2P38A

Crystal structure of pyrococcus abyssi protein homologue of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
155
structure length
155
Chain Sequence
LRVRRASSWELDLILKEAEKYGELLHEFFCVVEGKYRDVYAVNEEVWKIIEDINMRPYSLGTFVGTIRVDENLVEKFYPNLEFFSLIKLEKNYVILGPKASFLFTTGKDAPKEAVREIKWQGSKRVVVLNDLGDIIGIGLINPKSDRRFIKNLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Protein involved in ribosomal biogenesis
publication title Structural Insights into the Interaction of the Nip7 PUA Domain with Polyuridine RNA
pubmed doi rcsb
source organism Pyrococcus abyssi
total genus 43
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2p38A02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p38A01
2B78A 4DMGA 1K8WA 1Q7HA 1R3FA 1T5YA 2Q07A 2J5TA 1SQWA 2P38A 4Q1TA 1ZE2A 1ZS7A 1WXXA 2CWWA 1WXWA 1IQ8A 3D79A 1ZE1A 1R3EA 1J2BA 2J5VA 2CX0A 3VSEA 1ZL3A 2AB4A 3LDFA 3UAIA 1IT8A 2AS0A 2CX1A 1SGVA 1IT7A 3C0KA
chains in the Genus database with same CATH superfamily
1TJDA 4TX4A 3M4XA 3D9RA 2L1SA 1R4CA 3FCSB 3WOFB 1BU4A 3CXC2 2Y73A 5IENA 1JN5B 3MG3A 2J8XB 4MMZB 5EVHA 5FGOA 1Q9EA 3RGRA 4EXRA 3HAXA 3V99A 3QK9A 3BIRA 5RNTA 1UGIA 9RNTA 1GMQA 3SEDA 1WK2A 1RCLA 3LT9A 3FF2A 1L5GB 1VQL3 3PXMA 2H0GA 2WOFA 3K0ZA 3ZFZA 1U5OA 5JBSA 4XBYA 5IF6A 3VSEA 1A2KA 4N6UA 2OQEA 1X1XA 4FMDA 1K8A4 1RGLA 3TDGA 4BTYA 3WDGB 1QAFA 2XRXB 5KP1A 1V57A 3SOAA 3HX8A 2F4YA 2JQ5A 2WOHA 2K3DA 5ELJA 4KVHA 1LNHA 2HMNB 4FMBA 3SLUA 2UUGC 1RN4A 3O8YA 4K1VA 5D82A 4XM4A 1IU7A 1JN5A 3CNMA 5AEWB 1BNGA 3K5TA 2XGLA 4GSPA 2BMRB 2J5TA 1UI7A 5IG3A 1U8CB 3L0RA 3LWVA 1ZS7A 4CI3B 3LH4A 3DH2A 3UL6A 5CLKA 2W03A 3CCL3 1WXXA 2KKUA 3G8ZA 1A2VA 1GD3A 2QGUA 3B7CA 3G16A 1YIT3 1ZO2A 1OUNA 1W2ZA 5KP4A 1M1K4 1AQZA 1UDII 1CYUA 2RCDA 4FMAA 4XBXA 3X3ZA 4HM4B 4K61A 2QIYA 2YX9A 1YVBI 3B4OA 1RNTA 4BL3A 4J5GA 2OCTA 5BVBA 2HOHA 5FW5A 3LDFA 3CPOA 1S5AA 1UGHI 3EJVA 1MWSA 1JV2B 3LTAA 2E2VA 2GEXA 1TFOA 3AGOA 4K90B 3I553 1RHLA 1OACA 3MKIA 4BTXA 3IUWA 5LC7A 2GU3A 4IPBA 1BGSA 1TIJA 4MMXB 1MWTA 1SIHA 4N6MA 4BU4A 1GYBA 2HMKB 1T2IA 3DGOA 3LWRA 1V58A 6GSPA 3PS8A 4FCZA 4STDA 3IMAB 1J2BA 1FGQA 4LYLB 4R4KA 1CYVA 1YGWA 1IDPA 5AIIA 1O7MB 4K1UA 2MC8A 2ML6A 1VQQA 1VQ73 1GMPA 3CCS3 2K54A 5AIFA 4RNZA 3EN1B 3SXXA 1FUSA 4EV5A 3K9MC 1IV7A 2XGNA 2KF3A 2R4IA 1TRPA 1I3FA 2V1LA 3LTDA 1W6GA 1R3FA 3S28A 5EQLA 4KFFA 4L8OA 2OWPA 4J5KA 2PNCA 5CF1A 3KSPA 1BNEA 3X40A 3DGNA 1AY7A 5G1LA 5AIGA 3DM8A 3OWYA 3VF1A 1GD4A 1ROAA 2ZL8A 3OWUA 4XB5A 1Q814 3EBYA 2PZVA 1E3RA 3E99A 2LQVA 1GOVA 1AVKA 4HJLB 4KT3B 4L8PA 4ZM8A 3CD63 1RDSA 4HM7B 3CCJ3 1OHSA 4H61A 1FYSA 3CPW2 1W6YA 1X1YA 2FNQA 3MWZA 2Z0TA 1B2XA 1MOLA 1MWUA 2IUKA 2ML5A 4HZBB 3CCM3 1X1UA 5DRVA 1RGEA 3ZG5A 1E97A 1JRQA 4Q53A 1UCKA 2FXTA 1QAKA 1RRHA 3CCE3 2SBLA 3OX9A 1IVXA 3PCRA 2EY4A 1BRIA 3EB8A 4KFEA 3UB1A 3FG4A 2QEX3 4LEHA 1OGZA 5STDA 3ECFA 1IVUA 3KIIA 3F40A 3H3HA 4HM2B 3SOYA 3WA3A 1JKGB 1A2PA 1BNSA 4OUQA 2RSXA 3QRDA 2XR8B 4WWUC 2E2UA 4LMIA 3F14A 3CU3A 1LQGC 3NQYA 3NBBA 3PCSA 1BSDA 3Q3FA 4HM6B 3HJYA 1W7CA 1B3SA 3NBRA 3S67A 3DZLA 4X2HA 2WGOA 3V92A 3G4S3 1BUQA 2F86B 5AEUB 3WODG 3EN8A 3NBJA 3VSYA 1Q7Y4 1VQ43 3CNXA 4JF8A 1BRHA 2BT3A 1Q7HA 1BSAA 1GOYA 4HM5B 4EV2A 1IK3A 3T8UA 1WNHA 4CPKA 3MSOA 4Q1TA 1BSEA 3T0UA 1RKYA 3KKGA 1LOVA 2BHMA 1JKGA 2HMOB 3KSED 4CI2B 3S27A 1KWIA 1X1WA 2UGIA 1KC84 1ROVA 4XDWA 1BRNL 2OQEC 3D79A 3FKAA 2GU1A 2INXA 3IPTA 1QMAA 3IJEB 3URPA 1B27A 1DMNA 2W9PA 5G2GA 3WHOA 3G6E3 1JBRA 3NM7A 4JRFA 1G02A 3B4PA 5DREA 2IUJA 1LOWA 1FA3A 2YFIB 2XFTA 1D6ZA 2CC3A 4ILFA 1NB5I 4I5QA 4PEJA 4IIAA 1AVLA 2KAAA 2GEYA 2W04A 4LGQA 1CQSA 1BSBA 1UCLA 3VGNA 3I563 3EC9A 3MHEA 3BU4A 1BNJA 3LXUX 2H0HA 2IMJA 1CEWI 3D3LA 2W0QA 2P38A 3LWQA 1DYUA 1CH0A 4LZIA 3N54B 4HM1B 3U1WA 1K28A 1M1XB 1RN1A 4FCJA 1TTOA 1I0VA 1ZE1A 2CG1A 3NX0A 3JUMA 2FGTA 1R3EA 1HU9A 4X2OA 2CFWA 4MJDA 1WMOA 2RBIA 5EEOA 4TZ4C 3OWSA 4RNYA 3MG1A 1ZBOA 2YFLB 3HI7A 2BO9B 4HM0B 1T2HA 