2P38A

Crystal structure of pyrococcus abyssi protein homologue of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
155
structure length
155
Chain Sequence
LRVRRASSWELDLILKEAEKYGELLHEFFCVVEGKYRDVYAVNEEVWKIIEDINMRPYSLGTFVGTIRVDENLVEKFYPNLEFFSLIKLEKNYVILGPKASFLFTTGKDAPKEAVREIKWQGSKRVVVLNDLGDIIGIGLINPKSDRRFIKNLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Interaction of the Nip7 PUA Domain with Polyuridine RNA
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Biosynthetic protein
molecule keywords Protein involved in ribosomal biogenesis
total genus 43
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2p38A02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p38A01
2J5TA 1WXXA 3C0KA 1SGVA 1J2BA 1ZE1A 4DMGA 1ZE2A 1K8WA 1R3FA 2P38A 3D79A 4Q1TA 2Q07A 1IT8A 3LDFA 1R3EA 1IT7A 2CX1A 1ZL3A 3UAIA 2CX0A 2CWWA 2B78A 2AB4A 1IQ8A 2AS0A 2J5VA 1ZS7A 1Q7HA 1WXWA 3VSEA 1T5YA 1SQWA
chains in the Genus database with same CATH superfamily
1ZO2A 5CK6A 3S29A 1OCVA 3ECFA 1I70A 1YGWA 3F8HA 1JB2A 2W0QA 4EXRA 2CFDA 1BSAA 3DUKA 1RGLA 1ZE2A 3F7XA 5IF6A 4J5GA 1Q9EA 2P38A 5KP4A 4FMCA 3E99A 1EEJA 1A2PA 2Y73A 1BANA 4I4KA 1BNFA 3SXXA 4HM2B 1BSEA 1IT8A 1BGSA 3F9SA 3PXMA 3VF1A 2Z76A 1MGWA 1V74A 2J8XB 1FYSA 1JBTA 1QJGA 1OF5A 4HJLB 1FGRA 5D82A 1EG9B 3CXC2 2HOHA 1KSIA 1E3VA 3LTDA 2JQ5A 2RCDA 1UCLA 4R4KA 1C7HA 3EJVA 1RGAA 4K1UA 5IG0A 1MNLA 3S5CA 3SEDA 1B27A 3VSEA 3NQZA 3LTBA 3M4XA 1W6GA 3UNLA 4MMZB 4LMIA 1B2XA 2AUSA 1NO3A 3WDGB 1YVBI 3SYUA 1IV9A 3LXUX 5G1LA 2IUJA 3CPW2 1IYYA 2FRXA 3T0UA 3LYGA 3CME3 3F7SA 1GD4A 1AVLA 5AEWB 3F40A 4DMGA 1WK2A 3CCJ3 1GY7A 4GHOA 2YFIB 4J5KA 3WHOA 2UUGC 1PU4A 3D79A 1SIIA 4CDLA 1TIJA 3JUOA 4Q53A 3SOAA 1I0VA 2L1SA 4NHFA 1YNVX 3MG1A 1I3IA 3UAIA 3K5TA 2AB4A 2W56A 3M65A 3HJYA 1IQYA 1GY5A 1T3BA 1OF5B 1N5HA 1AQZA 4XDWA 3V99A 2R4IA 3OWYA 1SJWA 4LEHA 5CLKA 5AYRB 3QK9A 2P0XA 5FW5A 4AKZA 3I563 1KC84 3U1WA 3D9RA 5IENA 3ZG0A 1T5YA 2UX0A 3DGLA 1DETA 1JV2B 2MC8A 1T2IA 3WOEB 5JBSA 3B4OA 5JPUA 2STDA 3JUQA 1SGVA 4STDA 3CU3A 5CXOA 3LWVA 1I2FA 1NB3I 1RDSA 3MQKA 3MSOA 3GZBA 1DMQA 1NJI4 3CNMA 4J8TA 3D3LA 1V57A 4HZ9B 3VGNA 4BL2A 3U97A 4LZIA 1ULJB 4MJDA 1A90A 1GMPA 1M9GA 1UW1A 3X42A 4BTYA 2XFSA 3GRDA 5DRVA 1LOYA 3MYTA 4HOHA 4AKYA 1VQN3 3UL6A 3K9MC 2CFKA 3NX0A 5RNTA 1VQQA 3EBYA 1RLSA 3BNBA 3FGYA 4HM3B 3CPOA 3DH2A 4GSPA 5M18A 1HZ1A 3LWQA 1RN7A 1O7NB 3WODG 4MMYB 1E97A 1J2BA 1UUWB 2XR8B 3K0ZA 1QVG2 1JKGB 1NWWA 3LOYA 4BIRA 5IG3A 2WGQA 3LWOA 5G2GA 3BNEA 1S723 2YX9A 3UB1A 3EF8A 5M1AA 1B2MA 4N6TA 2KXGA 2BIRA 4R9KA 3URPA 1VQ83 2L4VA 1R4YA 2OCTA 1I2GA 3AGNA 3FLJA 4R80A 2SBLA 4EBGA 1I8VA 4LSOA 3G16A 2XFTA 3CCL3 2AAEA 1M1K4 1FGQA 1WQLB 2F5WA 1GYBA 3LMLA 1EUIC 3FKAA 4G1MB 2W04A 2CFGA 2OQEA 1YIJ3 4BTWA 1U8CB 1D6YA 2FXTA 1K41A 1TFKA 2ML5A 4HM7B 4WHAA 3NHXA 3KZTA 1NU3A 3LT9A 3NV0B 1JN5A 4R9LA 2E2TA 4HM6B 1W4NA 1BRNL 3MWZA 3FSDA 1ZBOA 3LJCA 1BVIA 2CX0A 3ZV0C 2F99A 1LOVA 2RNTA 3JUMA 1CEWI 1B2UA 1OGZA 4RNYA 1IU7A 1N9EA 3BLZA 1YI23 3NBBA 3FF0A 3T8UA 1FW7A 1NNVA 5HOHA 2AADA 3HX8A 1TP6A 1Q7HA 2GEXA 1STDA 3WA2X 1TRQA 1W02A 1A67A 7RNTA 3SVAA 2DP9A 2KKUA 2BMRB 4LYLB 1LQMB 3BB9A 4XDVA 5D81A 1TRPA 6GSPA 3C0KA 4KFDA 2ZL8A 2RBIA 2OQEC 3NUVA 5CF2A 5IG5A 1YJN3 1VQ63 1R4CA 2CG1A 1K734 5AIIA 1TJDA 1ZX2A 3CCQ3 1B21A 3FZWA 1B2ZA 2QEX3 1N8QA 1W6CA 2E2VA 3DM8A 4WYKB 1GY6A 1STFI 5EVHA 1D6UA 2OTJ3 3HI7A 1R3EA 4XBYA 1IT7A 1JN5B 3SX1A 2BNGA 1BSCA 3N8BA 5IG4A 1B20A 3HZPA 1DMNA 2Y74A 3EBTA 1GOVA 3FH1A 1GOYA 4OVMA 2KF3A 4L8OA 2Z7AA 1TFOA 4CCVA 4JF8A 2W9QA 3B4PA 1WTHA 2F56A 1OHOA 3GWRA 2RFKA 2OOVA 1SQWA 3NXJA 4N6NB 8RNTA 3MG3A 4IPBA 1EKMA 3X41A 1G0TA 1WXXA 1LQGC 4R1KA 2KF6A 3CD63 3J7Yd 1V58A 3AGOA 4WP5A 3X3ZA 1O7MB 1QMAA 2IUKA 2RFRA 4ZM8A 1CYVA 2P05A 1BOXA 1ULIB 1WMOA 1RGGA 4OK0A 5A0OB 3IMAB 3LH4A 4N6MA 9RNTA 1JJ22 3LDFA 3ROBA 1PFPA 3CC43 6STDA 1W5ZA 1QVF2 2IA7A 2OWPA 