction Data Only
pubmed doi rcsb
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2003-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09227 DUF1962 Domain of unknown function (DUF1962)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.50 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 1uoyA01
1UOYA
chains in the Genus database with same CATH superfamily
3M6VA 1TE7A 1WK2A 2CX1A 3VSEA 2AB4A 2Q07A 3UAIA 1ZE2A 1ZL3A 4TZ4C 4CI3B 3C0KA 4Q1TA 3HAXA 1T5YA 2J5VA 3D79A 2CX0A 4DMGA 3ZV0C 3HJYA 1IT8A 3LJCA 2J5TA 3LWVA 3MQKA 2APOA 2HVYA 1ZBOA 1WXWA 1WXXA 2AUSA 3LDFA 4CI2B 1UOYA 1XNEA 2EY4A 3M4XA 3M6WA 1J2BA 3U28A 1K8WA 3HJWA 2Z0TA 3LWPA 2KKUA 3IUWA 1IT7A 2ANEA 2AS0A 2DP9A 1R3EA 2E5OA 2RFKA 1Q7HA 3M6UA 2CWWA 3M6XA 3LWQA 1ZE1A 2B78A 2P38A 4CI1B 1R3FA 1ZS7A 1IQ8A 3LWRA 2FRXA 1SGVA 1SQWA 3LWOA 1S04A 3M65A
chains in the Genus database with same CATH topology
3M6VA 3HAXA 3ZV0C 3HJYA 3LWVA 3MQKA 2APOA 2AUSA 1UOYA 3M4XA 3M6WA 2EY4A 3U28A 3HJWA 3LWPA 2RFKA 3M6UA 3M6XA 3LWQA 3LWRA 2FRXA 3LWOA 2HVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOY A; 
#chains in the Genus database with same CATH topology
 3M6V A;  1TE7 A;  1WK2 A;  2CX1 A;  3VSE A;  2AB4 A;  2Q07 A;  3UAI A;  1ZE2 A;  1ZL3 A;  4TZ4 C;  4CI3 B;  3C0K A;  4Q1T A;  3HAX A;  1T5Y A;  2J5V A;  3D79 A;  2CX0 A;  4DMG A;  3ZV0 C;  3HJY A;  1IT8 A;  3LJC A;  2J5T A;  3LWV A;  3MQK A;  2APO A;  2HVY A;  1ZBO A;  1WXW A;  1WXX A;  2AUS A;  3LDF A;  4CI2 B;  1UOY A;  1XNE A;  2EY4 A;  3M4X A;  3M6W A;  1J2B A;  3U28 A;  1K8W A;  3HJW A;  2Z0T A;  3LWP A;  2KKU A;  3IUW A;  1IT7 A;  2ANE A;  2AS0 A;  2DP9 A;  1R3E A;  2E5O A;  2RFK A;  1Q7H A;  3M6U A;  2CWW A;  3M6X A;  3LWQ A;  1ZE1 A;  2B78 A;  2P38 A;  4CI1 B;  1R3F A;  1ZS7 A;  1IQ8 A;  3LWR A;  2FRX A;  1SGV A;  1SQW A;  3LWO A;  1S04 A;  3M65 A; 
#chains in the Genus database with same CATH homology
 3M6V A;  3HAX A;  3ZV0 C;  3HJY A;  3LWV A;  3MQK A;  2APO A;  2AUS A;  1UOY A;  3M4X A;  3M6W A;  2EY4 A;  3U28 A;  3HJW A;  3LWP A;  2RFK A;  3M6U A;  3M6X A;  3LWQ A;  3LWR A;  2FRX A;  3LWO A;  2HVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...