2P38A

Crystal structure of pyrococcus abyssi protein homologue of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
155
structure length
155
Chain Sequence
LRVRRASSWELDLILKEAEKYGELLHEFFCVVEGKYRDVYAVNEEVWKIIEDINMRPYSLGTFVGTIRVDENLVEKFYPNLEFFSLIKLEKNYVILGPKASFLFTTGKDAPKEAVREIKWQGSKRVVVLNDLGDIIGIGLINPKSDRRFIKNLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Interaction of the Nip7 PUA Domain with Polyuridine RNA
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Biosynthetic protein
molecule keywords Protein involved in ribosomal biogenesis
total genus 43
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2p38A02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p38A01
3LDFA 1K8WA 1SGVA 1Q7HA 2Q07A 1IT8A 2J5VA 3C0KA 1ZS7A 1R3FA 1ZE2A 3UAIA 2AB4A 1R3EA 1ZE1A 1WXWA 3VSEA 1IT7A 1WXXA 1J2BA 2AS0A 1SQWA 2J5TA 1IQ8A 2P38A 1ZL3A 2CX0A 4Q1TA 4DMGA 3D79A 2B78A 2CX1A 2CWWA 1T5YA
chains in the Genus database with same CATH superfamily
2E2TA 1RGHA 3LT8A 3CCL3 1ZX2A 2GBWB 1LOWA 3OWYA 1BNIA 4OK0A 1BNJA 2E5OA 1W2B2 2M7OA 2F5WA 3X42A 4CJNA 2AADA 4IPBA 1ZE2A 1CYVA 3NM2A 5KP1A 3LTBA 3O8YA 1M1K4 1RDSA 1RKYA 1KQS2 1D6ZA 3B4PA 1DETA 1C7HA 2YX9A 3G4S3 4O02B 3J7Yd 3I553 3CCU3 2C11A 2SARA 3QRDA 1B3SA 1DVCA 2YFLB 1VQ63 5STDA 1I8VA 4K90B 3ZV0C 3CCR3 5IG0A 1M1XB 1T2IA 2D42A 3F7SA 3HOHA 1A90A 3JUNA 2OTL3 3KSED 3M8CA 1G02A 4HJLB 1DMNA 1RLSA 1NB3I 1UUWB 4BTWA 4NPBA 1K8WA 1BNEA 2GU1A 1GS3A 4J5KA 1C54A 1AR0A 2FXTA 2WOHA 2R41A 1SARA 3Q90A 4K1UA 2GXFA 1MGRA 1EKMA 3B8LA 1R3FA 3JUOA 1IV9A 1MWTA 2PNCA 3STDA 5I97A 4WFOA 1JBSA 2AB4A 2J8XB 2FRXA 2W9PA 1VQ73 1TTOA 1ULJB 2QIYA 4FCMA 3F7XA 3DMCA 3F40A 1W4NA 1AV4A 1S723 1T2HA 2W6JH 3RNTA 3D4AA 1W6GA 4RBNA 1I0VA 4XBXA 1WQLB 3KSPA 4TZ4C 1RTUA 2H0IA 3K0ZA 5KP3A 4EV5A 5IEPA 1JBRA 2STDA 3DGLA 1EA2A 3S27A 1W6CA 1HYFA 2K3DA 1ZBOA 4HAAA 1IVXA 4STDA 5AYRB 3VGNA 4HBRA 1W01A 1O7WB 3HIGA 3T8UA 1YVBI 2KCDA 4KFFA 2F5MA 3OXAA 3BNDA 3MPHA 4HM6B 1RRLA 3L0RA 1JZOA 3OW22 4HZBB 2GU3A 2KF4A 3LWPA 3DUKA 3EBYA 4R9KA 2RNTA 1A2KA 4N3VA 3D3LA 2V1LA 3LWVA 1YI23 4CCVA 1N8QA 3UAIA 4HM2B 1PU4A 3CCJ3 3WMDA 3NHXA 1VQN3 3FZWA 1IT7A 2O9UX 3BNBA 1XNEA 3BLZA 3H3HA 3ER7A 2UGIA 1BANA 2HMLB 2QGUA 2HOHA 3UJMA 3KIIA 1NWWA 1IQ8A 1OHOA 4DKIA 2Z77A 3MG2A 1TE7A 2CW9A 3M6VA 4LEHA 2MC8A 3T0UA 2F98A 5IEOA 1UDII 2ML5A 3F8HA 1VQO3 1GOUA 3AMOA 5AI1A 1RSNA 1QJGA 4WHAA 5AIHA 3BNEA 3RGRA 2IYJA 3ECFA 3SOAA 1VQP3 1JZDA 1ZGXA 1BRJA 2AAEA 4EV2A 1Q814 1JV2B 1RHLA 2P09A 5CK6A 3CPW2 2D1WA 5RNTA 1I3FA 1VQQA 3U1WA 1X1WA 1BUQA 3URPA 1AY7A 1BIRA 5AYSC 1TJDA 1ZE1A 1LXEA 8CHOA 1VQ93 5DREA 3CC43 5G1KA 2INXA 3S5CA 2JDIH 4TX4A 4BIRA 3A76A 2IA7A 1KC84 9RNTA 4MEIA 1TRQA 1N9JA 3G6E3 3SX1A 1NDOB 1LQGC 1UGIA 1W00A 1Y4KA 2Y73A 1QALA 2K54A 5LC6A 3X3ZA 3MQKA 3LXUX 3MG3A 3FSDA 2RBIA 1FGTA 1O7NB 2E2VA 4O3VA 2I9WA 1ASKA 3FGYA 2IUKA 4HVNA 3LMLA 4KZ1A 2WGOA 1FW7A 1U5OA 5JPPA 2Z76A 1EQKA 2ZHXB 4PEJA 3B4OA 3G16A 1BUJA 5BIRA 1JB4A 1VQM3 4HZ9B 1VZZA 1Q40B 3K5TA 4AEQA 1SJWA 3HJWA 1WK2A 1IVVA 3DZLA 3BU4A 4OVMA 1BGSA 1MGWA 3FF0A 4GL6A 2CWUA 5AIGA 1DMQA 3S29A 4EC6A 1VQ53 2WOFA 4DMGA 1I2EA 3MWZA 4RNYA 8RNTA 1YHQ3 4FMDA 3BIRA 3D5IA 3DGMA 4FCZA 4I4KA 4RZMA 2UUGC 3G713 5IG5A 1YJN3 3CPOA 1Q42A 3N8BA 3M65A 3CCM3 4N6MA 1AVKA 3MHEA 2W03A 3EBTA 3DGYA 3M6WA 4GHOA 5D83A 1RMSA 1UI7A 1SIIA 1OHSA 2GEXA 3WOFB 1V58A 1ROVA 3GAXA 1N5HA 3NBRA 1J2BA 3AMOB 3UB1A 1NNVA 1MNLA 1RGKA 3PCSA 3HI7A 1JN5B 3KN4A 2CG0A 3EE1A 3EN1B 4JRFA 1B21A 1GY5A 4N6LA 1W7CA 2HMNB 4LSOA 1RNTA 2FNQA 3K7CA 1RGFA 4FR9A 5TGNA 1S04A 3IUWA 5AEWB 2F99A 1BNFA 1I70A 3K63A 3VF1A 1K8A4 2XF3A 3OWSA 1FUSA 1ZO2A 2H0HA 4J5GA 3WR2A 2XFTA 3M6UA 2WO0A 1FGOA 1OF5B 1BRGA 4J8TA 3JVCA 3ZG0A 3CNXA 1K41A 3U97A 3U28A 4HM8B 1OGZA 2CFWA 3S67A 2CFGA 1FGMA 5CF1A 2L4VA 4AKZA 1A67A 2O3OA 4WWUC 4CI1B 3FG1A 4L8OA 5CF2A 1MOLA 2SBLA 4MMZB 1L5GB 1SQWA 1B2ZA 1JBTA 1OF5A 4O2HA 3EHCA 1U8CB 