1I0XA 1I2EA 1IV7A 3D4AA 1DMMA 3NV0A 3CNXA 4WYKA 5IEPA 5AIGA 1AY7A 4H3UA 3PYJA 1ISKA 3LWPA 1FGMA 1YJ93 1WMNA 3EN1B 3UJMA 1IQXA 4OUQA 2KAAA 1UUGB 1LRAA 1FGTA 2HMLB 1PY3A 1KWIA 3N54B 2CK3H 1D6ZA 5CF1A 4XB5A 4IIAA 1VQ53 1K8WA 1M1XB 3D5GA 1GMRA 3CCS3 2XGLA 2Z6BA 3GZXB 1Q864 4N3VA 4N6V0 2INXA 2XGNA 5AIFA 5G1KA 1OH0A 3X3XA 2CG0A 4FR9A 4CI1B 2FNQA 5JPPA 3OW22 3OXAA 1O7HB 4L7KA 1RN1A 2QA43 2F5MA 2O9UX 2XSHB 3GSPA 1JBSA 3BIRA 3IUWA 3AMOA 2E2UA 2C10A 4J9AA 3EX9A 3DZLA 1BRSA 3RNTA 1UGHI 2MF7A 4FMBA 4K1VA 1DYUA 4ILFA 4N6LA 1W6YA 5IERA 1L5GB 1BRGA 3HK4A 3I553 1O7GB 5KP3A 1TE7A 2RGQA 1IVXA 2LYXA 1OHSA 3DXOA 1PYLA 3DGNA 1UI8A 3DGYA 3KSED 4GL6A 1UUVB 2PNCA 1ROAA 1JZOA 1X1YA 1K28A 1B2SA 1MWTA 2H0HA 4Q1TA 1RSNA 4HM0B 2EY4A 5KP1A 2UGIA 2WGOA 1IVUA 1GD3A 2LQVA 3VSYA 1VQ73 2O3OA 5HGRA 1BNSA 4BU4A 2H0IA 1RGCA 4HVNA 4BTXA 3D5IA 5IW9A 1XNEA 2GBXB 1YHQ3 3PGBA 1M904 4CJNA 1Q824 2XRXB 2B1XB 2HMJB 2Z0TA 2GSPA 1GMQA 2GU3A 1JRQA 2J5TA 2JDIH 2BMQB 3M6WA 1SIHA 1W2ZA 1DVCA 1W7CA 1F8NA 4XBXA 1LOXA 3NM2A 1B3SA 2C4BA 3G8ZA 4FMAA 3CMA3 1R3FA 3U28A 4EV2A 3S67A 1RMSA 4EW5A 1VQL3 2IYJA 3UL5A 3CCR3 3RDEA 1QAKA 1UOYA 1BNGA 1QAFA 1Z1SA 1RN4A 2KF5A 2Z77A 2V1LA 3AHWA 4KZ1A 2I9WA 3CCE3 4LGQA 4WFOA 1FA3A 1DE3A 1TU5A 1BUJA 8CHOA 4KT3B 1BRHA 2WOHA 3T8NA 2XEPA 1N8R4 2APOA 3Q3FA 4TZ4C 2SARA 5M19A 4NPBA 3A76A 1BNJA 3AHSA 3S28A 1JBRA 2GBWB 4HZBB 2KCDA 4BL3A 7GSPA 2K0MA 2BO9B 1RJOA 3N9HA 1VQP3 1T2HA 4HAAA 4O02B 1BNEA 2CC3A 3M8CA 1IVWA 2IY2A 1OUNA 3AMOB 3K63A 3KFQC 2W56B 4CI3B 2P09A 5I97A 1Q42A 2F98A 4H61A 4GB5A 5EEOA 1YJW3 1YVSA 1FGOA 1RNTA 1RCLA 1RHLA 1UCIA 3EHCA 4X2OA 3WR2A 5AIHA 4DKIA 3EN8A 1W00A 2WOFA 3PCSA 3V92A 3DGOA 1AVKA 3JVCA 1WXWA 3FG1A 3LZAA 1UCJA 4FCZA 5DREA 1G02A 2B24B 4O3VA 1BU4A 4RBNA 5BU4A 1U5OA 1WNHA 3KE7A 3KSPA 1FUSA 3M6XA 1E3RA 5FGOA 5STDA 4JRFA 2CIUA 3K7CA 3NBJA 4N6UA 3X3YA 1ZE1A 1G96A 1KD14 1K9M4 1O7WB 1ZGXA 3OX9A 3DY5A 2QIYA 4ORLA 3MG2A 5D83A 3DGMA 1RKYA 1LNHA 2W03A 1O7PB 3QRDA 2HMMB 3KIIA 1FUTA 3LWRA 2IMJA 4QWTA 3GZYB 4XBTA 1VQ43 1BNRA 3GAXA 2W2CA 3Q90A 1BRJA 1UDII 3BNDA 1EA2A 2GEYA 4HBRA 2CWTA 3FF2A 2AS0A 3H51A 3M6UA 4RNTA 2K3DA 1UGIA 5EQLA 3RGAA 6RNTA 1S5AA 1FUWA 4HM1B 4O8SA 4KVHA 3STDA 4EV5A 1GOUA 1RRHA 3IJEB 3LTCA 1MWRA 1JNQA 2M7OA 1LNIA 4NREA 3B7CA 2BHMA 4HM8B 1MGRA 3HAXA 1ROVA 2F86B 2C11A 4EC6A 1AR0A 1OHPA 3L0RA 2CH9A 3GZRA 1BSDA 3NBRA 1Q7Y4 4CPKA 1W2B2 2YFLB 1HU9A 2KRTA 1Q40B 1RTUA 3MPHA 1UI7A 5TGNA 2ZDJA 2CX1A 1IDPA 1RGKA 3NQYA 3F8XA 3TDGA 1LXEA 1MWUA 2D1WA 2CWWA 2W6JH 3CC23 2OOVC 3ALAA 1IVVA 3HIIA 3PS8A 4U13A 5ELJA 4HKVB 2F4YA 1Q814 3FG3A 4KFEA 1ZS7A 4WWUC 1JKGA 4K61A 3HIGA 2W9PA 3IPTA 1YIT3 1BUQA 5GSPA 3RGRA 3ZG5A 3G4S3 1BAOA 3EE1A 4L8PA 1X1WA 4X2HA 1GS3A 1RGEA 3CCM3 4XM4A 1AV4A 1CQSA 2GXFA 2CHCA 3Q1CA 3PZWA 3M6VA 3NM7A 1FZUA 2R41A 3B8LA 2CFWA 7STDA 3BU4A 1NDOB 3LT8A 1BNIA 1A2KA 1HKXA 1LVNA 2HVYA 1OGXA 1YGEA 2KF4A 1VQK3 1CH0A 2BMOB 2Q07A 2XSOB 2WO0A 1JZDA 2PZVA 1X1XA 5LC6A 1US1A 3A5EA 2B78A 4PEJA 1IQ8A 2ANEA 2J5VA 2K54A 4CI2B 1JB4A 4FCMA 1BSBA 3WOFB 2OTL3 1WMPA 1JB5A 3JUNA 3G713 4HM5B 3G6E3 2BT3A 3I0YA 1VQO3 2CKFB 2P0MA 1VQ93 1BRKA 1BIRA 1LOWA 3H3HA 3HOHA 1Y4KA 1N9JA 3EB8A 4HYZA 2E5OA 3EC9A 1DVDA 3HJWA 3ZFZA 4AEQA 1OPYA 3Q2PA 3SOYA 4FMDA 2ZA4A 3LTAA 3KKGA 3X40A 3PCRA 4EYCA 3F14A 1SPUA 3FCSB 3S27A 2HMOB 5BVBA 1EQKA 2CWUA 1OACA 1ZL3A 2ML6A 1RNBA 1I3FA 3OWSA 1VQM3 2ZHXB 2D42A 3OV4A 4MEIA 1Q40A 1QALA 3JUPA 3V98A 1RRLA 5AEUB 1RGFA 2XF3A 3BNCA 1IK3A 3CCU3 2H0GA 4TX4A 1N5PA 4RZMA 4HM4B 1K8A4 3CC73 1HYFA 4N6OB 1MWSA 1SARA 3MHEA 2HMNB 3MKIA 4IT7A 3O8YA 1ASKA 4I5QA 2BU4A 5BXQA 3KN4A 1VZZA 5LC7A 1TUHA 2CWVA 1S04A 2RSXA 2GU1A 4K90B 1BRIA 3DMCA 3ER7A 3CCV3 1X1UA 1UCKA 1CYUA 1W01A 1RCKA 2YFJB 2CFLA 2QGUA 3KCHA 4O2HA 1A2VA 1MOLA 2A15A 2FGTA 3EQQB 3FG4A 2HMKB 3G0KA 5AI1A 1RGHA 3WA3A 1C54A 1TTOA 3OWUA 3SLUA 4FCJA 5AYSC 1GSPA 4RNZA 2CW9A 5ELUA 1KQS2 3WMDA 5BIRA 1NB5I 4KFFA 2XH9A 5IEOA 4MMXB