2OTL3 1IYYA 2DP9A 1Z1SA 3CC43 3CCR3 1IQXA 3C0KA 1Q40B 3NV0B 5JPPA 1DMQA 1VQP3 3LTBA 3Q90A 4DMGA 4XDVA 3DGYA 1M904 5CXOA 3MQKA 2WGQA 3UJMA 2GSPA 1TUHA 1DETA 3M6UA 1HYFA 1K734 1VQ53 3T8NA 4HAAA 1OHOA 1UCJA 1BSCA 1KQS2 3AHWA 5AYSC 1NWWA 4HZ9B 1GS3A 4N6OB 2C11A 1JZOA 1I70A 4RBNA 1IQYA 1FGTA 3GAXA 1O7PB 1WTHA 1M9GA 1EQKA 1RGKA 3UNLA 7RNTA 1I2EA 1Q40A 3NV0A 4FMCA 1QVF2 2OOVA 1UCIA 1NO3A 1JJ22 1SIIA 2Y74A 3JUNA 1STDA 1Q864 2AUSA 1EEJA 2YFJB 3F7SA 1VQ63 2FRXA 2BIRA 2K0MA 1STFI 3AMOB 1TRQA 5HGRA 4DKIA 2OTJ3 1JNQA 1HZ1A 1QALA 3D4AA 1C54A 5IEOA 1LVNA 1D6UA 1SARA 4N3VA 1RCKA 3NUVA 1PU4A 2QA43 3EF8A 4R9LA 2KRTA 1W01A 4N6V0 1BOXA 2AADA 4U13A 2ANEA 1S723 1QJGA 4BIRA 4O2HA 1JB5A 4AEQA 2UX0A 2XF3A 3GZRA 4BTWA 1TU5A 3WR2A 2AB4A 2H0IA 1MWRA 1BVIA 2O3OA 2P0MA 1O7HB 2BU4A 3KFQC 3LMLA 5D83A 1PY3A 5IERA 5AIHA 2KF5A 3DGMA 1NNVA 1BRSA 3LWPA 1TFKA 3AMOA 1N9JA 1DVDA 3CMA3 1BIRA 1IVWA 4H3UA 1O7GB 3Q1CA 2AAEA 3EX9A 4N6TA 2KCDA 3M6XA 1T5YA 1EUIC 8CHOA 1I8VA 1UOYA 3LJCA 1T3BA 1V74A 2KXGA 4QWTA 1RN7A 1RRLA 3CCV3 1FUWA 2KF4A 1OCVA 2SARA 1B2SA 1IVVA 7STDA 3N8BA 4GL6A 7GSPA 1JB4A 1ZGXA 2BNGA 2R41A 1UUGB 1EKMA 3AHSA 1N9EA 2CKFB 1GSPA 1OHPA 2XSOB 1FGOA 1YNVX 2C4BA 3DY5A 2CFDA 2XH9A 1OF5B 2HMLB 2WO0A 4FCMA 3FLJA 1HKXA 2IA7A 1RGHA 2M7OA 4OK0A 3OW22 1SGVA 1BRKA 3BNDA 1RMSA 3PYJA 4RNTA 3X3XA 1G96A 5M18A 2ZDJA 1VQK3 1YI23 1RSNA 5AYRB 1I0XA 3X3YA 3HIIA 1KSIA 1B2UA 3M65A 2CFLA 4HVNA 1VQO3 4R9KA 1QVG2 4EBGA 1SQWA 1RJOA 1W00A 1NDOB 4N6LA 2XEPA 3KZTA 3CC73 1FW7A 1ZE2A 4J9AA 1FGRA 1W6CA 2ZA4A 3N9HA 2Z77A 2RGQA 1ASKA 1GOUA 1OF5A 2CG0A 2IYJA 3GSPA 4OVMA 1GMRA 1YHQ3 2P0XA 2O9UX 3RDEA 4CDLA 4HM8B 4KFDA 1MGWA 1BANA 2P09A 2JDIH 1A90A 1UW1A 3FGYA 3ZV0C 3LOYA 1N8R4 1WMPA 2D42A 3FSDA 1N5HA 2D1WA 4R80A 2Z6BA 2CX1A 3ALAA 3WA2X 5A0OB 5JPUA 1NJI4 2F5WA 2P05A 3DGLA 3ER7A 1B2MA 3DMCA 1FUTA 2XSHB 3F7XA 4O02B 1G0TA 1RGGA 1GY7A 3LTCA 1VQ93 1DE3A 1A67A 4WYKB 3MPHA 4HM3B 5ELUA 1LNIA 3HIGA 1JZDA 3HOHA 3RNTA 2E2TA 4N6NB 3HJWA 3Q2PA 1W5ZA 1WXWA 1IQ8A 3LZAA 3ROBA 3CC23 1NB3I 3OXAA 3RGAA 2CH9A 3FG1A 2J5VA 4MMYB 1JBSA 3DUKA 3WOEB 2RNTA 1I2FA 2CHCA 3EE1A 3F9SA 5TGNA 3A76A 2F98A 1IV9A 3HZPA 4HOHA 1YIJ3 4WP5A 1KD14 3PZWA 3MYTA 2AS0A 2A15A 3JUOA 2GXFA 3GZYB 2F56A 3G713 1D6YA 1GY6A 3M6WA 4WYKA 3V98A 5I97A 1SPUA 2F99A 1RGAA 1RLSA 4IT7A 1GY5A 3MG2A 1VQM3 3FF0A 1TP6A 5LC6A 4EC6A 1JBTA 3EQQB 3GZBA 6RNTA 2C10A 2CFGA 3K7CA 5D81A 1F8NA 2HVYA 2CFKA 3GWRA 3GRDA 3U97A 2HMJB 4XBTA 1YJW3 1O7NB 1I3IA 3PGBA 3BNEA 5BU4A 5IG0A 4G1MB 3F8HA 5M1AA 2OOVC 1B2ZA 1ZL3A 1AR0A 1JB2A 3NQZA 4GHOA 2I9WA 1UUVB 3M8CA 1BRGA 1EG9B 1MNLA 1VQ83 5IG4A 5HOHA 5IEPA 5GSPA 1BUJA 1FZUA 4KZ1A 1UI8A 4LSOA 1I2GA 1DMMA 1Q42A 1RGFA 2L4VA 3X41A 2B78A 1US1A 2IY2A 2Z7AA 2HMMB 2Q07A 3FH1A 1UUWB 4HBRA 5IW9A 3K63A 4RZMA 2BMQB 1OH0A 1SJWA 1EA2A 1AV4A 3H51A 2B1XB 5CF2A 1Y4KA 1DVCA 2CIUA 1BRJA 1RTUA 4NREA 4CJNA 1FGMA 2GBWB 5CK6A 4O3VA 3BNCA 2CWWA 3CCQ3 2W6JH 1B21A 1ULIB 1LXEA 4WFOA 4EW5A 1W2B2 1N5PA 4AKZA 3OV4A 3G0KA 5G1KA 1PYLA 5M19A 4GB5A 5KP3A 1NU3A 2APOA 3BB9A 3KCHA 2CK3H 3CCU3 1YJN3 1S04A 1IT7A 4CCVA 3AGNA 1ZX2A 1WMNA 3KN4A 4FR9A 1YJ93 1BNRA 3B8LA 5BIRA 2CWVA 2RFRA 2STDA 1BNIA 1K41A 4WHAA 3GZXB 3LYGA 3JUPA 2F5MA 2Z76A 4J8TA 1OGXA 1YGEA 5AI1A 2RFKA 2GBXB 3NHXA 1W02A 1WQLB 2W9QA 3KE7A 3M6VA 1RNBA 4I4KA 3EBTA 4ORLA 2MF7A 1B20A 3A5EA 2CX0A 4BL2A 1W4NA 3X42A 1VZZA 2W56B 1ISKA 3D5GA 4MEIA 1E3VA 3SX1A 3UAIA 1IT8A 1R4YA 3JUQA 4L7KA 3BLZA 3FZWA 3I0YA 3WMDA 2CWUA 4AKYA 1N8QA 3UL5A 5IG5A 2KF6A 3HK4A 1LRAA 1Q824 1BNFA 2W2CA 3LWOA 3DXOA 1K8WA 3SYUA 2BMOB 3J7Yd 3S5CA 3ZG0A 1BAOA 1O7WB 1K9M4 3FG3A 1LQMB 1PFPA 3F8XA 1LOYA 1ULJB 2ZHXB 4O8SA 2E5OA 2B24B 3BNBA 3LT8A 1TE7A 2CWTA 1XNEA 2XFSA 3STDA 6STDA 3D5IA 1MGRA 3EHCA 4CI1B 1LOXA 3SVAA 3JVCA 2W56A 4HYZA 4R1KA 3CME3 2LYXA 1OPYA 3NM2A 2CW9A 5BXQA 4NPBA 4NHFA 1C7HA 4EYCA 8RNTA 1VQN3 3NXJA 4HKVB 3U28A 3S29A 1YVSA 1RGCA