5FW5A 1PFPA 1SIHA 1FZUA 3NQYA 1VQ43 1FYSA 1BVIA 3FKAA 1STFI 4K61A 3CU3A 3EN8A 1BSBA 4ZM8A 7STDA 1DE3A 1IQXA 4WYKB 2AUSA 1RNBA 5AIFA 1TRPA 1E3VA 3AGNA 4GSPA 1WMNA 2F86B 1QVF2 3WOEB 2XGNA 3JUPA 1UCLA 1IT8A 1IU7A 3CXC2 1JN5A 2RCDA 2RFRA 3SEDA 2P0XA 3OWUA 2ZL8A 4N6UA 2CKFB 3Q3FA 4WYKA 3TDGA 1TUHA 1UOYA 1EG9B 1V74A 4H3UA 5CXOA 2HMOB 2RSXA 3WODG 1W6YA 1OACA 3LTCA 5D82A 3BB9A 1BRKA 3CNMA 3MYTA 1ZL3A 4ILFA 1K28A 1US1A 3D79A 2XRXB 3FG4A 4H61A 1YJ93 4N6V0 4CI3B 2KF6A 2PZVA 1UCJA 2HMJB 1JKGB 1GY7A 4X2OA 5AIIA 1FUTA 3V99A 1O7MB 3G0KA 4N6TA 3K9MC 2XR8B 4HOHA 4XDWA 2BMRB 3DGOA 4KFEA 1ISKA 1JNQA 2K0MA 3C0KA 1Q7Y4 1TFKA 1LVNA 3MSOA 1MWUA 4KVHA 1OH0A 3NM7A 4HKVB 1BSDA 1YVSA 1LOVA 1RN7A 3WHOA 5BU4A 1HU9A 1GOVA 2XH9A 3NUVA 3LWOA 1UW1A 2AS0A 1IYYA 1EEJA 4X2HA 4WP5A 2CFKA 1N9EA 1W5ZA 1DMMA 2BMQB 5JBSA 1E97A 1NJI4 1W2ZA 3CD63 2YFJB 3Q1CA 4LZIA 1N5PA 3NQZA 3DH2A 1VQ83 1YIT3 4N6NB 4GB5A 3EC9A 1E3RA 4IT7A 4XBYA 1LNHA 1Q9EA 1KSIA 1HZ1A 5G2GA 2BU4A 4LMIA 4NHFA 3KCHA 2P0MA 1O7GB 3ROBA 3AHWA 1UUVB 3T8NA 3HZPA 2LQVA 1JRQA 3F14A 2W9QA 2KF3A 1YIJ3 1AVLA 2A15A 1STDA 6STDA 2OOVA 3M6XA 1NB5I 1BOXA 2ZDJA 3H51A 5M1AA 1FGQA 1M9GA 1JB5A 5CLKA 3BNCA 1GOYA 2CHCA 2RGQA 1TFOA 1B20A 5IG3A 2QA43 2LYXA 1I2GA 4BL2A 2XFSA 3FLJA 2CFLA 4QWTA 4FMBA 4NREA 1Q40A 2OQEA 3KFQC 2BT3A 4LGQA 3HIIA 1BAOA 1BSEA 5ELUA 1TU5A 3FG3A 3SXXA 5BVBA 5GSPA 1BNGA 4BL3A 3G8ZA 2XSOB 3X3YA 2CFDA 4CI2B 4N6OB 2J5VA 5LC7A 1ZS7A 2WGQA 2HVYA 1CEWI 3A5EA 2B1XB 1R3EA 4HM1B 1WXWA 1RCKA 1RRHA 2W2CA 1ROAA 1NO3A 2E2UA 2F56A 1DYUA 2IMJA 3I0YA 2BHMA 4HM5B 4XDVA 1K734 1D6UA 1IDPA 1OCVA 1OGXA 2BO9B 1UCIA 2H0GA 3NV0A 5JPUA 6RNTA 1BNRA 1PY3A 2BIRA 2W56B 1K9M4 1R4CA 1BRHA 5BXQA 1O7PB 2CWWA 3I563 2XGLA 3ZG5A 2Y74A 4IIAA 3IPTA 3VSYA 1MWRA 3LDFA 3GRDA 3SYUA 4EW5A 2ANEA 3SOYA 2KXGA 1Q864 2Q07A 1S5AA 2C10A 1GMQA 3IMAB 3E99A 1FGRA 3PCRA 4R80A 3HAXA 1TIJA 5ELJA 1B27A 3LYGA 4AKYA 2CC3A 3DY5A 3V98A 5IERA 1BRNL 1LOXA 4MMXB 1WNHA 1CH0A 3QK9A 4RNZA 2OQEC 3EJVA 1DVDA 3UL5A 3LJCA 4RNTA 2W0QA 3NBBA 3ALAA 2J5TA 1HKXA 3NX0A 1GMRA 4HM3B 1M904 2CX0A 4G1MB 1RGAA 2MF7A 2YFIB 4U13A 1KWIA 2B78A 3CC23 1FA3A 1CYUA 3AGOA 1IV7A 3N9HA 3LTAA 2OCTA 4EYCA 1JJ22 1WMOA 3LZAA 4KFDA 4BTYA 2BMOB 3LTDA 1NU3A 3GWRA 5IF6A 1GD3A 3DXOA 1YNVX 3NV0B 3HK4A 1O7HB 1GD4A 3N54B 1GYBA 3WDGB 4BTXA 2KAAA 3LOYA 1N8R4 3FF2A 4MMYB 1RGEA 1BSCA 3FCSB 3SLUA 1OHPA 2EY4A 2XSHB 5DRVA 3WA3A 1WXXA 3LWQA 3F9SA 3IJEB 4HM0B 3D9RA 1GMPA 3AHSA 4HM4B 3KKGA 5M18A 1W02A 1X1UA 4FCJA 4Q1TA 3NBJA 5KP4A 1OPYA 2APOA 1Q824 5A0OB 1RGGA 3CMA3 3S28A 2Z0TA 3CCV3 2FGTA 4R1KA 1OUNA 2IY2A 3MKIA 1CQSA 1G96A 1UGHI 1AQZA 4L7KA 3PGBA 1B2SA 1ULIB 3D5GA 4I5QA 2GBXB 3X40A 3RDEA 1IK3A 3CC73 4K1VA 2JQ5A 5AEUB 2QEX3 1KD14 2P05A 1BNSA 1YGEA 1MWSA 7RNTA 5EVHA 1F8NA 4ORLA 4XM4A 1LNIA 1LOYA 3FH1A 4KT3B 3PYJA 4L8PA 2XEPA 3WA2X 1X1XA 1VQL3 4CDLA 3LWRA 3UNLA 3UL6A 4EBGA 1BSAA 4HM7B 3GZBA 1YJW3 2P38A 2GSPA 2CWTA 5G1LA 4XBTA 4R9LA 5EEOA 3X41A 1WMPA 4O8SA 1RN1A 4XB5A 5IG4A 4OUQA 4HYZA 1I2FA 1PYLA 1A2PA 2DP9A 2B24B 1UI8A 1Q7HA 1B2UA 3EX9A 2CIUA 2Z6BA 4FMCA 4CPKA 3Q2PA 3OX9A 3CCE3 3GZXB 5D81A 4R4KA 3X3XA 2GEYA 2HMKB 3CME3 1UUGB 2ZA4A 3DGNA 5FGOA 1GY6A 4LYLB 5HGRA 2W56A 3CCQ3 1EUIC 3GZYB 3JUQA 1BRSA 2L1SA 1TP6A 1BU4A 3OV4A 4Q53A 3GZRA 2UX0A 2OWPA 2W04A 1FUWA 1BRIA 3F8XA 3KE7A 3PS8A 2IUJA 1X1YA 3PXMA 1I3IA 3KZTA 2CX1A 3EB8A 1VQK3 1T3BA 4FMAA 2F4YA 2C4BA 1JB2A 1QAFA 5IW9A 5M19A 3M4XA 2KKUA 1RJOA 1QVG2 3HX8A 1V57A 1JKGA 1YGWA 1SGVA 2HMMB 5IENA 2CK3H 4MJDA 5EQLA 1LQMB 4J9AA 1IQYA 3GSPA 1RGCA 1QMAA 4JF8A 3EF8A 1RN4A 2CWVA 1B2XA 5HOHA 3LH4A 3CCS3 3EQQB 4BU4A 1B2MA 2R4IA 1UCKA 1RGLA 3PZWA 3VSEA 1RCLA 4EXRA 7GSPA 6GSPA 3B7CA 1D6YA 2CG1A 2OTJ3 3LT9A 1IVUA 1GSPA 2BNGA 1IVWA 3RGAA 3V92A 1SPUA 3DM8A 3JUMA 2Z7AA 2KRTA 3ZFZA 1Z1SA 3MG1A 1A2VA 1R4YA 3SVAA 1QAKA 2KF5A 2RFKA 1G0TA 1I0XA 1LRAA 2OOVC 2ML6A 3NXJA 2CH9A 1T5YA 1WTHA 3HJYA