chains in the Genus database with same CATH topology
1ZO2A 5CK6A 3S29A 1OCVA 3ECFA 3F8HA 1JB2A 2W0QA 4EXRA 2CFDA 3DUKA 3F7XA 1ZE2A 5IF6A 2P38A 5KP4A 4FMCA 3E99A 2Y73A 4I4KA 3SXXA 4HM2B 1IT8A 3F9SA 3PXMA 3VF1A 2Z76A 1V74A 1QJGA 1OF5A 4HJLB 1FGRA 5D82A 1EG9B 3CXC2 1KSIA 1E3VA 3LTDA 2JQ5A 2RCDA 5IG0A 4R4KA 1C7HA 3EJVA 4K1UA 1MNLA 3S5CA 3SEDA 3VSEA 3NQZA 3LTBA 3UNLA 1W6GA 4MMZB 4LMIA 1NO3A 3WDGB 1YVBI 1IV9A 3LXUX 2IUJA 3CPW2 3T0UA 3LYGA 3CME3 3F7SA 1GD4A 1AVLA 5AEWB 3F40A 4DMGA 3CCJ3 1GY7A 2YFIB 1PU4A 3D79A 1SIIA 4CDLA 1TIJA 3JUOA 4Q53A 3SOAA 4NHFA 3MG1A 3UAIA 3K5TA 2AB4A 2W56A 1IQYA 1GY5A 1OF5B 1N5HA 4XDWA 3V99A 2R4IA 3OWYA 1SJWA 4LEHA 5CLKA 5AYRB 3QK9A 2P0XA 5FW5A 4AKZA 3I563 1KC84 3U1WA 3D9RA 5IENA 1T5YA 2UX0A 3DGLA 1JV2B 2MC8A 3WOEB 5JBSA 3B4OA 5JPUA 2STDA 3JUQA 1SGVA 4STDA 3CU3A 5CXOA 1NB3I 3MSOA 3GZBA 1DMQA 1NJI4 3CNMA 4J8TA 3D3LA 4HZ9B 3VGNA 3U97A 4LZIA 1ULJB 4MJDA 1A90A 1M9GA 1UW1A 3X42A 4BTYA 2XFSA 3GRDA 5DRVA 3MYTA 4AKYA 1VQN3 3UL6A 3K9MC 2CFKA 3NX0A 3FGYA 3EBYA 3BNBA 4HM3B 3CPOA 1RN7A 1O7NB 3WODG 4MMYB 1E97A 1J2BA 1UUWB 2XR8B 3K0ZA 1QVG2 1JKGB 1NWWA 3LOYA 5IG3A 2WGQA 5G2GA 3BNEA 1S723 2YX9A 3UB1A 3EF8A 4N6TA 2KXGA 4R9KA 1VQ83 2L4VA 2OCTA 3FLJA 4R80A 2SBLA 4EBGA 4LSOA 3G16A 2XFTA 3CCL3 1M1K4 1FGQA 1WQLB 1GYBA 3LMLA 3FKAA 4G1MB 2W04A 2CFGA 2OQEA 1YIJ3 4BTWA 1U8CB 1D6YA 2FXTA 1K41A 1TFKA 2ML5A 4HM7B 4WHAA 3NHXA 3KZTA 1NU3A 3LT9A 3NV0B 1JN5A 4R9LA 2E2TA 4HM6B 1W4NA 3MWZA 3FSDA 2CX0A 2F99A 3JUMA 4RNYA 1CEWI 1OGZA 1YI23 1IU7A 1N9EA 3BLZA 3NBBA 3FF0A 3T8UA 3HX8A 3WA2X 1TP6A 1Q7HA 2GEXA 1STDA 1A67A 1W02A 3SVAA 2BMRB 5D81A 3BB9A 4XDVA 3C0KA 4KFDA 2ZL8A 2OQEC 3NUVA 5CF2A 5IG5A 1YJN3 1VQ63 1R4CA 2CG1A 1K734 5AIIA 3CCQ3 1ZX2A 3FZWA 2QEX3 1N8QA 1W6CA 2E2VA 3DM8A 4WYKB 1GY6A 1STFI 5EVHA 1D6UA 2OTJ3 3HI7A 1R3EA 4XBYA 1IT7A 1JN5B 3SX1A 2BNGA 3N8BA 5IG4A 3HZPA 1DMNA 2Y74A 3EBTA 3FH1A 4OVMA 4L8OA 2Z7AA 1TFOA 4CCVA 4JF8A 2W9QA 3B4PA 1WTHA 3GWRA 1OHOA 2OOVA 1SQWA 3NXJA 4N6NB 3MG3A 4IPBA 1EKMA 3X41A 1WXXA 4R1KA 3CD63 3J7Yd 4WP5A 3X3ZA 1O7MB 1QMAA 2IUKA 2RFRA 4ZM8A 1CYVA 2P05A 1ULIB 1WMOA 4OK0A 5A0OB 3IMAB 3LH4A 4N6MA 1JJ22 3LDFA 3ROBA 1PFPA 3CC43 6STDA 1W5ZA 1QVF2 2IA7A 2OWPA 1IV7A 1DMMA 3NV0A 3CNXA 4WYKA 5IEPA 5AIGA 4H3UA 3PYJA 1ISKA 1FGMA 1YJ93 1WMNA 3EN1B 3UJMA 1IQXA 4OUQA 1FGTA 2HMLB 1KWIA 3N54B 2CK3H 1D6ZA 5CF1A 4XB5A 4IIAA 1VQ53 1K8WA 1M1XB 3CCS3 2XGLA 2Z6BA 3GZXB 1Q864 4N3VA 4N6V0 2INXA 2XGNA 5AIFA 1OH0A 3X3XA 2CG0A 4FR9A 5JPPA 2FNQA 3OW22 3OXAA 1O7HB 4L7KA 2QA43 2O9UX 2XSHB 3AMOA 2E2UA 2C10A 4J9AA 3EX9A 3DZLA 2MF7A 4FMBA 4K1VA 1DYUA 4N6LA 1W6YA 5IERA 1L5GB 3HK4A 3I553 1O7GB 5KP3A 2RGQA 1IVXA 2LYXA 1OHSA 3DXOA 3KSED 3DGNA 1UI8A 4GL6A 1UUVB 2PNCA 1ROAA 1K28A 4Q1TA 4HM0B 5KP1A 2WGOA 1IVUA 1GD3A 2LQVA 3VSYA 1VQ73 2O3OA 5HGRA 4HVNA 4BTXA 5IW9A 2GBXB 1YHQ3 3PGBA 1M904 1Q824 2XRXB 2B1XB 2HMJB 2GU3A 1JRQA 2J5TA 2JDIH 2BMQB 1SIHA 1W2ZA 1DVCA 1W7CA 1F8NA 4XBXA 1LOXA 3NM2A 3G8ZA 4FMAA 3CMA3 1R3FA 4EV2A 3S67A 1VQL3 3UL5A 3CCR3 3RDEA 1QAKA 1QAFA 2Z77A 1Z1SA 4KZ1A 2V1LA 3CCE3 2I9WA 4LGQA 4WFOA 1FA3A 1TU5A 8CHOA 2WOHA 3T8NA 2XEPA 1N8R4 3A76A 3S28A 2GBWB 4HZBB 2KCDA 2K0MA 2BO9B 1RJOA 3N9HA 1VQP3 4O02B 2CC3A 3M8CA 1IVWA 1OUNA 3AMOB 3K63A 3KFQC 2W56B 2P09A 5I97A 1Q42A 2F98A 4H61A 4GB5A 5EEOA 1YJW3 1FGOA 3EHCA 4X2OA 5AIHA 3EN8A 1W00A 2WOFA 3PCSA 3V92A 3DGOA 1AVKA 3JVCA 1WXWA 3FG1A 3LZAA 4FCZA 5DREA 2B24B 4O3VA 4RBNA 1U5OA 1WNHA 3KE7A 3KSPA 5FGOA 1E3RA 5STDA 4JRFA 2CIUA 3K7CA 3NBJA 4N6UA 3X3YA 1ZE1A 1G96A 1KD14 1K9M4 1O7WB 3OX9A 3DY5A 2QIYA 4ORLA 3MG2A 5D83A 3DGMA 1RKYA 1LNHA 2W03A 1O7PB 3QRDA 2HMMB 3KIIA 4XBTA 2IMJA 4QWTA 3GZYB 1VQ43 3GAXA 2W2CA 3Q90A 3BNDA 1EA2A 2GEYA 4HBRA 2CWTA 3FF2A 2AS0A 3H51A 5EQLA 3RGAA 1S5AA 1FUWA 4HM1B 4O8SA 4KVHA 3STDA 4EV5A 1RRHA 3IJEB 3LTCA 1JNQA 2M7OA 