chains in the Genus database with same CATH topology
4TX4A 3D9RA 1R4CA 3FCSB 3WOFB 3CXC2 2Y73A 5IENA 1JN5B 3MG3A 5EVHA 4MMZB 5FGOA 3RGRA 4EXRA 3V99A 3QK9A 3SEDA 3LT9A 3FF2A 1L5GB 1VQL3 3PXMA 2WOFA 3K0ZA 1U5OA 5JBSA 4XBYA 5IF6A 3VSEA 1A2KA 4N6UA 2OQEA 1K8A4 4FMDA 4BTYA 3TDGA 3WDGB 1QAFA 2XRXB 5KP1A 3SOAA 3HX8A 2JQ5A 2WOHA 5ELJA 4KVHA 1LNHA 2HMNB 4FMBA 3SLUA 3O8YA 4K1VA 5D82A 4XM4A 1IU7A 1JN5A 3CNMA 5AEWB 3K5TA 2XGLA 2BMRB 2J5TA 1UI7A 5IG3A 1U8CB 3L0RA 1ZS7A 3LH4A 3UL6A 5CLKA 2W03A 3CCL3 1WXXA 1YIT3 3G8ZA 1A2VA 1GD3A 2QGUA 3B7CA 3G16A 1ZO2A 1OUNA 1W2ZA 5KP4A 1M1K4 1CYUA 2RCDA 4FMAA 4XBXA 3X3ZA 4HM4B 4K61A 2QIYA 2YX9A 1YVBI 3B4OA 1W2B2 2OCTA 5BVBA 5FW5A 3LDFA 3CPOA 1S5AA 3EJVA 3LTAA 1JV2B 2E2VA 2GEXA 1TFOA 3I553 4K90B 1OACA 3MKIA 4BTXA 5LC7A 2GU3A 4IPBA 1TIJA 4MMXB 1SIHA 4N6MA 1GYBA 2HMKB 3DGOA 3PS8A 4FCZA 4STDA 3IMAB 1J2BA 1FGQA 4R4KA 1CYVA 5AIIA 1IDPA 1O7MB 4K1UA 2MC8A 2ML6A 1VQ73 3CCS3 2K54A 5AIFA 4RNZA 3EN1B 3SXXA 4EV5A 3K9MC 1IV7A 2XGNA 2R4IA 2V1LA 3LTDA 1W6GA 1R3FA 3S28A 5EQLA 4KFFA 4L8OA 2OWPA 2PNCA 5CF1A 3KSPA 3X40A 3DGNA 5AIGA 3DM8A 3OWYA 3VF1A 1GD4A 1ROAA 2ZL8A 3OWUA 4XB5A 1Q814 3EBYA 2PZVA 1E3RA 3E99A 2LQVA 1AVKA 4HJLB 4ZM8A 4L8PA 3CD63 4HM7B 3CCJ3 1OHSA 4H61A 3CPW2 1W6YA 2FNQA 3MWZA 1MOLA 2IUKA 2ML5A 4HZBB 3CCM3 5DRVA 1E97A 1JRQA 4Q53A 2FXTA 1QAKA 1RRHA 3CCE3 2SBLA 3OX9A 1IVXA 3PCRA 4KFEA 3UB1A 3EB8A 3FG4A 2QEX3 4LEHA 1OGZA 5STDA 3ECFA 1IVUA 3KIIA 3F40A 3H3HA 4HM2B 3SOYA 3WA3A 1JKGB 4OUQA 2RSXA 3QRDA 2XR8B 4WWUC 2E2UA 4LMIA 3F14A 3CU3A 3NQYA 3NBBA 3PCSA 4HM6B 3S67A 3NBRA 1W7CA 3V92A 3G4S3 3DZLA 4X2HA 2WGOA 1BUQA 2F86B 5AEUB 3WODG 3EN8A 3NBJA 3VSYA 1Q7Y4 1VQ43 3CNXA 4JF8A 2BT3A 1Q7HA 4HM5B 4EV2A 1IK3A 3T8UA 1WNHA 3MSOA 4Q1TA 3T0UA 1RKYA 3KKGA 2BHMA 2HMOB 1JKGA 3KSED 1KC84 3S27A 1KWIA 1ROVA 4XDWA 2OQEC 3D79A 3FKAA 2GU1A 2INXA 3IPTA 1QMAA 3IJEB 1DMNA 2W9PA 5G2GA 3G6E3 3NM7A 4JRFA 3B4PA 5DREA 2IUJA 1FA3A 2YFIB 2XFTA 1D6ZA 2CC3A 1NB5I 4PEJA 4IIAA 1AVLA 2GEYA 2W04A 4LGQA 1CQSA 3VGNA 3I563 3EC9A 3MHEA 3LXUX 2IMJA 1CEWI 3D3LA 2W0QA 2P38A 1DYUA 4LZIA 3N54B 4HM1B 3U1WA 1K28A 1M1XB 4FCJA 1ZE1A 2CG1A 3NX0A 3JUMA 2FGTA 1R3EA 1HU9A 4X2OA 2CFWA 4MJDA 1WMOA 5EEOA 4RNYA 3OWSA 3MG1A 2YFLB 3HI7A 2BO9B 4HM0B 2OTL3 1Z1SA 3CC43 3CCR3 1IQXA 3C0KA 1Q40B 3NV0B 5JPPA 1DMQA 1VQP3 3LTBA 3Q90A 4DMGA 4XDVA 1M904 5CXOA 2WGQA 3UJMA 1TUHA 1K734 1VQ53 3T8NA 1OHOA 1KQS2 5AYSC 1NWWA 4HZ9B 1GS3A 4N6OB 2C11A 4RBNA 1IQYA 1FGTA 3GAXA 1O7PB 1WTHA 1M9GA 1EQKA 3UNLA 1Q40A 3NV0A 4FMCA 1QVF2 2OOVA 1NO3A 1JJ22 1SIIA 2Y74A 3JUNA 1STDA 1Q864 2YFJB 3F7SA 1VQ63 2K0MA 1STFI 3AMOB 5HGRA 2OTJ3 1JNQA 1QALA 5IEOA 1LVNA 1D6UA 4N3VA 3NUVA 1PU4A 2QA43 3EF8A 4R9LA 2KRTA 1W01A 4N6V0 4U13A 1S723 1QJGA 4O2HA 1JB5A 4AEQA 2UX0A 2XF3A 3GZRA 4BTWA 1TU5A 2AB4A 2O3OA 2P0MA 1O7HB 3KFQC 3LMLA 5D83A 5IERA 5AIHA 3DGMA 1TFKA 3AMOA 1N9JA 1DVDA 3CMA3 1IVWA 4H3UA 1O7GB 3Q1CA 4N6TA 3EX9A 2KCDA 8CHOA 1T5YA 5IG4A 1V74A 4QWTA 2KXGA 3CCV3 1RN7A 1RRLA 1FUWA 1OCVA 1IVVA 7STDA 3N8BA 4GL6A 1JB4A 2BNGA 1EKMA 1N9EA 2CKFB 1OHPA 2XSOB 1FGOA 3DY5A 2CFDA 2XH9A 1OF5B 2HMLB 2WO0A 4FCMA 3FLJA 1HKXA 2IA7A 2M7OA 4OK0A 3OW22 1SGVA 3BNDA 3PYJA 3X3XA 1G96A 2ZDJA 1VQK3 1YI23 5AYRB 3X3YA 3HIIA 1KSIA 1QVG2 2CFLA 4HVNA 1VQO3 4R9KA 4EBGA 1SQWA 1RJOA 1W00A 1NDOB 4N6LA 2XEPA 3KZTA 3CC73 1ZE2A 4J9AA 1FGRA 1W6CA 3N9HA 2Z77A 2RGQA 1ASKA 1OF5A 2CG0A 4OVMA 1YHQ3 2P0XA 2O9UX 3RDEA 4CDLA 4HM8B 4KFDA 2P09A 1A90A 2JDIH 1UW1A 3FGYA 1N8R4 3LOYA 1WMPA 2D42A 3FSDA 1N5HA 2D1WA 4R80A 2Z6BA 2CX1A 3ALAA 3WA2X 5A0OB 5JPUA 1NJI4 2P05A 3DGLA 3ER7A 3DMCA 2XSHB 3F7XA 4O02B 1GY7A 3LTCA 1VQ93 1A67A 4WYKB 3MPHA 4HM3B 5ELUA 3HIGA 2E2TA 4N6NB 3Q2PA 1W5ZA 1WXWA 1IQ8A 3LZAA 3ROBA 3CC23 1NB3I 3OXAA 3RGAA 2CH9A 3FG1A 2J5VA 4MMYB 3DUKA 3WOEB 2CHCA 3EE1A 3F9SA 5TGNA 3A76A 2F98A 1IV9A 3HZPA 1YIJ3 4WP5A 1KD14 3PZWA 3MYTA 2AS0A 2A15A 3JUOA 2GXFA 3GZYB 3G713 1D6YA 1GY6A 4WYKA 3V98A 