chains in the Genus database with same CATH topology
2E2TA 3LT8A 3CCL3 1ZX2A 2GBWB 4OK0A 3OWYA 1W2B2 2M7OA 3X42A 4IPBA 1ZE2A 1CYVA 3NM2A 5KP1A 3LTBA 3O8YA 1M1K4 1RKYA 1KQS2 1D6ZA 3B4PA 1C7HA 2YX9A 4O02B 3J7Yd 3I553 3CCU3 2C11A 3QRDA 1DVCA 1VQ63 2YFLB 5STDA 3CCR3 4K90B 5IG0A 1M1XB 1A90A 2D42A 3F7SA 3JUNA 2OTL3 3KSED 3M8CA 4HJLB 1DMNA 1UUWB 1NB3I 4BTWA 1K8WA 2GU1A 1GS3A 1AR0A 2FXTA 2WOHA 3Q90A 4K1UA 2GXFA 1EKMA 3B8LA 1R3FA 3JUOA 1IV9A 2PNCA 3STDA 5I97A 4WFOA 2AB4A 1VQ73 2W9PA 1ULJB 2QIYA 4FCMA 3F7XA 3DMCA 3F40A 1W4NA 1AV4A 1S723 2W6JH 1W6GA 4RBNA 4XBXA 1WQLB 3KSPA 3K0ZA 5KP3A 4EV5A 2STDA 3DGLA 1EA2A 3S27A 1W6CA 4STDA 3VGNA 1IVXA 5AYRB 4HBRA 1W01A 1O7WB 3HIGA 3T8UA 1YVBI 2KCDA 4KFFA 3OXAA 3BNDA 3MPHA 4HM6B 1RRLA 3L0RA 3OW22 4HZBB 2GU3A 3DUKA 3EBYA 4R9KA 1A2KA 4N3VA 3D3LA 2V1LA 1YI23 4CCVA 1N8QA 3UAIA 4HM2B 1PU4A 3CCJ3 3WMDA 3NHXA 1VQN3 3FZWA 1IT7A 2O9UX 3BNBA 3BLZA 3H3HA 3ER7A 2HMLB 2QGUA 3UJMA 3KIIA 1NWWA 1IQ8A 1OHOA 3G4S3 2Z77A 3MG2A 2CW9A 2MC8A 3T0UA 4LEHA 2F98A 5IEOA 2ML5A 3F8HA 1VQO3 3AMOA 5AI1A 1QJGA 4WHAA 5AIHA 3BNEA 3RGRA 3ECFA 3SOAA 1VQP3 1Q814 4EV2A 1JV2B 2P09A 5CK6A 3CPW2 2D1WA 3U1WA 1BUQA 5AYSC 1ZE1A 1LXEA 8CHOA 1VQ93 5DREA 3CC43 2INXA 3S5CA 2JDIH 4TX4A 3A76A 2IA7A 1KC84 4MEIA 1N9JA 3G6E3 3SX1A 1NDOB 1W00A 2Y73A 1Y4KA 1QALA 2K54A 5LC6A 3X3ZA 3LXUX 3MG3A 3FSDA 1FGTA 1O7NB 2E2VA 4O3VA 2I9WA 1ASKA 3FGYA 2IUKA 4HVNA 3LMLA 4KZ1A 2WGOA 1U5OA 5JPPA 2Z76A 1EQKA 4PEJA 3B4OA 3G16A 1JB4A 1VQM3 4HZ9B 1VZZA 1Q40B 3K5TA 4AEQA 1SJWA 1IVVA 3DZLA 4OVMA 3FF0A 4GL6A 2CWUA 5AIGA 1DMQA 3S29A 4EC6A 1VQ53 2WOFA 4DMGA 3MWZA 4RNYA 1YHQ3 4FMDA 3DGMA 4FCZA 1DVDA 4I4KA 4RZMA 3G713 1YJN3 5IG5A 3CPOA 1Q42A 3N8BA 3CCM3 4N6MA 1AVKA 3MHEA 2W03A 3EBTA 5D83A 1UI7A 1SIIA 1OHSA 2GEXA 3WOFB 3GAXA 1ROVA 1N5HA 3NBRA 1J2BA 3AMOB 3UB1A 1MNLA 3PCSA 3HI7A 1JN5B 3KN4A 2CG0A 3EE1A 3EN1B 4JRFA 1GY5A 4N6LA 1W7CA 2HMNB 4LSOA 2FNQA 1T5YA 3K7CA 4FR9A 5TGNA 5AEWB 2F99A 3K63A 3VF1A 1K8A4 2XF3A 3OWSA 1ZO2A 2XFTA 2WO0A 1FGOA 1OF5B 4J8TA 3JVCA 3CNXA 1K41A 3U97A 4HM8B 1OGZA 2CFWA 3S67A 2CFGA 1FGMA 5CF1A 2L4VA 4AKZA 1A67A 2O3OA 4WWUC 3FG1A 4L8OA 5CF2A 1MOLA 2SBLA 4MMZB 1L5GB 1SQWA 1OF5A 4O2HA 3EHCA 1U8CB 5FW5A 1PFPA 1SIHA 1VQ43 3NQYA 3FKAA 1STFI 4K61A 3CU3A 3EN8A 4ZM8A 7STDA 1IQXA 4WYKB 5AIFA 1E3VA 1QVF2 1WMNA 2F86B 3WOEB 2XGNA 3JUPA 1IT8A 1IU7A 3CXC2 1JN5A 2RCDA 2RFRA 3SEDA 2P0XA 3OWUA 2ZL8A 4N6UA 2CKFB 4WYKA 3TDGA 1TUHA 4H3UA 1EG9B 1V74A 5CXOA 2HMOB 2RSXA 3WODG 1W6YA 1OACA 3LTCA 5D82A 3BB9A 3MYTA 3CNMA 1ZL3A 1K28A 1US1A 3D79A 2XRXB 3FG4A 4H61A 1YJ93 4N6V0 5AIIA 2PZVA 2HMJB 1JKGB 1GY7A 4X2OA 3V99A 1O7MB 3G0KA 4N6TA 3K9MC 2XR8B 4XDWA 2BMRB 3DGOA 4KFEA 1ISKA 1JNQA 2K0MA 3C0KA 1Q7Y4 1TFKA 1LVNA 3MSOA 4KVHA 1OH0A 3NM7A 4HKVB 1RN7A 1HU9A 2XH9A 3NUVA 1UW1A 2AS0A 4X2HA 4WP5A 2CFKA 1N9EA 1W5ZA 1DMMA 2BMQB 5JBSA 1E97A 1NJI4 1W2ZA 3CD63 2YFJB 3Q1CA 4LZIA 1N5PA 3NQZA 1VQ83 1YIT3 4N6NB 4GB5A 3EC9A 1E3RA 4IT7A 4XBYA 1LNHA 1KSIA 5G2GA 4LMIA 4NHFA 2P0MA 1O7GB 3ROBA 1UUVB 3T8NA 3HZPA 2LQVA 1JRQA 3F14A 2W9QA 1YIJ3 1AVLA 2A15A 1STDA 6STDA 2OOVA 1NB5I 2ZDJA 3H51A 1FGQA 1M9GA 1JB5A 5CLKA 3BNCA 2CHCA 2RGQA 1TFOA 5IG3A 2QA43 2LYXA 2XFSA 3FLJA 2CFLA 4QWTA 4FMBA 4NREA 1Q40A 2OQEA 3KFQC 2BT3A 4LGQA 3HIIA 5ELUA 1TU5A 3FG3A 3SXXA 5BVBA 3G8ZA 2XSOB 3X3YA 2CFDA 4N6OB 2J5VA 5LC7A 1ZS7A 2WGQA 1CEWI 2B1XB 1R3EA 4HM1B 1WXWA 1RRHA 2W2CA 1ROAA 1NO3A 2E2UA 1DYUA 2IMJA 3I0YA 2BHMA 4HM5B 4XDVA 1K734 1D6UA 1IDPA 1OCVA 1OGXA 2BO9B 5JPUA 3NV0A 1K9M4 1R4CA 5BXQA 1O7PB 2CWWA 3I563 2XGLA 2Y74A 4IIAA 3IPTA 3VSYA 3LDFA 3GRDA 3SOYA 2KXGA 1Q864 2Q07A 1S5AA 2C10A 3IMAB 3E99A 1FGRA 3PCRA 4R80A 1TIJA 5ELJA 3LYGA 5IERA 4AKYA 2CC3A 3DY5A 3V98A 1LOXA 4MMXB 1WNHA 3QK9A 4RNZA 2OQEC 3EJVA 3UL5A 2W0QA 3NBBA 3ALAA 2J5TA 1HKXA 3NX0A 4HM3B 1M904 2CX0A 4G1MB 2MF7A 2YFIB 4U13A 1KWIA 2B78A 3CC23 1FA3A 1CYUA 1IV7A 3N9HA 3LTAA 2OCTA 4EYCA 1JJ22 1WMOA 3LZAA 4KFDA 