4NREA 3B7CA 2BHMA 4HM8B 1ROVA 2F86B 2C11A 4EC6A 1AR0A 1OHPA 3L0RA 2CH9A 3GZRA 3NBRA 1Q7Y4 1W2B2 2YFLB 1HU9A 2KRTA 1Q40B 3MPHA 1UI7A 5TGNA 2ZDJA 2CX1A 1IDPA 3NQYA 3TDGA 3F8XA 1LXEA 2D1WA 2CWWA 2W6JH 3CC23 2OOVC 3ALAA 1IVVA 3HIIA 3PS8A 4U13A 5ELJA 4HKVB 1Q814 3FG3A 4KFEA 1ZS7A 4WWUC 1JKGA 4K61A 3HIGA 2W9PA 3IPTA 1YIT3 1BUQA 3RGRA 3G4S3 3EE1A 4L8PA 3CCM3 4X2HA 1GS3A 4XM4A 1AV4A 1CQSA 2GXFA 2CHCA 3Q1CA 3PZWA 3NM7A 3B8LA 2CFWA 7STDA 3LT8A 1NDOB 1LVNA 1A2KA 1HKXA 1OGXA 1YGEA 1VQK3 2BMOB 2Q07A 2XSOB 2WO0A 2PZVA 5LC6A 1US1A 4PEJA 2B78A 1IQ8A 2J5VA 2K54A 1JB4A 4FCMA 3WOFB 2OTL3 1WMPA 1JB5A 3JUNA 3G713 4HM5B 3G6E3 2BT3A 3I0YA 1VQO3 2CKFB 2P0MA 1VQ93 3H3HA 1Y4KA 1N9JA 3EB8A 4HYZA 3EC9A 1DVDA 4AEQA 1OPYA 3Q2PA 3SOYA 4FMDA 3LTAA 3KKGA 3X40A 3PCRA 4EYCA 3F14A 1SPUA 3FCSB 3S27A 2HMOB 5BVBA 1EQKA 2CWUA 1OACA 1ZL3A 2ML6A 3OWSA 1VQM3 3OV4A 2D42A 4MEIA 3V98A 1Q40A 1QALA 3JUPA 5AEUB 1RRLA 3CCU3 2XF3A 3BNCA 1IK3A 4TX4A 1N5PA 4RZMA 4HM4B 3CC73 4N6OB 3MHEA 2HMNB 3MKIA 4IT7A 3O8YA 1ASKA 5BXQA 3KN4A 1VZZA 5LC7A 1TUHA 2CWVA 2RSXA 4K90B 2GU1A 3CCV3 3DMCA 3ER7A 1K8A4 1CYUA 1W01A 2YFJB 2CFLA 2QGUA 4O2HA 1A2VA 1MOLA 2A15A 2FGTA 3EQQB 3FG4A 2HMKB 3G0KA 5AI1A 3WA3A 3OWUA 3SLUA 4FCJA 5AYSC 4RNZA 2CW9A 5ELUA 1KQS2 3WMDA 1NB5I 4KFFA 2XH9A 5IEOA 4MMXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5T A;  1WXX A;  3C0K A;  1SGV A;  1J2B A;  1ZE1 A;  4DMG A;  1ZE2 A;  1K8W A;  1R3F A;  2P38 A;  3D79 A;  4Q1T A;  2Q07 A;  1IT8 A;  3LDF A;  1R3E A;  1IT7 A;  2CX1 A;  1ZL3 A;  3UAI A;  2CX0 A;  2CWW A;  2B78 A;  2AB4 A;  1IQ8 A;  2AS0 A;  2J5V A;  1ZS7 A;  1Q7H A;  1WXW A;  3VSE A;  1T5Y A;  1SQW A; 
#chains in the Genus database with same CATH topology
 1ZO2 A;  5CK6 A;  3S29 A;  1OCV A;  3ECF A;  1I70 A;  1YGW A;  3F8H A;  1JB2 A;  2W0Q A;  4EXR A;  2CFD A;  1BSA A;  3DUK A;  1RGL A;  1ZE2 A;  3F7X A;  5IF6 A;  4J5G A;  1Q9E A;  2P38 A;  5KP4 A;  4FMC A;  3E99 A;  1EEJ A;  1A2P A;  2Y73 A;  1BAN A;  4I4K A;  1BNF A;  3SXX A;  4HM2 B;  1BSE A;  1IT8 A;  1BGS A;  3F9S A;  3PXM A;  3VF1 A;  2Z76 A;  1MGW A;  1V74 A;  2J8X B;  1FYS A;  1JBT A;  1QJG A;  1OF5 A;  4HJL B;  1FGR A;  5D82 A;  1EG9 B;  3CXC 2;  2HOH A;  1KSI A;  1E3V A;  3LTD A;  2JQ5 A;  2RCD A;  1UCL A;  4R4K A;  1C7H A;  3EJV A;  1RGA A;  4K1U A;  5IG0 A;  1MNL A;  3S5C A;  3SED A;  1B27 A;  3VSE A;  3NQZ A;  3LTB A;  3M4X A;  1W6G A;  3UNL A;  4MMZ B;  4LMI A;  1B2X A;  2AUS A;  1NO3 A;  3WDG B;  1YVB I;  3SYU A;  1IV9 A;  3LXU X;  5G1L A;  2IUJ A;  3CPW 2;  1IYY A;  2FRX A;  3T0U A;  3LYG A;  3CME 3;  3F7S A;  1GD4 A;  1AVL A;  5AEW B;  3F40 A;  4DMG A;  1WK2 A;  3CCJ 3;  1GY7 A;  4GHO A;  2YFI B;  4J5K A;  3WHO A;  2UUG C;  1PU4 A;  3D79 A;  1SII A;  4CDL A;  1TIJ A;  3JUO A;  4Q53 A;  3SOA A;  1I0V A;  2L1S A;  4NHF A;  1YNV X;  3MG1 A;  1I3I A;  3UAI A;  3K5T A;  2AB4 A;  2W56 A;  3M65 A;  3HJY A;  1IQY A;  1GY5 A;  1T3B A;  1OF5 B;  1N5H A;  1AQZ A;  4XDW A;  3V99 A;  2R4I A;  3OWY A;  1SJW A;  4LEH A;  5CLK A;  5AYR B;  3QK9 A;  2P0X A;  5FW5 A;  4AKZ A;  3I56 3;  1KC8 4;  3U1W A;  3D9R A;  5IEN A;  3ZG0 A;  1T5Y A;  2UX0 A;  3DGL A;  1DET A;  1JV2 B;  2MC8 A;  1T2I A;  3WOE B;  5JBS A;  3B4O A;  5JPU A;  2STD A;  3JUQ A;  1SGV A;  4STD A;  3CU3 A;  5CXO A;  3LWV A;  1I2F A;  1NB3 I;  1RDS A;  3MQK A;  3MSO A;  3GZB A;  1DMQ A;  1NJI 4;  3CNM A;  4J8T A;  3D3L A;  1V57 A;  4HZ9 B;  3VGN A;  4BL2 A;  3U97 A;  4LZI A;  1ULJ B;  4MJD A;  1A90 A;  1GMP A;  1M9G A;  1UW1 A;  3X42 A;  4BTY A;  2XFS A;  3GRD A;  5DRV A;  1LOY A;  3MYT A;  4HOH A;  4AKY A;  1VQN 3;  3UL6 A;  3K9M C;  2CFK A;  3NX0 A;  5RNT A;  1VQQ A;  3EBY A;  1RLS A;  3BNB A;  3FGY A;  4HM3 B;  3CPO A;  3DH2 A;  4GSP A;  5M18 A;  1HZ1 A;  3LWQ A;  1RN7 A;  1O7N B;  3WOD G;  4MMY B;  1E97 A;  1J2B A;  1UUW B;  