5I97A 1SPUA 2F99A 4IT7A 1GY5A 3MG2A 1VQM3 3FF0A 1TP6A 5LC6A 4EC6A 3EQQB 3GZBA 2C10A 2CFGA 3K7CA 5D81A 1F8NA 3GWRA 2CFKA 3GRDA 3U97A 2HMJB 4XBTA 1YJW3 1O7NB 3PGBA 3BNEA 5IG0A 4G1MB 3F8HA 2OOVC 1ZL3A 1AR0A 1JB2A 3NQZA 2I9WA 1UUVB 3M8CA 1EG9B 1MNLA 1VQ83 5IEPA 4KZ1A 1UI8A 4LSOA 1DMMA 1Q42A 2L4VA 3X41A 2B78A 1US1A 2Z7AA 2HMMB 2Q07A 3FH1A 1UUWB 4HBRA 5IW9A 3K63A 4RZMA 2BMQB 1OH0A 1SJWA 1EA2A 1AV4A 3H51A 2B1XB 5CF2A 1Y4KA 1DVCA 2CIUA 4NREA 1FGMA 2GBWB 5CK6A 4O3VA 3BNCA 2CWWA 3CCQ3 2W6JH 1ULIB 1LXEA 4WFOA 1N5PA 4AKZA 3OV4A 3G0KA 4GB5A 5KP3A 1NU3A 3BB9A 3CCU3 2CK3H 1YJN3 1IT7A 4CCVA 1ZX2A 1WMNA 3KN4A 4FR9A 1YJ93 3B8LA 2CWVA 2RFRA 2STDA 1K41A 4WHAA 3GZXB 3LYGA 3JUPA 2Z76A 4J8TA 1OGXA 1YGEA 5AI1A 3NHXA 2GBXB 1W02A 1WQLB 2W9QA 3KE7A 4I4KA 3EBTA 4ORLA 2MF7A 2CX0A 1W4NA 3X42A 1VZZA 2W56B 1ISKA 4MEIA 1E3VA 3SX1A 3UAIA 1IT8A 3JUQA 4L7KA 3WMDA 3BLZA 3FZWA 3I0YA 4AKYA 2CWUA 1N8QA 3UL5A 5IG5A 1Q824 3HK4A 2W2CA 3DXOA 1K8WA 2BMOB 3J7Yd 3S5CA 1O7WB 1K9M4 3FG3A 1PFPA 3F8XA 1ULJB 4O8SA 2B24B 3BNBA 3LT8A 2CWTA 2XFSA 3STDA 6STDA 3EHCA 1LOXA 3SVAA 3JVCA 2W56A 4HYZA 4R1KA 3CME3 2LYXA 1OPYA 3NM2A 2CW9A 5BXQA 4NHFA 1C7HA 4EYCA 1VQN3 3NXJA 4HKVB 3S29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B78 A;  4DMG A;  1K8W A;  1Q7H A;  1R3F A;  1T5Y A;  2Q07 A;  2J5T A;  1SQW A;  2P38 A;  4Q1T A;  1ZE2 A;  1ZS7 A;  1WXX A;  2CWW A;  1WXW A;  1IQ8 A;  3D79 A;  1ZE1 A;  1R3E A;  1J2B A;  2J5V A;  2CX0 A;  3VSE A;  1ZL3 A;  2AB4 A;  3LDF A;  3UAI A;  1IT8 A;  2AS0 A;  2CX1 A;  1SGV A;  1IT7 A;  3C0K A; 
#chains in the Genus database with same CATH topology
 1TJD A;  4TX4 A;  3M4X A;  3D9R A;  2L1S A;  1R4C A;  3FCS B;  3WOF B;  1BU4 A;  3CXC 2;  2Y73 A;  5IEN A;  1JN5 B;  3MG3 A;  2J8X B;  4MMZ B;  5EVH A;  5FGO A;  1Q9E A;  3RGR A;  4EXR A;  3HAX A;  3V99 A;  3QK9 A;  3BIR A;  5RNT A;  1UGI A;  9RNT A;  1GMQ A;  3SED A;  1WK2 A;  1RCL A;  3LT9 A;  3FF2 A;  1L5G B;  1VQL 3;  3PXM A;  2H0G A;  2WOF A;  3K0Z A;  3ZFZ A;  1U5O A;  5JBS A;  4XBY A;  5IF6 A;  3VSE A;  1A2K A;  4N6U A;  2OQE A;  1X1X A;  4FMD A;  1K8A 4;  1RGL A;  3TDG A;  4BTY A;  3WDG B;  1QAF A;  2XRX B;  5KP1 A;  1V57 A;  3SOA A;  3HX8 A;  2F4Y A;  2JQ5 A;  2WOH A;  2K3D A;  5ELJ A;  4KVH A;  1LNH A;  2HMN B;  4FMB A;  3SLU A;  2UUG C;  1RN4 A;  3O8Y A;  4K1V A;  5D82 A;  4XM4 A;  1IU7 A;  1JN5 A;  3CNM A;  5AEW B;  1BNG A;  3K5T A;  2XGL A;  4GSP A;  2BMR B;  2J5T A;  1UI7 A;  5IG3 A;  1U8C B;  3L0R A;  3LWV A;  1ZS7 A;  4CI3 B;  3LH4 A;  3DH2 A;  3UL6 A;  5CLK A;  2W03 A;  3CCL 3;  1WXX A;  2KKU A;  3G8Z A;  1A2V A;  1GD3 A;  2QGU A;  3B7C A;  3G16 A;  1YIT 3;  1ZO2 A;  1OUN A;  1W2Z A;  5KP4 A;  1M1K 4;  1AQZ A;  1UDI I;  1CYU A;  2RCD A;  4FMA A;  4XBX A;  3X3Z A;  4HM4 B;  4K61 A;  2QIY A;  2YX9 A;  1YVB I;  3B4O A;  1RNT A;  4BL3 A;  4J5G A;  2OCT A;  5BVB A;  2HOH A;  5FW5 A;  3LDF A;  3CPO A;  1S5A A;  1UGH I;  3EJV A;  1MWS A;  1JV2 B;  3LTA A;  2E2V A;  2GEX A;  1TFO A;  3AGO A;  4K90 B;  3I55 3;  1RHL A;  1OAC A;  3MKI A;  4BTX A;  3IUW A;  5LC7 A;  2GU3 A;  4IPB A;  1BGS A;  1TIJ A;  4MMX B;  1MWT A;  1SIH A;  4N6M A;  4BU4 A;  1GYB A;  2HMK B;  1T2I A;  3DGO A;  3LWR A;  1V58 A;  6GSP A;  3PS8 A;  4FCZ A;  4STD A;  3IMA B;  1J2B A;  1FGQ A;  4LYL B;  4R4K A;  1CYV A;  1YGW A;  1IDP A;  5AII A;  1O7M B;  4K1U A;  2MC8 A;  2ML6 A;  1VQQ A;  1VQ7 3;  1GMP A;  3CCS 3;  2K54 A;  5AIF A;  4RNZ A;  3EN1 B;  3SXX A;  1FUS A;  4EV5 A;  3K9M C;  1IV7 A;  2XGN A;  2KF3 A;  2R4I A;  1TRP A;  1I3F A;  2V1L A;  3LTD A;  1W6G A;  1R3F A;  3S28 A;  5EQL A;  4KFF A;  4L8O A;  2OWP A;  4J5K A;  2PNC A;  5CF1 A;  3KSP A;  1BNE A;  3X40 A;  3DGN A;  1AY7 A;  5G1L A;  5AIG A;  3DM8 A;  3OWY A;  3VF1 A;  1GD4 A;  1ROA A;  2ZL8 A;  3OWU A;  4XB5 A;  1Q81 4;  3EBY A;  2PZV A;  1E3R A;  3E99 A;  2LQV A;  1GOV A;  1AVK