4BTYA 2BMOB 3LTDA 1NU3A 3GWRA 5IF6A 1GD3A 3DXOA 3NV0B 3HK4A 1O7HB 1GD4A 3N54B 1GYBA 3WDGB 4BTXA 1N8R4 3LOYA 3FF2A 4MMYB 3FCSB 3SLUA 1OHPA 2XSHB 5DRVA 3WA3A 1WXXA 3F9SA 3IJEB 4HM0B 3D9RA 4HM4B 3KKGA 1W02A 4FCJA 4Q1TA 3NBJA 5KP4A 1OPYA 1Q824 5A0OB 3CMA3 3S28A 3CCV3 2FGTA 4R1KA 1OUNA 3MKIA 1CQSA 1G96A 4L7KA 3PGBA 1ULIB 2GBXB 3X40A 3RDEA 1IK3A 3CC73 4K1VA 2JQ5A 5AEUB 2QEX3 1KD14 2P05A 1YGEA 5EVHA 1F8NA 4ORLA 4XM4A 3WA2X 3FH1A 5IEPA 3PYJA 4L8PA 2XEPA 1VQL3 4CDLA 3UNLA 3UL6A 4EBGA 4HM7B 3GZBA 1YJW3 2P38A 2CWTA 4XBTA 4R9LA 5EEOA 3X41A 1WMPA 4O8SA 4XB5A 5IG4A 4OUQA 4HYZA 2B24B 1UI8A 1Q7HA 3EX9A 2CIUA 2Z6BA 4FMCA 3Q2PA 3OX9A 3CCE3 3GZXB 5D81A 4R4KA 3X3XA 2GEYA 2HMKB 3CME3 3DGNA 5FGOA 1GY6A 5HGRA 2W56A 3CCQ3 3GZYB 3JUQA 1TP6A 3OV4A 4Q53A 3GZRA 2UX0A 2OWPA 2W04A 1FUWA 3F8XA 3KE7A 3PS8A 2IUJA 3PXMA 3KZTA 1VQK3 2CX1A 3EB8A 4FMAA 1JB2A 1QAFA 5IW9A 1RJOA 1QVG2 3HX8A 1JKGA 1SGVA 2HMMB 5IENA 2CK3H 4MJDA 5EQLA 4J9AA 1IQYA 1QMAA 4JF8A 3EF8A 2CWVA 3LH4A 3CCS3 3EQQB 2R4IA 3PZWA 3VSEA 4EXRA 3B7CA 1D6YA 2CG1A 2OTJ3 3LT9A 1IVUA 2BNGA 1IVWA 3RGAA 3V92A 1SPUA 3DM8A 3JUMA 2Z7AA 2KRTA 1Z1SA 3MG1A 1A2VA 3SVAA 1QAKA 2OOVC 3NXJA 2ML6A 2CH9A 2W56B 1WTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDF A;  1K8W A;  1SGV A;  1Q7H A;  2Q07 A;  1IT8 A;  2J5V A;  3C0K A;  1ZS7 A;  1R3F A;  1ZE2 A;  3UAI A;  2AB4 A;  1R3E A;  1ZE1 A;  1WXW A;  3VSE A;  1IT7 A;  1WXX A;  1J2B A;  2AS0 A;  1SQW A;  2J5T A;  1IQ8 A;  2P38 A;  1ZL3 A;  2CX0 A;  4Q1T A;  4DMG A;  3D79 A;  2B78 A;  2CX1 A;  2CWW A;  1T5Y A; 
#chains in the Genus database with same CATH topology
 2E2T A;  1RGH A;  3LT8 A;  3CCL 3;  1ZX2 A;  2GBW B;  1LOW A;  3OWY A;  1BNI A;  4OK0 A;  1BNJ A;  2E5O A;  1W2B 2;  2M7O A;  2F5W A;  3X42 A;  4CJN A;  2AAD A;  4IPB A;  1ZE2 A;  1CYV A;  3NM2 A;  5KP1 A;  3LTB A;  3O8Y A;  1M1K 4;  1RDS A;  1RKY A;  1KQS 2;  1D6Z A;  3B4P A;  1DET A;  1C7H A;  2YX9 A;  3G4S 3;  4O02 B;  3J7Y d;  3I55 3;  3CCU 3;  2C11 A;  2SAR A;  3QRD A;  1B3S A;  1DVC A;  2YFL B;  1VQ6 3;  5STD A;  1I8V A;  4K90 B;  3ZV0 C;  3CCR 3;  5IG0 A;  1M1X B;  1T2I A;  2D42 A;  3F7S A;  3HOH A;  1A90 A;  3JUN A;  2OTL 3;  3KSE D;  3M8C A;  1G02 A;  4HJL B;  1DMN A;  1RLS A;  1NB3 I;  1UUW B;  4BTW A;  4NPB A;  1K8W A;  1BNE A;  2GU1 A;  1GS3 A;  4J5K A;  1C54 A;  1AR0 A;  2FXT A;  2WOH A;  2R41 A;  1SAR A;  3Q90 A;  4K1U A;  2GXF A;  1MGR A;  1EKM A;  3B8L A;  1R3F A;  3JUO A;  1IV9 A;  1MWT A;  2PNC A;  3STD A;  5I97 A;  4WFO A;  1JBS A;  2AB4 A;  2J8X B;  2FRX A;  2W9P A;  1VQ7 3;  1TTO A;  1ULJ B;  2QIY A;  4FCM A;  3F7X A;  3DMC A;  3F40 A;  1W4N A;  1AV4 A;  1S72 3;  1T2H A;  2W6J H;  3RNT A;  3D4A A;  1W6G A;  4RBN A;  1I0V A;  4XBX A;  1WQL B;  3KSP A;  4TZ4 C;  1RTU A;  2H0I A;  3K0Z A;  5KP3 A;  4EV5 A;  5IEP A;  1JBR A;  2STD A;  3DGL A;  1EA2 A;  3S27 A;  1W6C A;  1HYF A;  2K3D A;  1ZBO A;  4HAA A;  1IVX A;  4STD A;  5AYR B;  3VGN A;  4HBR A;  1W01 A;  1O7W B;  3HIG A;  3T8U A;  1YVB I;  2KCD A;  4KFF A;  2F5M A;  3OXA A;  3BND A;  3MPH A;  4HM6 B;  1RRL A;  3L0R A;  1JZO A;  3OW2 2;  4HZB B;  2GU3 A;  2KF4 A;  3LWP A;  3DUK A;  3EBY A;  4R9K A;  2RNT A;  1A2K A;  4N3V A;  3D3L A;  2V1L A;  3LWV A;  1YI2 3;  4CCV A;  1N8Q A;  3UAI A;  4HM2 B;  1PU4 A;  3CCJ 3;  3WMD A;  3NHX A;  1VQN 3;  3FZW A;  1IT7 A;  2O9U X;  3BNB A;  1XNE A;  3BLZ A;  3H3H A;  3ER7 A;  2UGI A;  1BAN A;  2HML B;  2QGU A;  2HOH A;  3UJM A;  3KII A;  1NWW A;  1IQ8 A;  1OHO A;  4DKI A;  2Z77 A;  3MG2 A;  1TE7 A;  2CW9 A;  3M6V A;  4LEH A;  2MC8 A;  3T0U A;  2F98 A;  5IEO A;  1UDI I;  2ML5 A;  3F8H A;  1VQO 3;  1GOU A;  3AMO A;  5AI1 A;  1RSN A;  1QJG A;  4WHA A;  5AIH A;  3BNE A;  3RGR A;  2IYJ A;  3ECF A;  3SOA A;  1VQP 3;  1JZD A;  1ZGX A;  1BRJ A;  2AAE A;  4EV2 A;  1Q81 4;  1JV2 B;  1RHL A;  2P09 A;  5CK6 A;  3CPW 2;  2D1W A;  