2XR8 B;  3K0Z A;  1QVG 2;  1JKG B;  1NWW A;  3LOY A;  4BIR A;  5IG3 A;  2WGQ A;  3LWO A;  5G2G A;  3BNE A;  1S72 3;  2YX9 A;  3UB1 A;  3EF8 A;  5M1A A;  1B2M A;  4N6T A;  2KXG A;  2BIR A;  4R9K A;  3URP A;  1VQ8 3;  2L4V A;  1R4Y A;  2OCT A;  1I2G A;  3AGN A;  3FLJ A;  4R80 A;  2SBL A;  4EBG A;  1I8V A;  4LSO A;  3G16 A;  2XFT A;  3CCL 3;  2AAE A;  1M1K 4;  1FGQ A;  1WQL B;  2F5W A;  1GYB A;  3LML A;  1EUI C;  3FKA A;  4G1M B;  2W04 A;  2CFG A;  2OQE A;  1YIJ 3;  4BTW A;  1U8C B;  1D6Y A;  2FXT A;  1K41 A;  1TFK A;  2ML5 A;  4HM7 B;  4WHA A;  3NHX A;  3KZT A;  1NU3 A;  3LT9 A;  3NV0 B;  1JN5 A;  4R9L A;  2E2T A;  4HM6 B;  1W4N A;  1BRN L;  3MWZ A;  3FSD A;  1ZBO A;  3LJC A;  1BVI A;  2CX0 A;  3ZV0 C;  2F99 A;  1LOV A;  2RNT A;  3JUM A;  1CEW I;  1B2U A;  1OGZ A;  4RNY A;  1IU7 A;  1N9E A;  3BLZ A;  1YI2 3;  3NBB A;  3FF0 A;  3T8U A;  1FW7 A;  1NNV A;  5HOH A;  2AAD A;  3HX8 A;  1TP6 A;  1Q7H A;  2GEX A;  1STD A;  3WA2 X;  1TRQ A;  1W02 A;  1A67 A;  7RNT A;  3SVA A;  2DP9 A;  2KKU A;  2BMR B;  4LYL B;  1LQM B;  3BB9 A;  4XDV A;  5D81 A;  1TRP A;  6GSP A;  3C0K A;  4KFD A;  2ZL8 A;  2RBI A;  2OQE C;  3NUV A;  5CF2 A;  5IG5 A;  1YJN 3;  1VQ6 3;  1R4C A;  2CG1 A;  1K73 4;  5AII A;  1TJD A;  1ZX2 A;  3CCQ 3;  1B21 A;  3FZW A;  1B2Z A;  2QEX 3;  1N8Q A;  1W6C A;  2E2V A;  3DM8 A;  4WYK B;  1GY6 A;  1STF I;  5EVH A;  1D6U A;  2OTJ 3;  3HI7 A;  1R3E A;  4XBY A;  1IT7 A;  1JN5 B;  3SX1 A;  2BNG A;  1BSC A;  3N8B A;  5IG4 A;  1B20 A;  3HZP A;  1DMN A;  2Y74 A;  3EBT A;  1GOV A;  3FH1 A;  1GOY A;  4OVM A;  2KF3 A;  4L8O A;  2Z7A A;  1TFO A;  4CCV A;  4JF8 A;  2W9Q A;  3B4P A;  1WTH A;  2F56 A;  1OHO A;  3GWR A;  2RFK A;  2OOV A;  1SQW A;  3NXJ A;  4N6N B;  8RNT A;  3MG3 A;  4IPB A;  1EKM A;  3X41 A;  1G0T A;  1WXX A;  1LQG C;  4R1K A;  2KF6 A;  3CD6 3;  3J7Y d;  1V58 A;  3AGO A;  4WP5 A;  3X3Z A;  1O7M B;  1QMA A;  2IUK A;  2RFR A;  4ZM8 A;  1CYV A;  2P05 A;  1BOX A;  1ULI B;  1WMO A;  1RGG A;  4OK0 A;  5A0O B;  3IMA B;  3LH4 A;  4N6M A;  9RNT A;  1JJ2 2;  3LDF A;  3ROB A;  1PFP A;  3CC4 3;  6STD A;  1W5Z A;  1QVF 2;  2IA7 A;  2OWP A;  1I0X A;  1I2E A;  1IV7 A;  3D4A A;  1DMM A;  3NV0 A;  3CNX A;  4WYK A;  5IEP A;  5AIG A;  1AY7 A;  4H3U A;  3PYJ A;  1ISK A;  3LWP A;  1FGM A;  1YJ9 3;  1WMN A;  3EN1 B;  3UJM A;  1IQX A;  4OUQ A;  2KAA A;  1UUG B;  1LRA A;  1FGT A;  2HML B;  1PY3 A;  1KWI A;  3N54 B;  2CK3 H;  1D6Z A;  5CF1 A;  4XB5 A;  4IIA A;  1VQ5 3;  1K8W A;  1M1X B;  3D5G A;  1GMR A;  3CCS 3;  2XGL A;  2Z6B A;  3GZX B;  1Q86 4;  4N3V A;  4N6V 0;  2INX A;  2XGN A;  5AIF A;  5G1K A;  1OH0 A;  3X3X A;  2CG0 A;  4FR9 A;  4CI1 B;  2FNQ A;  5JPP A;  3OW2 2;  3OXA A;  1O7H B;  4L7K A;  1RN1 A;  2QA4 3;  2F5M A;  2O9U X;  2XSH B;  3GSP A;  1JBS A;  3BIR A;  3IUW A;  3AMO A;  2E2U A;  2C10 A;  4J9A A;  3EX9 A;  3DZL A;  1BRS A;  3RNT A;  1UGH I;  2MF7 A;  4FMB A;  4K1V A;  1DYU A;  4ILF A;  4N6L A;  1W6Y A;  5IER A;  1L5G B;  1BRG A;  3HK4 A;  3I55 3;  1O7G B;  5KP3 A;  1TE7 A;  2RGQ A;  1IVX A;  2LYX A;  1OHS A;  3DXO A;  1PYL A;  3DGN A;  1UI8 A;  3DGY A;  3KSE D;  4GL6 A;  1UUV B;  2PNC A;  1ROA A;  1JZO A;  1X1Y A;  1K28 A;  1B2S A;  1MWT A;  2H0H A;  4Q1T A;  1RSN A;  4HM0 B;  2EY4 A;  5KP1 A;  2UGI A;  2WGO A;  1IVU A;  1GD3 A;  2LQV A;  3VSY A;  1VQ7 3;  2O3O A;  5HGR A;  1BNS A;  4BU4 A;  2H0I A;  1RGC A;  4HVN A;  4BTX A;  3D5I A;  5IW9 A;  1XNE A;  2GBX B;  1YHQ 3;  3PGB A;  1M90 4;  4CJN A;  1Q82 4;  2XRX B;  2B1X B;  2HMJ B;  2Z0T A;  2GSP A;  1GMQ A;  2GU3 A;  1JRQ A;  2J5T A;  2JDI H;  2BMQ B;  3M6W A;  1SIH A;  1W2Z A;  1DVC A;  1W7C A;  1F8N A;  4XBX A;  1LOX A;  3NM2 A;  1B3S A;  2C4B A;  3G8Z A;  4FMA A;  3CMA 3;  1R3F A;  3U28 A;  4EV2 A;  3S67 A;  1RMS A;  4EW5 A;  1VQL 3;  2IYJ A;  3UL5 A;  3CCR 3;  