A;  4HJL B;  4KT3 B;  4L8P A;  4ZM8 A;  3CD6 3;  1RDS A;  4HM7 B;  3CCJ 3;  1OHS A;  4H61 A;  1FYS A;  3CPW 2;  1W6Y A;  1X1Y A;  2FNQ A;  3MWZ A;  2Z0T A;  1B2X A;  1MOL A;  1MWU A;  2IUK A;  2ML5 A;  4HZB B;  3CCM 3;  1X1U A;  5DRV A;  1RGE A;  3ZG5 A;  1E97 A;  1JRQ A;  4Q53 A;  1UCK A;  2FXT A;  1QAK A;  1RRH A;  3CCE 3;  2SBL A;  3OX9 A;  1IVX A;  3PCR A;  2EY4 A;  1BRI A;  3EB8 A;  4KFE A;  3UB1 A;  3FG4 A;  2QEX 3;  4LEH A;  1OGZ A;  5STD A;  3ECF A;  1IVU A;  3KII A;  3F40 A;  3H3H A;  4HM2 B;  3SOY A;  3WA3 A;  1JKG B;  1A2P A;  1BNS A;  4OUQ A;  2RSX A;  3QRD A;  2XR8 B;  4WWU C;  2E2U A;  4LMI A;  3F14 A;  3CU3 A;  1LQG C;  3NQY A;  3NBB A;  3PCS A;  1BSD A;  3Q3F A;  4HM6 B;  3HJY A;  1W7C A;  1B3S A;  3NBR A;  3S67 A;  3DZL A;  4X2H A;  2WGO A;  3V92 A;  3G4S 3;  1BUQ A;  2F86 B;  5AEU B;  3WOD G;  3EN8 A;  3NBJ A;  3VSY A;  1Q7Y 4;  1VQ4 3;  3CNX A;  4JF8 A;  1BRH A;  2BT3 A;  1Q7H A;  1BSA A;  1GOY A;  4HM5 B;  4EV2 A;  1IK3 A;  3T8U A;  1WNH A;  4CPK A;  3MSO A;  4Q1T A;  1BSE A;  3T0U A;  1RKY A;  3KKG A;  1LOV A;  2BHM A;  1JKG A;  2HMO B;  3KSE D;  4CI2 B;  3S27 A;  1KWI A;  1X1W A;  2UGI A;  1KC8 4;  1ROV A;  4XDW A;  1BRN L;  2OQE C;  3D79 A;  3FKA A;  2GU1 A;  2INX A;  3IPT A;  1QMA A;  3IJE B;  3URP A;  1B27 A;  1DMN A;  2W9P A;  5G2G A;  3WHO A;  3G6E 3;  1JBR A;  3NM7 A;  4JRF A;  1G02 A;  3B4P A;  5DRE A;  2IUJ A;  1LOW A;  1FA3 A;  2YFI B;  2XFT A;  1D6Z A;  2CC3 A;  4ILF A;  1NB5 I;  4I5Q A;  4PEJ A;  4IIA A;  1AVL A;  2KAA A;  2GEY A;  2W04 A;  4LGQ A;  1CQS A;  1BSB A;  1UCL A;  3VGN A;  3I56 3;  3EC9 A;  3MHE A;  3BU4 A;  1BNJ A;  3LXU X;  2H0H A;  2IMJ A;  1CEW I;  3D3L A;  2W0Q A;  2P38 A;  3LWQ A;  1DYU A;  1CH0 A;  4LZI A;  3N54 B;  4HM1 B;  3U1W A;  1K28 A;  1M1X B;  1RN1 A;  4FCJ A;  1TTO A;  1I0V A;  1ZE1 A;  2CG1 A;  3NX0 A;  3JUM A;  2FGT A;  1R3E A;  1HU9 A;  4X2O A;  2CFW A;  4MJD A;  1WMO A;  2RBI A;  5EEO A;  4TZ4 C;  3OWS A;  4RNY A;  3MG1 A;  1ZBO A;  2YFL B;  3HI7 A;  2BO9 B;  4HM0 B;  1T2H A;  2OTL 3;  1IYY A;  2DP9 A;  1Z1S A;  3CC4 3;  3CCR 3;  1IQX A;  3C0K A;  1Q40 B;  3NV0 B;  5JPP A;  1DMQ A;  1VQP 3;  3LTB A;  3Q90 A;  4DMG A;  4XDV A;  3DGY A;  1M90 4;  5CXO A;  3MQK A;  2WGQ A;  3UJM A;  2GSP A;  1TUH A;  1DET A;  3M6U A;  1HYF A;  1K73 4;  1VQ5 3;  3T8N A;  4HAA A;  1OHO A;  1UCJ A;  1BSC A;  1KQS 2;  3AHW A;  5AYS C;  1NWW A;  4HZ9 B;  1GS3 A;  4N6O B;  2C11 A;  1JZO A;  1I70 A;  4RBN A;  1IQY A;  1FGT A;  3GAX A;  1O7P B;  1WTH A;  1M9G A;  1EQK A;  1RGK A;  3UNL A;  7RNT A;  1I2E A;  1Q40 A;  3NV0 A;  4FMC A;  1QVF 2;  2OOV A;  1UCI A;  1NO3 A;  1JJ2 2;  1SII A;  2Y74 A;  3JUN A;  1STD A;  1Q86 4;  2AUS A;  1EEJ A;  2YFJ B;  3F7S A;  1VQ6 3;  2FRX A;  2BIR A;  2K0M A;  1STF I;  3AMO B;  1TRQ A;  5HGR A;  4DKI A;  2OTJ 3;  1JNQ A;  1HZ1 A;  1QAL A;  3D4A A;  1C54 A;  5IEO A;  1LVN A;  1D6U A;  1SAR A;  4N3V A;  1RCK A;  3NUV A;  1PU4 A;  2QA4 3;  3EF8 A;  4R9L A;  2KRT A;  1W01 A;  4N6V 0;  1BOX A;  2AAD A;  4U13 A;  2ANE A;  1S72 3;  1QJG A;  4BIR A;  4O2H A;  1JB5 A;  4AEQ A;  2UX0 A;  2XF3 A;  3GZR A;  4BTW A;  1TU5 A;  3WR2 A;  2AB4 A;  2H0I A;  1MWR A;  1BVI A;  2O3O A;  2P0M A;  1O7H B;  2BU4 A;  3KFQ C;  3LML A;  5D83 A;  1PY3 A;  5IER A;  5AIH A;  2KF5 A;  3DGM A;  1NNV A;  1BRS A;  3LWP A;  1TFK A;  3AMO A;  1N9J A;  1DVD A;  3CMA 3;  1BIR A;  1IVW A;  4H3U A;  1O7G B;  3Q1C A;  2AAE A;  3EX9 A;  4N6T A;  2KCD A;  3M6X A;  1T5Y A;  1EUI C;  8CHO A;  1I8V A;  1UOY A;  3LJC A;  1T3B A;  1V74 A;  2KXG A;  4QWT A;  1RN7 A;  1RRL A;  3CCV 3;  1FUW A;  2KF4 A;  1OCV A;  2SAR A;  1B2S A;  1IVV A;  7STD A;  3N8B A;  4GL6 A;  7GSP A;  1JB4 A;  1ZGX A;  2BNG A;  2R41 A;  1UUG B;  1EKM A;  3AHS A;  1N9E A;  2CKF B;  1GSP A;  1OHP A;  2XSO B;  1FGO A;  1YNV X;  2C4B A;  3DY5 A;  2CFD