5RNT A;  1I3F A;  1VQQ A;  3U1W A;  1X1W A;  1BUQ A;  3URP A;  1AY7 A;  1BIR A;  5AYS C;  1TJD A;  1ZE1 A;  1LXE A;  8CHO A;  1VQ9 3;  5DRE A;  3CC4 3;  5G1K A;  2INX A;  3S5C A;  2JDI H;  4TX4 A;  4BIR A;  3A76 A;  2IA7 A;  1KC8 4;  9RNT A;  4MEI A;  1TRQ A;  1N9J A;  3G6E 3;  3SX1 A;  1NDO B;  1LQG C;  1UGI A;  1W00 A;  1Y4K A;  2Y73 A;  1QAL A;  2K54 A;  5LC6 A;  3X3Z A;  3MQK A;  3LXU X;  3MG3 A;  3FSD A;  2RBI A;  1FGT A;  1O7N B;  2E2V A;  4O3V A;  2I9W A;  1ASK A;  3FGY A;  2IUK A;  4HVN A;  3LML A;  4KZ1 A;  2WGO A;  1FW7 A;  1U5O A;  5JPP A;  2Z76 A;  1EQK A;  2ZHX B;  4PEJ A;  3B4O A;  3G16 A;  1BUJ A;  5BIR A;  1JB4 A;  1VQM 3;  4HZ9 B;  1VZZ A;  1Q40 B;  3K5T A;  4AEQ A;  1SJW A;  3HJW A;  1WK2 A;  1IVV A;  3DZL A;  3BU4 A;  4OVM A;  1BGS A;  1MGW A;  3FF0 A;  4GL6 A;  2CWU A;  5AIG A;  1DMQ A;  3S29 A;  4EC6 A;  1VQ5 3;  2WOF A;  4DMG A;  1I2E A;  3MWZ A;  4RNY A;  8RNT A;  1YHQ 3;  4FMD A;  3BIR A;  3D5I A;  3DGM A;  4FCZ A;  4I4K A;  4RZM A;  2UUG C;  3G71 3;  5IG5 A;  1YJN 3;  3CPO A;  1Q42 A;  3N8B A;  3M65 A;  3CCM 3;  4N6M A;  1AVK A;  3MHE A;  2W03 A;  3EBT A;  3DGY A;  3M6W A;  4GHO A;  5D83 A;  1RMS A;  1UI7 A;  1SII A;  1OHS A;  2GEX A;  3WOF B;  1V58 A;  1ROV A;  3GAX A;  1N5H A;  3NBR A;  1J2B A;  3AMO B;  3UB1 A;  1NNV A;  1MNL A;  1RGK A;  3PCS A;  3HI7 A;  1JN5 B;  3KN4 A;  2CG0 A;  3EE1 A;  3EN1 B;  4JRF A;  1B21 A;  1GY5 A;  4N6L A;  1W7C A;  2HMN B;  4LSO A;  1RNT A;  2FNQ A;  3K7C A;  1RGF A;  4FR9 A;  5TGN A;  1S04 A;  3IUW A;  5AEW B;  2F99 A;  1BNF A;  1I70 A;  3K63 A;  3VF1 A;  1K8A 4;  2XF3 A;  3OWS A;  1FUS A;  1ZO2 A;  2H0H A;  4J5G A;  3WR2 A;  2XFT A;  3M6U A;  2WO0 A;  1FGO A;  1OF5 B;  1BRG A;  4J8T A;  3JVC A;  3ZG0 A;  3CNX A;  1K41 A;  3U97 A;  3U28 A;  4HM8 B;  1OGZ A;  2CFW A;  3S67 A;  2CFG A;  1FGM A;  5CF1 A;  2L4V A;  4AKZ A;  1A67 A;  2O3O A;  4WWU C;  4CI1 B;  3FG1 A;  4L8O A;  5CF2 A;  1MOL A;  2SBL A;  4MMZ B;  1L5G B;  1SQW A;  1B2Z A;  1JBT A;  1OF5 A;  4O2H A;  3EHC A;  1U8C B;  5FW5 A;  1PFP A;  1SIH A;  1FZU A;  3NQY A;  1VQ4 3;  1FYS A;  1BVI A;  3FKA A;  1STF I;  4K61 A;  3CU3 A;  3EN8 A;  1BSB A;  4ZM8 A;  7STD A;  1DE3 A;  1IQX A;  4WYK B;  2AUS A;  1RNB A;  5AIF A;  1TRP A;  1E3V A;  3AGN A;  4GSP A;  1WMN A;  2F86 B;  1QVF 2;  3WOE B;  2XGN A;  3JUP A;  1UCL A;  1IT8 A;  1IU7 A;  3CXC 2;  1JN5 A;  2RCD A;  2RFR A;  3SED A;  2P0X A;  3OWU A;  2ZL8 A;  4N6U A;  2CKF B;  3Q3F A;  4WYK A;  3TDG A;  1TUH A;  1UOY A;  1EG9 B;  1V74 A;  4H3U A;  5CXO A;  2HMO B;  2RSX A;  3WOD G;  1W6Y A;  1OAC A;  3LTC A;  5D82 A;  3BB9 A;  1BRK A;  3CNM A;  3MYT A;  1ZL3 A;  4ILF A;  1K28 A;  1US1 A;  3D79 A;  2XRX B;  3FG4 A;  4H61 A;  1YJ9 3;  4N6V 0;  4CI3 B;  2KF6 A;  2PZV A;  1UCJ A;  2HMJ B;  1JKG B;  1GY7 A;  4X2O A;  5AII A;  1FUT A;  3V99 A;  1O7M B;  3G0K A;  4N6T A;  3K9M C;  2XR8 B;  4HOH A;  4XDW A;  2BMR B;  3DGO A;  4KFE A;  1ISK A;  1JNQ A;  2K0M A;  3C0K A;  1Q7Y 4;  1TFK A;  1LVN A;  3MSO A;  1MWU A;  4KVH A;  1OH0 A;  3NM7 A;  4HKV B;  1BSD A;  1YVS A;  1LOV A;  1RN7 A;  3WHO A;  5BU4 A;  1HU9 A;  1GOV A;  2XH9 A;  3NUV A;  3LWO A;  1UW1 A;  2AS0 A;  1IYY A;  1EEJ A;  4X2H A;  4WP5 A;  2CFK A;  1N9E A;  1W5Z A;  1DMM A;  2BMQ B;  5JBS A;  1E97 A;  1NJI 4;  1W2Z A;  3CD6 3;  2YFJ B;  3Q1C A;  4LZI A;  1N5P A;  3NQZ A;  3DH2 A;  1VQ8 3;  1YIT 3;  4N6N B;  4GB5 A;  3EC9 A;  1E3R A;  4IT7 A;  4XBY A;  1LNH A;  1Q9E A;  1KSI A;  1HZ1 A;  5G2G A;  2BU4 A;  4LMI A;  4NHF A;  3KCH A;  2P0M A;  1O7G B;  3ROB A;  3AHW A;  1UUV B;  3T8N A;  3HZP A;  2LQV A;  1JRQ A;  3F14 A;  2W9Q A;  2KF3 A;  1YIJ 3;  1AVL A;  2A15 A;  1STD A;  6STD A;  2OOV A;  3M6X A;  1NB5 I;  1BOX A;  2ZDJ A;  3H51 A;  5M1A A;  1FGQ A;  1M9G A;  1JB5 A;  5CLK A;  3BNC A;  1GOY A;  2CHC A;  2RGQ A;  1TFO A;  1B20 