3RDE A;  1QAK A;  1UOY A;  1BNG A;  1QAF A;  1Z1S A;  1RN4 A;  2KF5 A;  2Z77 A;  2V1L A;  3AHW A;  4KZ1 A;  2I9W A;  3CCE 3;  4LGQ A;  4WFO A;  1FA3 A;  1DE3 A;  1TU5 A;  1BUJ A;  8CHO A;  4KT3 B;  1BRH A;  2WOH A;  3T8N A;  2XEP A;  1N8R 4;  2APO A;  3Q3F A;  4TZ4 C;  2SAR A;  5M19 A;  4NPB A;  3A76 A;  1BNJ A;  3AHS A;  3S28 A;  1JBR A;  2GBW B;  4HZB B;  2KCD A;  4BL3 A;  7GSP A;  2K0M A;  2BO9 B;  1RJO A;  3N9H A;  1VQP 3;  1T2H A;  4HAA A;  4O02 B;  1BNE A;  2CC3 A;  3M8C A;  1IVW A;  2IY2 A;  1OUN A;  3AMO B;  3K63 A;  3KFQ C;  2W56 B;  4CI3 B;  2P09 A;  5I97 A;  1Q42 A;  2F98 A;  4H61 A;  4GB5 A;  5EEO A;  1YJW 3;  1YVS A;  1FGO A;  1RNT A;  1RCL A;  1RHL A;  1UCI A;  3EHC A;  4X2O A;  3WR2 A;  5AIH A;  4DKI A;  3EN8 A;  1W00 A;  2WOF A;  3PCS A;  3V92 A;  3DGO A;  1AVK A;  3JVC A;  1WXW A;  3FG1 A;  3LZA A;  1UCJ A;  4FCZ A;  5DRE A;  1G02 A;  2B24 B;  4O3V A;  1BU4 A;  4RBN A;  5BU4 A;  1U5O A;  1WNH A;  3KE7 A;  3KSP A;  1FUS A;  3M6X A;  1E3R A;  5FGO A;  5STD A;  4JRF A;  2CIU A;  3K7C A;  3NBJ A;  4N6U A;  3X3Y A;  1ZE1 A;  1G96 A;  1KD1 4;  1K9M 4;  1O7W B;  1ZGX A;  3OX9 A;  3DY5 A;  2QIY A;  4ORL A;  3MG2 A;  5D83 A;  3DGM A;  1RKY A;  1LNH A;  2W03 A;  1O7P B;  3QRD A;  2HMM B;  3KII A;  1FUT A;  3LWR A;  2IMJ A;  4QWT A;  3GZY B;  4XBT A;  1VQ4 3;  1BNR A;  3GAX A;  2W2C A;  3Q90 A;  1BRJ A;  1UDI I;  3BND A;  1EA2 A;  2GEY A;  4HBR A;  2CWT A;  3FF2 A;  2AS0 A;  3H51 A;  3M6U A;  4RNT A;  2K3D A;  1UGI A;  5EQL A;  3RGA A;  6RNT A;  1S5A A;  1FUW A;  4HM1 B;  4O8S A;  4KVH A;  3STD A;  4EV5 A;  1GOU A;  1RRH A;  3IJE B;  3LTC A;  1MWR A;  1JNQ A;  2M7O A;  1LNI A;  4NRE A;  3B7C A;  2BHM A;  4HM8 B;  1MGR A;  3HAX A;  1ROV A;  2F86 B;  2C11 A;  4EC6 A;  1AR0 A;  1OHP A;  3L0R A;  2CH9 A;  3GZR A;  1BSD A;  3NBR A;  1Q7Y 4;  4CPK A;  1W2B 2;  2YFL B;  1HU9 A;  2KRT A;  1Q40 B;  1RTU A;  3MPH A;  1UI7 A;  5TGN A;  2ZDJ A;  2CX1 A;  1IDP A;  1RGK A;  3NQY A;  3F8X A;  3TDG A;  1LXE A;  1MWU A;  2D1W A;  2CWW A;  2W6J H;  3CC2 3;  2OOV C;  3ALA A;  1IVV A;  3HII A;  3PS8 A;  4U13 A;  5ELJ A;  4HKV B;  2F4Y A;  1Q81 4;  3FG3 A;  4KFE A;  1ZS7 A;  4WWU C;  1JKG A;  4K61 A;  3HIG A;  2W9P A;  3IPT A;  1YIT 3;  1BUQ A;  5GSP A;  3RGR A;  3ZG5 A;  3G4S 3;  1BAO A;  3EE1 A;  4L8P A;  1X1W A;  4X2H A;  1GS3 A;  1RGE A;  3CCM 3;  4XM4 A;  1AV4 A;  1CQS A;  2GXF A;  2CHC A;  3Q1C A;  3PZW A;  3M6V A;  3NM7 A;  1FZU A;  2R41 A;  3B8L A;  2CFW A;  7STD A;  3BU4 A;  1NDO B;  3LT8 A;  1BNI A;  1A2K A;  1HKX A;  1LVN A;  2HVY A;  1OGX A;  1YGE A;  2KF4 A;  1VQK 3;  1CH0 A;  2BMO B;  2Q07 A;  2XSO B;  2WO0 A;  1JZD A;  2PZV A;  1X1X A;  5LC6 A;  1US1 A;  3A5E A;  2B78 A;  4PEJ A;  1IQ8 A;  2ANE A;  2J5V A;  2K54 A;  4CI2 B;  1JB4 A;  4FCM A;  1BSB A;  3WOF B;  2OTL 3;  1WMP A;  1JB5 A;  3JUN A;  3G71 3;  4HM5 B;  3G6E 3;  2BT3 A;  3I0Y A;  1VQO 3;  2CKF B;  2P0M A;  1VQ9 3;  1BRK A;  1BIR A;  1LOW A;  3H3H A;  3HOH A;  1Y4K A;  1N9J A;  3EB8 A;  4HYZ A;  2E5O A;  3EC9 A;  1DVD A;  3HJW A;  3ZFZ A;  4AEQ A;  1OPY A;  3Q2P A;  3SOY A;  4FMD A;  2ZA4 A;  3LTA A;  3KKG A;  3X40 A;  3PCR A;  4EYC A;  3F14 A;  1SPU A;  3FCS B;  3S27 A;  2HMO B;  5BVB A;  1EQK A;  2CWU A;  1OAC A;  1ZL3 A;  2ML6 A;  1RNB A;  1I3F A;  3OWS A;  1VQM 3;  2ZHX B;  2D42 A;  3OV4 A;  4MEI A;  1Q40 A;  1QAL A;  3JUP A;  3V98 A;  1RRL A;  5AEU B;  1RGF A;  2XF3 A;  3BNC A;  1IK3 A;  3CCU 3;  2H0G A;  4TX4 A;  1N5P A;  4RZM A;  4HM4 B;  1K8A 4;  3CC7 3;  1HYF A;  4N6O B;  1MWS A;  1SAR A;  3MHE A;  2HMN B;  3MKI A;  4IT7 A;  3O8Y A;  1ASK A;  4I5Q A;  2BU4 A;  5BXQ A;  3KN4 A;  1VZZ A;  5LC7 A;  1TUH A;  2CWV A;  1S04 A;  2RSX A;  2GU1 A;  4K90 B;  1BRI A;  3DMC A;  3ER7 A;  3CCV 3;  1X1U A;  1UCK A;  1CYU A;  1W01 A;  1RCK A;  2YFJ B;  2CFL A;  2QGU A;  3KCH A;  4O2H A;  1A2V A;  1MOL A;  2A15 A;  2FGT A;  3EQQ B;  3FG4 A;  2HMK B;  3G0K A;  5AI1 A;  1RGH A;  3WA3 A;  1C54 A;  1TTO A;  3OWU A;  3SLU A;  4FCJ A;  5AYS C;  1GSP A;  4RNZ A;  2CW9 A;  5ELU A;  1KQS 2;  3WMD A;  5BIR A;  1NB5 I;  4KFF A;  2XH9 A;  5IEO A;  4MMX B; 