A;  2XH9 A;  1OF5 B;  2HML B;  2WO0 A;  4FCM A;  3FLJ A;  1HKX A;  2IA7 A;  1RGH A;  2M7O A;  4OK0 A;  3OW2 2;  1SGV A;  1BRK A;  3BND A;  1RMS A;  3PYJ A;  4RNT A;  3X3X A;  1G96 A;  5M18 A;  2ZDJ A;  1VQK 3;  1YI2 3;  1RSN A;  5AYR B;  1I0X A;  3X3Y A;  3HII A;  1KSI A;  1B2U A;  3M65 A;  2CFL A;  4HVN A;  1VQO 3;  4R9K A;  1QVG 2;  4EBG A;  1SQW A;  1RJO A;  1W00 A;  1NDO B;  4N6L A;  2XEP A;  3KZT A;  3CC7 3;  1FW7 A;  1ZE2 A;  4J9A A;  1FGR A;  1W6C A;  2ZA4 A;  3N9H A;  2Z77 A;  2RGQ A;  1ASK A;  1GOU A;  1OF5 A;  2CG0 A;  2IYJ A;  3GSP A;  4OVM A;  1GMR A;  1YHQ 3;  2P0X A;  2O9U X;  3RDE A;  4CDL A;  4HM8 B;  4KFD A;  1MGW A;  1BAN A;  2P09 A;  2JDI H;  1A90 A;  1UW1 A;  3FGY A;  3ZV0 C;  3LOY A;  1N8R 4;  1WMP A;  2D42 A;  3FSD A;  1N5H A;  2D1W A;  4R80 A;  2Z6B A;  2CX1 A;  3ALA A;  3WA2 X;  5A0O B;  5JPU A;  1NJI 4;  2F5W A;  2P05 A;  3DGL A;  3ER7 A;  1B2M A;  3DMC A;  1FUT A;  2XSH B;  3F7X A;  4O02 B;  1G0T A;  1RGG A;  1GY7 A;  3LTC A;  1VQ9 3;  1DE3 A;  1A67 A;  4WYK B;  3MPH A;  4HM3 B;  5ELU A;  1LNI A;  3HIG A;  1JZD A;  3HOH A;  3RNT A;  2E2T A;  4N6N B;  3HJW A;  3Q2P A;  1W5Z A;  1WXW A;  1IQ8 A;  3LZA A;  3ROB A;  3CC2 3;  1NB3 I;  3OXA A;  3RGA A;  2CH9 A;  3FG1 A;  2J5V A;  4MMY B;  1JBS A;  3DUK A;  3WOE B;  2RNT A;  1I2F A;  2CHC A;  3EE1 A;  3F9S A;  5TGN A;  3A76 A;  2F98 A;  1IV9 A;  3HZP A;  4HOH A;  1YIJ 3;  4WP5 A;  1KD1 4;  3PZW A;  3MYT A;  2AS0 A;  2A15 A;  3JUO A;  2GXF A;  3GZY B;  2F56 A;  3G71 3;  1D6Y A;  1GY6 A;  3M6W A;  4WYK A;  3V98 A;  5I97 A;  1SPU A;  2F99 A;  1RGA A;  1RLS A;  4IT7 A;  1GY5 A;  3MG2 A;  1VQM 3;  3FF0 A;  1TP6 A;  5LC6 A;  4EC6 A;  1JBT A;  3EQQ B;  3GZB A;  6RNT A;  2C10 A;  2CFG A;  3K7C A;  5D81 A;  1F8N A;  2HVY A;  2CFK A;  3GWR A;  3GRD A;  3U97 A;  2HMJ B;  4XBT A;  1YJW 3;  1O7N B;  1I3I A;  3PGB A;  3BNE A;  5BU4 A;  5IG0 A;  4G1M B;  3F8H A;  5M1A A;  2OOV C;  1B2Z A;  1ZL3 A;  1AR0 A;  1JB2 A;  3NQZ A;  4GHO A;  2I9W A;  1UUV B;  3M8C A;  1BRG A;  1EG9 B;  1MNL A;  1VQ8 3;  5IG4 A;  5HOH A;  5IEP A;  5GSP A;  1BUJ A;  1FZU A;  4KZ1 A;  1UI8 A;  4LSO A;  1I2G A;  1DMM A;  1Q42 A;  1RGF A;  2L4V A;  3X41 A;  2B78 A;  1US1 A;  2IY2 A;  2Z7A A;  2HMM B;  2Q07 A;  3FH1 A;  1UUW B;  4HBR A;  5IW9 A;  3K63 A;  4RZM A;  2BMQ B;  1OH0 A;  1SJW A;  1EA2 A;  1AV4 A;  3H51 A;  2B1X B;  5CF2 A;  1Y4K A;  1DVC A;  2CIU A;  1BRJ A;  1RTU A;  4NRE A;  4CJN A;  1FGM A;  2GBW B;  5CK6 A;  4O3V A;  3BNC A;  2CWW A;  3CCQ 3;  2W6J H;  1B21 A;  1ULI B;  1LXE A;  4WFO A;  4EW5 A;  1W2B 2;  1N5P A;  4AKZ A;  3OV4 A;  3G0K A;  5G1K A;  1PYL A;  5M19 A;  4GB5 A;  5KP3 A;  1NU3 A;  2APO A;  3BB9 A;  3KCH A;  2CK3 H;  3CCU 3;  1YJN 3;  1S04 A;  1IT7 A;  4CCV A;  3AGN A;  1ZX2 A;  1WMN A;  3KN4 A;  4FR9 A;  1YJ9 3;  1BNR A;  3B8L A;  5BIR A;  2CWV A;  2RFR A;  2STD A;  1BNI A;  1K41 A;  4WHA A;  3GZX B;  3LYG A;  3JUP A;  2F5M A;  2Z76 A;  4J8T A;  1OGX A;  1YGE A;  5AI1 A;  2RFK A;  2GBX B;  3NHX A;  1W02 A;  1WQL B;  2W9Q A;  3KE7 A;  3M6V A;  1RNB A;  4I4K A;  3EBT A;  4ORL A;  2MF7 A;  1B20 A;  3A5E A;  2CX0 A;  4BL2 A;  1W4N A;  3X42 A;  1VZZ A;  2W56 B;  1ISK A;  3D5G A;  4MEI A;  1E3V A;  3SX1 A;  3UAI A;  1IT8 A;  1R4Y A;  3JUQ A;  4L7K A;  3BLZ A;  3FZW A;  3I0Y A;  3WMD A;  2CWU A;  4AKY A;  1N8Q A;  3UL5 A;  5IG5 A;  2KF6 A;  3HK4 A;  1LRA A;  1Q82 4;  1BNF A;  2W2C A;  3LWO A;  3DXO A;  1K8W A;  3SYU A;  2BMO B;  3J7Y d;  3S5C A;  3ZG0 A;  1BAO A;  1O7W B;  1K9M 4;  3FG3 A;  1LQM B;  1PFP A;  3F8X A;  1LOY A;  1ULJ B;  2ZHX B;  4O8S A;  2E5O A;  2B24 B;  3BNB A;  3LT8 A;  1TE7 A;  2CWT A;  1XNE A;  2XFS A;  3STD A;  6STD A;  3D5I A;  1MGR A;  3EHC A;  4CI1 B;  1LOX A;  3SVA A;  3JVC A;  2W56 A;  4HYZ A;  4R1K A;  3CME 3;  2LYX A;  1OPY A;  3NM2 A;  2CW9 A;  5BXQ A;  4NPB A;  4NHF A;  1C7H A;  4EYC A;  8RNT A;  1VQN 3;  3NXJ A;  4HKV B;  3U28 A;  3S29 A;  1YVS A;  1RGC A; 