A;  5IG3 A;  2QA4 3;  2LYX A;  1I2G A;  4BL2 A;  2XFS A;  3FLJ A;  2CFL A;  4QWT A;  4FMB A;  4NRE A;  1Q40 A;  2OQE A;  3KFQ C;  2BT3 A;  4LGQ A;  3HII A;  1BAO A;  1BSE A;  5ELU A;  1TU5 A;  3FG3 A;  3SXX A;  5BVB A;  5GSP A;  1BNG A;  4BL3 A;  3G8Z A;  2XSO B;  3X3Y A;  2CFD A;  4CI2 B;  4N6O B;  2J5V A;  5LC7 A;  1ZS7 A;  2WGQ A;  2HVY A;  1CEW I;  3A5E A;  2B1X B;  1R3E A;  4HM1 B;  1WXW A;  1RCK A;  1RRH A;  2W2C A;  1ROA A;  1NO3 A;  2E2U A;  2F56 A;  1DYU A;  2IMJ A;  3I0Y A;  2BHM A;  4HM5 B;  4XDV A;  1K73 4;  1D6U A;  1IDP A;  1OCV A;  1OGX A;  2BO9 B;  1UCI A;  2H0G A;  3NV0 A;  5JPU A;  6RNT A;  1BNR A;  1PY3 A;  2BIR A;  2W56 B;  1K9M 4;  1R4C A;  1BRH A;  5BXQ A;  1O7P B;  2CWW A;  3I56 3;  2XGL A;  3ZG5 A;  2Y74 A;  4IIA A;  3IPT A;  3VSY A;  1MWR A;  3LDF A;  3GRD A;  3SYU A;  4EW5 A;  2ANE A;  3SOY A;  2KXG A;  1Q86 4;  2Q07 A;  1S5A A;  2C10 A;  1GMQ A;  3IMA B;  3E99 A;  1FGR A;  3PCR A;  4R80 A;  3HAX A;  1TIJ A;  5ELJ A;  1B27 A;  3LYG A;  4AKY A;  2CC3 A;  3DY5 A;  3V98 A;  5IER A;  1BRN L;  1LOX A;  4MMX B;  1WNH A;  1CH0 A;  3QK9 A;  4RNZ A;  2OQE C;  3EJV A;  1DVD A;  3UL5 A;  3LJC A;  4RNT A;  2W0Q A;  3NBB A;  3ALA A;  2J5T A;  1HKX A;  3NX0 A;  1GMR A;  4HM3 B;  1M90 4;  2CX0 A;  4G1M B;  1RGA A;  2MF7 A;  2YFI B;  4U13 A;  1KWI A;  2B78 A;  3CC2 3;  1FA3 A;  1CYU A;  3AGO A;  1IV7 A;  3N9H A;  3LTA A;  2OCT A;  4EYC A;  1JJ2 2;  1WMO A;  3LZA A;  4KFD A;  4BTY A;  2BMO B;  3LTD A;  1NU3 A;  3GWR A;  5IF6 A;  1GD3 A;  3DXO A;  1YNV X;  3NV0 B;  3HK4 A;  1O7H B;  1GD4 A;  3N54 B;  1GYB A;  3WDG B;  4BTX A;  2KAA A;  3LOY A;  1N8R 4;  3FF2 A;  4MMY B;  1RGE A;  1BSC A;  3FCS B;  3SLU A;  1OHP A;  2EY4 A;  2XSH B;  5DRV A;  3WA3 A;  1WXX A;  3LWQ A;  3F9S A;  3IJE B;  4HM0 B;  3D9R A;  1GMP A;  3AHS A;  4HM4 B;  3KKG A;  5M18 A;  1W02 A;  1X1U A;  4FCJ A;  4Q1T A;  3NBJ A;  5KP4 A;  1OPY A;  2APO A;  1Q82 4;  5A0O B;  1RGG A;  3CMA 3;  3S28 A;  2Z0T A;  3CCV 3;  2FGT A;  4R1K A;  1OUN A;  2IY2 A;  3MKI A;  1CQS A;  1G96 A;  1UGH I;  1AQZ A;  4L7K A;  3PGB A;  1B2S A;  1ULI B;  3D5G A;  4I5Q A;  2GBX B;  3X40 A;  3RDE A;  1IK3 A;  3CC7 3;  4K1V A;  2JQ5 A;  5AEU B;  2QEX 3;  1KD1 4;  2P05 A;  1BNS A;  1YGE A;  1MWS A;  7RNT A;  5EVH A;  1F8N A;  4ORL A;  4XM4 A;  1LNI A;  1LOY A;  3FH1 A;  4KT3 B;  3PYJ A;  4L8P A;  2XEP A;  3WA2 X;  1X1X A;  1VQL 3;  4CDL A;  3LWR A;  3UNL A;  3UL6 A;  4EBG A;  1BSA A;  4HM7 B;  3GZB A;  1YJW 3;  2P38 A;  2GSP A;  2CWT A;  5G1L A;  4XBT A;  4R9L A;  5EEO A;  3X41 A;  1WMP A;  4O8S A;  1RN1 A;  4XB5 A;  5IG4 A;  4OUQ A;  4HYZ A;  1I2F A;  1PYL A;  1A2P A;  2DP9 A;  2B24 B;  1UI8 A;  1Q7H A;  1B2U A;  3EX9 A;  2CIU A;  2Z6B A;  4FMC A;  4CPK A;  3Q2P A;  3OX9 A;  3CCE 3;  3GZX B;  5D81 A;  4R4K A;  3X3X A;  2GEY A;  2HMK B;  3CME 3;  1UUG B;  2ZA4 A;  3DGN A;  5FGO A;  1GY6 A;  4LYL B;  5HGR A;  2W56 A;  3CCQ 3;  1EUI C;  3GZY B;  3JUQ A;  1BRS A;  2L1S A;  1TP6 A;  1BU4 A;  3OV4 A;  4Q53 A;  3GZR A;  2UX0 A;  2OWP A;  2W04 A;  1FUW A;  1BRI A;  3F8X A;  3KE7 A;  3PS8 A;  2IUJ A;  1X1Y A;  3PXM A;  1I3I A;  3KZT A;  2CX1 A;  3EB8 A;  1VQK 3;  1T3B A;  4FMA A;  2F4Y A;  2C4B A;  1JB2 A;  1QAF A;  5IW9 A;  5M19 A;  3M4X A;  2KKU A;  1RJO A;  1QVG 2;  3HX8 A;  1V57 A;  1JKG A;  1YGW A;  1SGV A;  2HMM B;  5IEN A;  2CK3 H;  4MJD A;  5EQL A;  1LQM B;  4J9A A;  1IQY A;  3GSP A;  1RGC A;  1QMA A;  4JF8 A;  3EF8 A;  1RN4 A;  2CWV A;  1B2X A;  5HOH A;  3LH4 A;  3CCS 3;  3EQQ B;  4BU4 A;  1B2M A;  2R4I A;  1UCK A;  1RGL A;  3PZW A;  3VSE A;  1RCL A;  4EXR A;  7GSP A;  6GSP A;  3B7C A;  1D6Y A;  2CG1 A;  2OTJ 3;  3LT9 A;  1IVU A;  1GSP A;  2BNG A;  1IVW A;  3RGA A;  3V92 A;  1SPU A;  3DM8 A;  3JUM A;  2Z7A A;  2KRT A;  3ZFZ A;  1Z1S A;  3MG1 A;  1A2V A;  1R4Y A;  3SVA A;  1QAK A;  2KF5 A;  2RFK A;  1G0T A;  1I0X A;  1LRA A;  2OOV C;  2ML6 A;  3NXJ A;  2CH9 A;  1T5Y A;  1WTH A;  3HJY A; 