#chains in the Genus database with same CATH homology
 1ZO2 A;  5CK6 A;  3S29 A;  1OCV A;  3ECF A;  3F8H A;  1JB2 A;  2W0Q A;  4EXR A;  2CFD A;  3DUK A;  3F7X A;  1ZE2 A;  5IF6 A;  2P38 A;  5KP4 A;  4FMC A;  3E99 A;  2Y73 A;  4I4K A;  3SXX A;  4HM2 B;  1IT8 A;  3F9S A;  3PXM A;  3VF1 A;  2Z76 A;  1V74 A;  1QJG A;  1OF5 A;  4HJL B;  1FGR A;  5D82 A;  1EG9 B;  3CXC 2;  1KSI A;  1E3V A;  3LTD A;  2JQ5 A;  2RCD A;  5IG0 A;  4R4K A;  1C7H A;  3EJV A;  4K1U A;  1MNL A;  3S5C A;  3SED A;  3VSE A;  3NQZ A;  3LTB A;  3UNL A;  1W6G A;  4MMZ B;  4LMI A;  1NO3 A;  3WDG B;  1YVB I;  1IV9 A;  3LXU X;  2IUJ A;  3CPW 2;  3T0U A;  3LYG A;  3CME 3;  3F7S A;  1GD4 A;  1AVL A;  5AEW B;  3F40 A;  4DMG A;  3CCJ 3;  1GY7 A;  2YFI B;  1PU4 A;  3D79 A;  1SII A;  4CDL A;  1TIJ A;  3JUO A;  4Q53 A;  3SOA A;  4NHF A;  3MG1 A;  3UAI A;  3K5T A;  2AB4 A;  2W56 A;  1IQY A;  1GY5 A;  1OF5 B;  1N5H A;  4XDW A;  3V99 A;  2R4I A;  3OWY A;  1SJW A;  4LEH A;  5CLK A;  5AYR B;  3QK9 A;  2P0X A;  5FW5 A;  4AKZ A;  3I56 3;  1KC8 4;  3U1W A;  3D9R A;  5IEN A;  1T5Y A;  2UX0 A;  3DGL A;  1JV2 B;  2MC8 A;  3WOE B;  5JBS A;  3B4O A;  5JPU A;  2STD A;  3JUQ A;  1SGV A;  4STD A;  3CU3 A;  5CXO A;  1NB3 I;  3MSO A;  3GZB A;  1DMQ A;  1NJI 4;  3CNM A;  4J8T A;  3D3L A;  4HZ9 B;  3VGN A;  3U97 A;  4LZI A;  1ULJ B;  4MJD A;  1A90 A;  1M9G A;  1UW1 A;  3X42 A;  4BTY A;  2XFS A;  3GRD A;  5DRV A;  3MYT A;  4AKY A;  1VQN 3;  3UL6 A;  3K9M C;  2CFK A;  3NX0 A;  3FGY A;  3EBY A;  3BNB A;  4HM3 B;  3CPO A;  1RN7 A;  1O7N B;  3WOD G;  4MMY B;  1E97 A;  1J2B A;  1UUW B;  2XR8 B;  3K0Z A;  1QVG 2;  1JKG B;  1NWW A;  3LOY A;  5IG3 A;  2WGQ A;  5G2G A;  3BNE A;  1S72 3;  2YX9 A;  3UB1 A;  3EF8 A;  4N6T A;  2KXG A;  4R9K A;  1VQ8 3;  2L4V A;  2OCT A;  3FLJ A;  4R80 A;  2SBL A;  4EBG A;  4LSO A;  3G16 A;  2XFT A;  3CCL 3;  1M1K 4;  1FGQ A;  1WQL B;  1GYB A;  3LML A;  3FKA A;  4G1M B;  2W04 A;  2CFG A;  2OQE A;  1YIJ 3;  4BTW A;  1U8C B;  1D6Y A;  2FXT A;  1K41 A;  1TFK A;  2ML5 A;  4HM7 B;  4WHA A;  3NHX A;  3KZT A;  1NU3 A;  3LT9 A;  3NV0 B;  1JN5 A;  4R9L A;  2E2T A;  4HM6 B;  1W4N A;  3MWZ A;  3FSD A;  2CX0 A;  2F99 A;  3JUM A;  4RNY A;  1CEW I;  1OGZ A;  1YI2 3;  1IU7 A;  1N9E A;  3BLZ A;  3NBB A;  3FF0 A;  3T8U A;  3HX8 A;  3WA2 X;  1TP6 A;  1Q7H A;  2GEX A;  1STD A;  1A67 A;  1W02 A;  3SVA A;  2BMR B;  5D81 A;  3BB9 A;  4XDV A;  3C0K A;  4KFD A;  2ZL8 A;  2OQE C;  3NUV A;  5CF2 A;  5IG5 A;  1YJN 3;  1VQ6 3;  1R4C A;  2CG1 A;  1K73 4;  5AII A;  3CCQ 3;  1ZX2 A;  3FZW A;  2QEX 3;  1N8Q A;  1W6C A;  2E2V A;  3DM8 A;  4WYK B;  1GY6 A;  1STF I;  5EVH A;  1D6U A;  2OTJ 3;  3HI7 A;  1R3E A;  4XBY A;  1IT7 A;  1JN5 B;  3SX1 A;  2BNG A;  3N8B A;  5IG4 A;  3HZP A;  1DMN A;  2Y74 A;  3EBT A;  3FH1 A;  4OVM A;  4L8O A;  2Z7A A;  1TFO A;  4CCV A;  4JF8 A;  2W9Q A;  3B4P A;  1WTH A;  3GWR A;  1OHO A;  2OOV A;  1SQW A;  3NXJ A;  4N6N B;  3MG3 A;  4IPB A;  1EKM A;  3X41 A;  1WXX A;  4R1K A;  3CD6 3;  3J7Y d;  4WP5 A;  3X3Z A;  1O7M B;  1QMA A;  2IUK A;  2RFR A;  4ZM8 A;  1CYV A;  2P05 A;  1ULI B;  1WMO A;  4OK0 A;  5A0O B;  3IMA B;  3LH4 A;  4N6M A;  1JJ2 2;  3LDF A;  3ROB A;  1PFP A;  3CC4 3;  6STD A;  1W5Z A;  1QVF 2;  2IA7 A;  2OWP A;  1IV7 A;  1DMM A;  3NV0 A;  3CNX A;  4WYK A;  5IEP A;  5AIG A;  4H3U A;  3PYJ A;  1ISK A;  1FGM A;  1YJ9 3;  1WMN A;  3EN1 B;  3UJM A;  1IQX A;  4OUQ A;  1FGT A;  2HML B;  1KWI A;  3N54 B;  2CK3 H;  1D6Z A;  5CF1 A;  4XB5 A;  4IIA A;  1VQ5 3;  1K8W A;  