#chains in the Genus database with same CATH homology
 4TX4 A;  3D9R A;  1R4C A;  3FCS B;  3WOF B;  3CXC 2;  2Y73 A;  5IEN A;  1JN5 B;  3MG3 A;  5EVH A;  4MMZ B;  5FGO A;  3RGR A;  4EXR A;  3V99 A;  3QK9 A;  3SED A;  3LT9 A;  3FF2 A;  1L5G B;  1VQL 3;  3PXM A;  2WOF A;  3K0Z A;  1U5O A;  5JBS A;  4XBY A;  5IF6 A;  3VSE A;  1A2K A;  4N6U A;  2OQE A;  1K8A 4;  4FMD A;  4BTY A;  3TDG A;  3WDG B;  1QAF A;  2XRX B;  5KP1 A;  3SOA A;  3HX8 A;  2JQ5 A;  2WOH A;  5ELJ A;  4KVH A;  1LNH A;  2HMN B;  4FMB A;  3SLU A;  3O8Y A;  4K1V A;  5D82 A;  4XM4 A;  1IU7 A;  1JN5 A;  3CNM A;  5AEW B;  3K5T A;  2XGL A;  2BMR B;  2J5T A;  1UI7 A;  5IG3 A;  1U8C B;  3L0R A;  1ZS7 A;  3LH4 A;  3UL6 A;  5CLK A;  2W03 A;  3CCL 3;  1WXX A;  1YIT 3;  3G8Z A;  1A2V A;  1GD3 A;  2QGU A;  3B7C A;  3G16 A;  1ZO2 A;  1OUN A;  1W2Z A;  5KP4 A;  1M1K 4;  1CYU A;  2RCD A;  4FMA A;  4XBX A;  3X3Z A;  4HM4 B;  4K61 A;  2QIY A;  2YX9 A;  1YVB I;  3B4O A;  1W2B 2;  2OCT A;  5BVB A;  5FW5 A;  3LDF A;  3CPO A;  1S5A A;  3EJV A;  3LTA A;  1JV2 B;  2E2V A;  2GEX A;  1TFO A;  3I55 3;  4K90 B;  1OAC A;  3MKI A;  4BTX A;  5LC7 A;  2GU3 A;  4IPB A;  1TIJ A;  4MMX B;  1SIH A;  4N6M A;  1GYB A;  2HMK B;  3DGO A;  3PS8 A;  4FCZ A;  4STD A;  3IMA B;  1J2B A;  1FGQ A;  4R4K A;  1CYV A;  5AII A;  1IDP A;  1O7M B;  4K1U A;  2MC8 A;  2ML6 A;  1VQ7 3;  3CCS 3;  2K54 A;  5AIF A;  4RNZ A;  3EN1 B;  3SXX A;  4EV5 A;  3K9M C;  1IV7 A;  2XGN A;  2R4I A;  2V1L A;  3LTD A;  1W6G A;  1R3F A;  3S28 A;  5EQL A;  4KFF A;  4L8O A;  2OWP A;  2PNC A;  5CF1 A;  3KSP A;  3X40 A;  3DGN A;  5AIG A;  3DM8 A;  3OWY A;  3VF1 A;  1GD4 A;  1ROA A;  2ZL8 A;  3OWU A;  4XB5 A;  1Q81 4;  3EBY A;  2PZV A;  1E3R A;  3E99 A;  2LQV A;  1AVK A;  4HJL B;  4ZM8 A;  4L8P A;  3CD6 3;  4HM7 B;  3CCJ 3;  1OHS A;  4H61 A;  3CPW 2;  1W6Y A;  2FNQ A;  3MWZ A;  1MOL A;  2IUK A;  2ML5 A;  4HZB B;  3CCM 3;  5DRV A;  1E97 A;  1JRQ A;  4Q53 A;  2FXT A;  1QAK A;  1RRH A;  3CCE 3;  2SBL A;  3OX9 A;  1IVX A;  3PCR A;  4KFE A;  3UB1 A;  3EB8 A;  3FG4 A;  2QEX 3;  4LEH A;  1OGZ A;  5STD A;  3ECF A;  1IVU A;  3KII A;  3F40 A;  3H3H A;  4HM2 B;  3SOY A;  3WA3 A;  1JKG B;  4OUQ A;  2RSX A;  3QRD A;  2XR8 B;  4WWU C;  2E2U A;  4LMI A;  3F14 A;  3CU3 A;  3NQY A;  3NBB A;  3PCS A;  4HM6 B;  3S67 A;  3NBR A;  1W7C A;  3V92 A;  3G4S 3;  3DZL A;  4X2H A;  2WGO A;  1BUQ A;  2F86 B;  5AEU B;  3WOD G;  3EN8 A;  3NBJ A;  3VSY A;  1Q7Y 4;  1VQ4 3;  3CNX A;  4JF8 A;  2BT3 A;  1Q7H A;  4HM5 B;  4EV2 A;  1IK3 A;  3T8U A;  1WNH A;  3MSO A;  4Q1T A;  3T0U A;  1RKY A;  3KKG A;  2BHM A;  2HMO B;  1JKG A;  3KSE D;  1KC8 4;  3S27 A;  1KWI A;  1ROV A;  4XDW A;  2OQE C;  3D79 A;  3FKA A;  2GU1 A;  2INX A;  3IPT A;  1QMA A;  3IJE B;  1DMN A;  2W9P A;  5G2G A;  3G6E 3;  3NM7 A;  4JRF A;  3B4P A;  5DRE A;  2IUJ A;  1FA3 A;  2YFI B;  2XFT A;  1D6Z A;  2CC3 A;  1NB5 I;  4PEJ A;  4IIA A;  1AVL A;  2GEY A;  2W04 A;  4LGQ A;  1CQS A;  3VGN A;  3I56 3;  3EC9 A;  3MHE A;  3LXU X;  2IMJ A;  1CEW I;  3D3L A;  2W0Q A;  2P38 A;  1DYU A;  4LZI A;  3N54 B;  4HM1 B;  3U1W A;  1K28 A;  1M1X B;  4FCJ A;  1ZE1 A;  2CG1 A;  3NX0 A;  3JUM A;  2FGT A;  1R3E A;  1HU9 A;  4X2O A;  2CFW A;  4MJD A;  1WMO A;  5EEO A;  4RNY A;  3OWS A;  3MG1 A;  2YFL B;  3HI7 A;  2BO9 B;  4HM0 B;  2OTL 3;  1Z1S A;  3CC4 3;  3CCR 3;  1IQX A;  3C0K A;  1Q40 B;  3NV0 B;  5JPP A;  1DMQ A;  1VQP 3;  3LTB A;  3Q90 A;  4DMG A;  4XDV A;  1M90 4;  5CXO A;  2WGQ A;  3UJM A;  1TUH A;  1K73 4;  1VQ5 3;  3T8N A;  1OHO A;  1KQS 2;  5AYS C;  1NWW A;  4HZ9 B;  1GS3 A;  4N6O B;  2C11 A;  4RBN A;  1IQY A;  1FGT A;  3GAX A;  1O7P B;  1WTH A;  1M9G A;  1EQK A;  3UNL A;  1Q40 A;  3NV0 A;  4FMC A;  1QVF 2;  2OOV A;  1NO3 A;  1JJ2 2;  1SII A;  