#chains in the Genus database with same CATH homology
 2E2T A;  3LT8 A;  3CCL 3;  1ZX2 A;  2GBW B;  4OK0 A;  3OWY A;  1W2B 2;  2M7O A;  3X42 A;  4IPB A;  1ZE2 A;  1CYV A;  3NM2 A;  5KP1 A;  3LTB A;  3O8Y A;  1M1K 4;  1RKY A;  1KQS 2;  1D6Z A;  3B4P A;  1C7H A;  2YX9 A;  4O02 B;  3J7Y d;  3I55 3;  3CCU 3;  2C11 A;  3QRD A;  1DVC A;  1VQ6 3;  2YFL B;  5STD A;  3CCR 3;  4K90 B;  5IG0 A;  1M1X B;  1A90 A;  2D42 A;  3F7S A;  3JUN A;  2OTL 3;  3KSE D;  3M8C A;  4HJL B;  1DMN A;  1UUW B;  1NB3 I;  4BTW A;  1K8W A;  2GU1 A;  1GS3 A;  1AR0 A;  2FXT A;  2WOH A;  3Q90 A;  4K1U A;  2GXF A;  1EKM A;  3B8L A;  1R3F A;  3JUO A;  1IV9 A;  2PNC A;  3STD A;  5I97 A;  4WFO A;  2AB4 A;  1VQ7 3;  2W9P A;  1ULJ B;  2QIY A;  4FCM A;  3F7X A;  3DMC A;  3F40 A;  1W4N A;  1AV4 A;  1S72 3;  2W6J H;  1W6G A;  4RBN A;  4XBX A;  1WQL B;  3KSP A;  3K0Z A;  5KP3 A;  4EV5 A;  2STD A;  3DGL A;  1EA2 A;  3S27 A;  1W6C A;  4STD A;  3VGN A;  1IVX A;  5AYR B;  4HBR A;  1W01 A;  1O7W B;  3HIG A;  3T8U A;  1YVB I;  2KCD A;  4KFF A;  3OXA A;  3BND A;  3MPH A;  4HM6 B;  1RRL A;  3L0R A;  3OW2 2;  4HZB B;  2GU3 A;  3DUK A;  3EBY A;  4R9K A;  1A2K A;  4N3V A;  3D3L A;  2V1L A;  1YI2 3;  4CCV A;  1N8Q A;  3UAI A;  4HM2 B;  1PU4 A;  3CCJ 3;  3WMD A;  3NHX A;  1VQN 3;  3FZW A;  1IT7 A;  2O9U X;  3BNB A;  3BLZ A;  3H3H A;  3ER7 A;  2HML B;  2QGU A;  3UJM A;  3KII A;  1NWW A;  1IQ8 A;  1OHO A;  3G4S 3;  2Z77 A;  3MG2 A;  2CW9 A;  2MC8 A;  3T0U A;  4LEH A;  2F98 A;  5IEO A;  2ML5 A;  3F8H A;  1VQO 3;  3AMO A;  5AI1 A;  1QJG A;  4WHA A;  5AIH A;  3BNE A;  3RGR A;  3ECF A;  3SOA A;  1VQP 3;  1Q81 4;  4EV2 A;  1JV2 B;  2P09 A;  5CK6 A;  3CPW 2;  2D1W A;  3U1W A;  1BUQ A;  5AYS C;  1ZE1 A;  1LXE A;  8CHO A;  1VQ9 3;  5DRE A;  3CC4 3;  2INX A;  3S5C A;  2JDI H;  4TX4 A;  3A76 A;  2IA7 A;  1KC8 4;  4MEI A;  1N9J A;  3G6E 3;  3SX1 A;  1NDO B;  1W00 A;  2Y73 A;  1Y4K A;  1QAL A;  2K54 A;  5LC6 A;  3X3Z A;  3LXU X;  3MG3 A;  3FSD A;  1FGT A;  1O7N B;  2E2V A;  4O3V A;  2I9W A;  1ASK A;  3FGY A;  2IUK A;  4HVN A;  3LML A;  4KZ1 A;  2WGO A;  1U5O A;  5JPP A;  2Z76 A;  1EQK A;  4PEJ A;  3B4O A;  3G16 A;  1JB4 A;  1VQM 3;  4HZ9 B;  1VZZ A;  1Q40 B;  3K5T A;  4AEQ A;  1SJW A;  1IVV A;  3DZL A;  4OVM A;  3FF0 A;  4GL6 A;  2CWU A;  5AIG A;  1DMQ A;  3S29 A;  4EC6 A;  1VQ5 3;  2WOF A;  4DMG A;  3MWZ A;  4RNY A;  1YHQ 3;  4FMD A;  3DGM A;  4FCZ A;  1DVD A;  4I4K A;  4RZM A;  3G71 3;  1YJN 3;  5IG5 A;  3CPO A;  1Q42 A;  3N8B A;  3CCM 3;  4N6M A;  1AVK A;  3MHE A;  2W03 A;  3EBT A;  5D83 A;  1UI7 A;  1SII A;  1OHS A;  2GEX A;  3WOF B;  3GAX A;  1ROV A;  1N5H A;  3NBR A;  1J2B A;  3AMO B;  3UB1 A;  1MNL A;  3PCS A;  3HI7 A;  1JN5 B;  3KN4 A;  2CG0 A;  3EE1 A;  3EN1 B;  4JRF A;  1GY5 A;  4N6L A;  1W7C A;  2HMN B;  4LSO A;  2FNQ A;  1T5Y A;  3K7C A;  4FR9 A;  5TGN A;  5AEW B;  2F99 A;  3K63 A;  3VF1 A;  1K8A 4;  2XF3 A;  3OWS A;  1ZO2 A;  2XFT A;  2WO0 A;  1FGO A;  1OF5 B;  4J8T A;  3JVC A;  3CNX A;  1K41 A;  3U97 A;  4HM8 B;  1OGZ A;  2CFW A;  3S67 A;  2CFG A;  1FGM A;  5CF1 A;  2L4V A;  4AKZ A;  1A67 A;  2O3O A;  4WWU C;  3FG1 A;  4L8O A;  5CF2 A;  1MOL A;  2SBL A;  4MMZ B;  1L5G B;  1SQW A;  1OF5 A;  4O2H A;  3EHC A;  1U8C B;  5FW5 A;  1PFP A;  1SIH A;  1VQ4 3;  3NQY A;  3FKA A;  1STF I;  4K61 A;  3CU3 A;  3EN8 A;  4ZM8 A;  7STD A;  1IQX A;  4WYK B;  5AIF A;  1E3V A;  1QVF 2;  1WMN A;  2F86 B;  3WOE B;  2XGN A;  3JUP A;  1IT8 A;  1IU7 A;  3CXC 2;  1JN5 A;  2RCD A;  2RFR A;  3SED A;  2P0X A;  3OWU A;  2ZL8 A;  4N6U A;  2CKF B;  4WYK A;  3TDG A;  1TUH A;  4H3U A;  1EG9 B;  1V74 A;  5CXO A;  2HMO B;  2RSX A;  3WOD G;  1W6Y A;  1OAC A;  3LTC A;  5D82 A;  3BB9 A;  3MYT A;  3CNM A;  1ZL3 A;  1K28 A;  1US1 A;  3D79 A;  