2Y74 A;  3JUN A;  1STD A;  1Q86 4;  2YFJ B;  3F7S A;  1VQ6 3;  2K0M A;  1STF I;  3AMO B;  5HGR A;  2OTJ 3;  1JNQ A;  1QAL A;  5IEO A;  1LVN A;  1D6U A;  4N3V A;  3NUV A;  1PU4 A;  2QA4 3;  3EF8 A;  4R9L A;  2KRT A;  1W01 A;  4N6V 0;  4U13 A;  1S72 3;  1QJG A;  4O2H A;  1JB5 A;  4AEQ A;  2UX0 A;  2XF3 A;  3GZR A;  4BTW A;  1TU5 A;  2AB4 A;  2O3O A;  2P0M A;  1O7H B;  3KFQ C;  3LML A;  5D83 A;  5IER A;  5AIH A;  3DGM A;  1TFK A;  3AMO A;  1N9J A;  1DVD A;  3CMA 3;  1IVW A;  4H3U A;  1O7G B;  3Q1C A;  4N6T A;  3EX9 A;  2KCD A;  8CHO A;  1T5Y A;  5IG4 A;  1V74 A;  4QWT A;  2KXG A;  3CCV 3;  1RN7 A;  1RRL A;  1FUW A;  1OCV A;  1IVV A;  7STD A;  3N8B A;  4GL6 A;  1JB4 A;  2BNG A;  1EKM A;  1N9E A;  2CKF B;  1OHP A;  2XSO B;  1FGO A;  3DY5 A;  2CFD A;  2XH9 A;  1OF5 B;  2HML B;  2WO0 A;  4FCM A;  3FLJ A;  1HKX A;  2IA7 A;  2M7O A;  4OK0 A;  3OW2 2;  1SGV A;  3BND A;  3PYJ A;  3X3X A;  1G96 A;  2ZDJ A;  1VQK 3;  1YI2 3;  5AYR B;  3X3Y A;  3HII A;  1KSI A;  1QVG 2;  2CFL A;  4HVN A;  1VQO 3;  4R9K A;  4EBG A;  1SQW A;  1RJO A;  1W00 A;  1NDO B;  4N6L A;  2XEP A;  3KZT A;  3CC7 3;  1ZE2 A;  4J9A A;  1FGR A;  1W6C A;  3N9H A;  2Z77 A;  2RGQ A;  1ASK A;  1OF5 A;  2CG0 A;  4OVM A;  1YHQ 3;  2P0X A;  2O9U X;  3RDE A;  4CDL A;  4HM8 B;  4KFD A;  2P09 A;  1A90 A;  2JDI H;  1UW1 A;  3FGY A;  1N8R 4;  3LOY A;  1WMP A;  2D42 A;  3FSD A;  1N5H A;  2D1W A;  4R80 A;  2Z6B A;  2CX1 A;  3ALA A;  3WA2 X;  5A0O B;  5JPU A;  1NJI 4;  2P05 A;  3DGL A;  3ER7 A;  3DMC A;  2XSH B;  3F7X A;  4O02 B;  1GY7 A;  3LTC A;  1VQ9 3;  1A67 A;  4WYK B;  3MPH A;  4HM3 B;  5ELU A;  3HIG A;  2E2T A;  4N6N B;  3Q2P A;  1W5Z A;  1WXW A;  1IQ8 A;  3LZA A;  3ROB A;  3CC2 3;  1NB3 I;  3OXA A;  3RGA A;  2CH9 A;  3FG1 A;  2J5V A;  4MMY B;  3DUK A;  3WOE B;  2CHC A;  3EE1 A;  3F9S A;  5TGN A;  3A76 A;  2F98 A;  1IV9 A;  3HZP A;  1YIJ 3;  4WP5 A;  1KD1 4;  3PZW A;  3MYT A;  2AS0 A;  2A15 A;  3JUO A;  2GXF A;  3GZY B;  3G71 3;  1D6Y A;  1GY6 A;  4WYK A;  3V98 A;  5I97 A;  1SPU A;  2F99 A;  4IT7 A;  1GY5 A;  3MG2 A;  1VQM 3;  3FF0 A;  1TP6 A;  5LC6 A;  4EC6 A;  3EQQ B;  3GZB A;  2C10 A;  2CFG A;  3K7C A;  5D81 A;  1F8N A;  3GWR A;  2CFK A;  3GRD A;  3U97 A;  2HMJ B;  4XBT A;  1YJW 3;  1O7N B;  3PGB A;  3BNE A;  5IG0 A;  4G1M B;  3F8H A;  2OOV C;  1ZL3 A;  1AR0 A;  1JB2 A;  3NQZ A;  2I9W A;  1UUV B;  3M8C A;  1EG9 B;  1MNL A;  1VQ8 3;  5IEP A;  4KZ1 A;  1UI8 A;  4LSO A;  1DMM A;  1Q42 A;  2L4V A;  3X41 A;  2B78 A;  1US1 A;  2Z7A A;  2HMM B;  2Q07 A;  3FH1 A;  1UUW B;  4HBR A;  5IW9 A;  3K63 A;  4RZM A;  2BMQ B;  1OH0 A;  1SJW A;  1EA2 A;  1AV4 A;  3H51 A;  2B1X B;  5CF2 A;  1Y4K A;  1DVC A;  2CIU A;  4NRE A;  1FGM A;  2GBW B;  5CK6 A;  4O3V A;  3BNC A;  2CWW A;  3CCQ 3;  2W6J H;  1ULI B;  1LXE A;  4WFO A;  1N5P A;  4AKZ A;  3OV4 A;  3G0K A;  4GB5 A;  5KP3 A;  1NU3 A;  3BB9 A;  3CCU 3;  2CK3 H;  1YJN 3;  1IT7 A;  4CCV A;  1ZX2 A;  1WMN A;  3KN4 A;  4FR9 A;  1YJ9 3;  3B8L A;  2CWV A;  2RFR A;  2STD A;  1K41 A;  4WHA A;  3GZX B;  3LYG A;  3JUP A;  2Z76 A;  4J8T A;  1OGX A;  1YGE A;  5AI1 A;  3NHX A;  2GBX B;  1W02 A;  1WQL B;  2W9Q A;  3KE7 A;  4I4K A;  3EBT A;  4ORL A;  2MF7 A;  2CX0 A;  1W4N A;  3X42 A;  1VZZ A;  2W56 B;  1ISK A;  4MEI A;  1E3V A;  3SX1 A;  3UAI A;  1IT8 A;  3JUQ A;  4L7K A;  3WMD A;  3BLZ A;  3FZW A;  3I0Y A;  4AKY A;  2CWU A;  1N8Q A;  3UL5 A;  5IG5 A;  1Q82 4;  3HK4 A;  2W2C A;  3DXO A;  1K8W A;  2BMO B;  3J7Y d;  3S5C A;  1O7W B;  1K9M 4;  3FG3 A;  1PFP A;  3F8X A;  1ULJ B;  4O8S A;  2B24 B;  3BNB A;  3LT8 A;  2CWT A;  2XFS A;  3STD A;  6STD A;  3EHC A;  1LOX A;  3SVA A;  3JVC A;  2W56 A;  4HYZ A;  4R1K A;  3CME 3;  2LYX A;  1OPY A;  3NM2 A;  2CW9 A;  5BXQ A;  4NHF A;  1C7H A;  4EYC A;  1VQN 3;  3NXJ A;  4HKV B;  3S29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...