2XRX B;  3FG4 A;  4H61 A;  1YJ9 3;  4N6V 0;  5AII A;  2PZV A;  2HMJ B;  1JKG B;  1GY7 A;  4X2O A;  3V99 A;  1O7M B;  3G0K A;  4N6T A;  3K9M C;  2XR8 B;  4XDW A;  2BMR B;  3DGO A;  4KFE A;  1ISK A;  1JNQ A;  2K0M A;  3C0K A;  1Q7Y 4;  1TFK A;  1LVN A;  3MSO A;  4KVH A;  1OH0 A;  3NM7 A;  4HKV B;  1RN7 A;  1HU9 A;  2XH9 A;  3NUV A;  1UW1 A;  2AS0 A;  4X2H A;  4WP5 A;  2CFK A;  1N9E A;  1W5Z A;  1DMM A;  2BMQ B;  5JBS A;  1E97 A;  1NJI 4;  1W2Z A;  3CD6 3;  2YFJ B;  3Q1C A;  4LZI A;  1N5P A;  3NQZ A;  1VQ8 3;  1YIT 3;  4N6N B;  4GB5 A;  3EC9 A;  1E3R A;  4IT7 A;  4XBY A;  1LNH A;  1KSI A;  5G2G A;  4LMI A;  4NHF A;  2P0M A;  1O7G B;  3ROB A;  1UUV B;  3T8N A;  3HZP A;  2LQV A;  1JRQ A;  3F14 A;  2W9Q A;  1YIJ 3;  1AVL A;  2A15 A;  1STD A;  6STD A;  2OOV A;  1NB5 I;  2ZDJ A;  3H51 A;  1FGQ A;  1M9G A;  1JB5 A;  5CLK A;  3BNC A;  2CHC A;  2RGQ A;  1TFO A;  5IG3 A;  2QA4 3;  2LYX A;  2XFS A;  3FLJ A;  2CFL A;  4QWT A;  4FMB A;  4NRE A;  1Q40 A;  2OQE A;  3KFQ C;  2BT3 A;  4LGQ A;  3HII A;  5ELU A;  1TU5 A;  3FG3 A;  3SXX A;  5BVB A;  3G8Z A;  2XSO B;  3X3Y A;  2CFD A;  4N6O B;  2J5V A;  5LC7 A;  1ZS7 A;  2WGQ A;  1CEW I;  2B1X B;  1R3E A;  4HM1 B;  1WXW A;  1RRH A;  2W2C A;  1ROA A;  1NO3 A;  2E2U A;  1DYU A;  2IMJ A;  3I0Y A;  2BHM A;  4HM5 B;  4XDV A;  1K73 4;  1D6U A;  1IDP A;  1OCV A;  1OGX A;  2BO9 B;  5JPU A;  3NV0 A;  1K9M 4;  1R4C A;  5BXQ A;  1O7P B;  2CWW A;  3I56 3;  2XGL A;  2Y74 A;  4IIA A;  3IPT A;  3VSY A;  3LDF A;  3GRD A;  3SOY A;  2KXG A;  1Q86 4;  2Q07 A;  1S5A A;  2C10 A;  3IMA B;  3E99 A;  1FGR A;  3PCR A;  4R80 A;  1TIJ A;  5ELJ A;  3LYG A;  5IER A;  4AKY A;  2CC3 A;  3DY5 A;  3V98 A;  1LOX A;  4MMX B;  1WNH A;  3QK9 A;  4RNZ A;  2OQE C;  3EJV A;  3UL5 A;  2W0Q A;  3NBB A;  3ALA A;  2J5T A;  1HKX A;  3NX0 A;  4HM3 B;  1M90 4;  2CX0 A;  4G1M B;  2MF7 A;  2YFI B;  4U13 A;  1KWI A;  2B78 A;  3CC2 3;  1FA3 A;  1CYU A;  1IV7 A;  3N9H A;  3LTA A;  2OCT A;  4EYC A;  1JJ2 2;  1WMO A;  3LZA A;  4KFD A;  4BTY A;  2BMO B;  3LTD A;  1NU3 A;  3GWR A;  5IF6 A;  1GD3 A;  3DXO A;  3NV0 B;  3HK4 A;  1O7H B;  1GD4 A;  3N54 B;  1GYB A;  3WDG B;  4BTX A;  1N8R 4;  3LOY A;  3FF2 A;  4MMY B;  3FCS B;  3SLU A;  1OHP A;  2XSH B;  5DRV A;  3WA3 A;  1WXX A;  3F9S A;  3IJE B;  4HM0 B;  3D9R A;  4HM4 B;  3KKG A;  1W02 A;  4FCJ A;  4Q1T A;  3NBJ A;  5KP4 A;  1OPY A;  1Q82 4;  5A0O B;  3CMA 3;  3S28 A;  3CCV 3;  2FGT A;  4R1K A;  1OUN A;  3MKI A;  1CQS A;  1G96 A;  4L7K A;  3PGB A;  1ULI B;  2GBX B;  3X40 A;  3RDE A;  1IK3 A;  3CC7 3;  4K1V A;  2JQ5 A;  5AEU B;  2QEX 3;  1KD1 4;  2P05 A;  1YGE A;  5EVH A;  1F8N A;  4ORL A;  4XM4 A;  3WA2 X;  3FH1 A;  5IEP A;  3PYJ A;  4L8P A;  2XEP A;  1VQL 3;  4CDL A;  3UNL A;  3UL6 A;  4EBG A;  4HM7 B;  3GZB A;  1YJW 3;  2P38 A;  2CWT A;  4XBT A;  4R9L A;  5EEO A;  3X41 A;  1WMP A;  4O8S A;  4XB5 A;  5IG4 A;  4OUQ A;  4HYZ A;  2B24 B;  1UI8 A;  1Q7H A;  3EX9 A;  2CIU A;  2Z6B A;  4FMC A;  3Q2P A;  3OX9 A;  3CCE 3;  3GZX B;  5D81 A;  4R4K A;  3X3X A;  2GEY A;  2HMK B;  3CME 3;  3DGN A;  5FGO A;  1GY6 A;  5HGR A;  2W56 A;  3CCQ 3;  3GZY B;  3JUQ A;  1TP6 A;  3OV4 A;  4Q53 A;  3GZR A;  2UX0 A;  2OWP A;  2W04 A;  1FUW A;  3F8X A;  3KE7 A;  3PS8 A;  2IUJ A;  3PXM A;  3KZT A;  1VQK 3;  2CX1 A;  3EB8 A;  4FMA A;  1JB2 A;  1QAF A;  5IW9 A;  1RJO A;  1QVG 2;  3HX8 A;  1JKG A;  1SGV A;  2HMM B;  5IEN A;  2CK3 H;  4MJD A;  5EQL A;  4J9A A;  1IQY A;  1QMA A;  4JF8 A;  3EF8 A;  2CWV A;  3LH4 A;  3CCS 3;  3EQQ B;  2R4I A;  3PZW A;  3VSE A;  4EXR A;  3B7C A;  1D6Y A;  2CG1 A;  2OTJ 3;  3LT9 A;  1IVU A;  2BNG A;  1IVW A;  3RGA A;  3V92 A;  1SPU A;  3DM8 A;  3JUM A;  2Z7A A;  2KRT A;  1Z1S A;  3MG1 A;  1A2V A;  3SVA A;  1QAK A;  2OOV C;  3NXJ A;  2ML6 A;  2CH9 A;  2W56 B;  1WTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...