1M1X B;  3CCS 3;  2XGL A;  2Z6B A;  3GZX B;  1Q86 4;  4N3V A;  4N6V 0;  2INX A;  2XGN A;  5AIF A;  1OH0 A;  3X3X A;  2CG0 A;  4FR9 A;  5JPP A;  2FNQ A;  3OW2 2;  3OXA A;  1O7H B;  4L7K A;  2QA4 3;  2O9U X;  2XSH B;  3AMO A;  2E2U A;  2C10 A;  4J9A A;  3EX9 A;  3DZL A;  2MF7 A;  4FMB A;  4K1V A;  1DYU A;  4N6L A;  1W6Y A;  5IER A;  1L5G B;  3HK4 A;  3I55 3;  1O7G B;  5KP3 A;  2RGQ A;  1IVX A;  2LYX A;  1OHS A;  3DXO A;  3KSE D;  3DGN A;  1UI8 A;  4GL6 A;  1UUV B;  2PNC A;  1ROA A;  1K28 A;  4Q1T A;  4HM0 B;  5KP1 A;  2WGO A;  1IVU A;  1GD3 A;  2LQV A;  3VSY A;  1VQ7 3;  2O3O A;  5HGR A;  4HVN A;  4BTX A;  5IW9 A;  2GBX B;  1YHQ 3;  3PGB A;  1M90 4;  1Q82 4;  2XRX B;  2B1X B;  2HMJ B;  2GU3 A;  1JRQ A;  2J5T A;  2JDI H;  2BMQ B;  1SIH A;  1W2Z A;  1DVC A;  1W7C A;  1F8N A;  4XBX A;  1LOX A;  3NM2 A;  3G8Z A;  4FMA A;  3CMA 3;  1R3F A;  4EV2 A;  3S67 A;  1VQL 3;  3UL5 A;  3CCR 3;  3RDE A;  1QAK A;  1QAF A;  2Z77 A;  1Z1S A;  4KZ1 A;  2V1L A;  3CCE 3;  2I9W A;  4LGQ A;  4WFO A;  1FA3 A;  1TU5 A;  8CHO A;  2WOH A;  3T8N A;  2XEP A;  1N8R 4;  3A76 A;  3S28 A;  2GBW B;  4HZB B;  2KCD A;  2K0M A;  2BO9 B;  1RJO A;  3N9H A;  1VQP 3;  4O02 B;  2CC3 A;  3M8C A;  1IVW A;  1OUN A;  3AMO B;  3K63 A;  3KFQ C;  2W56 B;  2P09 A;  5I97 A;  1Q42 A;  2F98 A;  4H61 A;  4GB5 A;  5EEO A;  1YJW 3;  1FGO A;  3EHC A;  4X2O A;  5AIH A;  3EN8 A;  1W00 A;  2WOF A;  3PCS A;  3V92 A;  3DGO A;  1AVK A;  3JVC A;  1WXW A;  3FG1 A;  3LZA A;  4FCZ A;  5DRE A;  2B24 B;  4O3V A;  4RBN A;  1U5O A;  1WNH A;  3KE7 A;  3KSP A;  5FGO A;  1E3R A;  5STD A;  4JRF A;  2CIU A;  3K7C A;  3NBJ A;  4N6U A;  3X3Y A;  1ZE1 A;  1G96 A;  1KD1 4;  1K9M 4;  1O7W B;  3OX9 A;  3DY5 A;  2QIY A;  4ORL A;  3MG2 A;  5D83 A;  3DGM A;  1RKY A;  1LNH A;  2W03 A;  1O7P B;  3QRD A;  2HMM B;  3KII A;  4XBT A;  2IMJ A;  4QWT A;  3GZY B;  1VQ4 3;  3GAX A;  2W2C A;  3Q90 A;  3BND A;  1EA2 A;  2GEY A;  4HBR A;  2CWT A;  3FF2 A;  2AS0 A;  3H51 A;  5EQL A;  3RGA A;  1S5A A;  1FUW A;  4HM1 B;  4O8S A;  4KVH A;  3STD A;  4EV5 A;  1RRH A;  3IJE B;  3LTC A;  1JNQ A;  2M7O A;  4NRE A;  3B7C A;  2BHM A;  4HM8 B;  1ROV A;  2F86 B;  2C11 A;  4EC6 A;  1AR0 A;  1OHP A;  3L0R A;  2CH9 A;  3GZR A;  3NBR A;  1Q7Y 4;  1W2B 2;  2YFL B;  1HU9 A;  2KRT A;  1Q40 B;  3MPH A;  1UI7 A;  5TGN A;  2ZDJ A;  2CX1 A;  1IDP A;  3NQY A;  3TDG A;  3F8X A;  1LXE A;  2D1W A;  2CWW A;  2W6J H;  3CC2 3;  2OOV C;  3ALA A;  1IVV A;  3HII A;  3PS8 A;  4U13 A;  5ELJ A;  4HKV B;  1Q81 4;  3FG3 A;  4KFE A;  1ZS7 A;  4WWU C;  1JKG A;  4K61 A;  3HIG A;  2W9P A;  3IPT A;  1YIT 3;  1BUQ A;  3RGR A;  3G4S 3;  3EE1 A;  4L8P A;  3CCM 3;  4X2H A;  1GS3 A;  4XM4 A;  1AV4 A;  1CQS A;  2GXF A;  2CHC A;  3Q1C A;  3PZW A;  3NM7 A;  3B8L A;  2CFW A;  7STD A;  3LT8 A;  1NDO B;  1LVN A;  1A2K A;  1HKX A;  1OGX A;  1YGE A;  1VQK 3;  2BMO B;  2Q07 A;  2XSO B;  2WO0 A;  2PZV A;  5LC6 A;  1US1 A;  4PEJ A;  2B78 A;  1IQ8 A;  2J5V A;  2K54 A;  1JB4 A;  4FCM A;  3WOF B;  2OTL 3;  1WMP A;  1JB5 A;  3JUN A;  3G71 3;  4HM5 B;  3G6E 3;  2BT3 A;  3I0Y A;  1VQO 3;  2CKF B;  2P0M A;  1VQ9 3;  3H3H A;  1Y4K A;  1N9J A;  3EB8 A;  4HYZ A;  3EC9 A;  1DVD A;  4AEQ A;  1OPY A;  3Q2P A;  3SOY A;  4FMD A;  3LTA A;  3KKG A;  3X40 A;  3PCR A;  4EYC A;  3F14 A;  1SPU A;  3FCS B;  3S27 A;  2HMO B;  5BVB A;  1EQK A;  2CWU A;  1OAC A;  1ZL3 A;  2ML6 A;  3OWS A;  1VQM 3;  3OV4 A;  2D42 A;  4MEI A;  3V98 A;  1Q40 A;  1QAL A;  3JUP A;  5AEU B;  1RRL A;  3CCU 3;  2XF3 A;  3BNC A;  1IK3 A;  4TX4 A;  1N5P A;  4RZM A;  4HM4 B;  3CC7 3;  4N6O B;  3MHE A;  2HMN B;  3MKI A;  4IT7 A;  3O8Y A;  1ASK A;  5BXQ A;  3KN4 A;  1VZZ A;  5LC7 A;  1TUH A;  2CWV A;  2RSX A;  4K90 B;  2GU1 A;  3CCV 3;  3DMC A;  3ER7 A;  1K8A 4;  1CYU A;  1W01 A;  2YFJ B;  2CFL A;  2QGU A;  4O2H A;  1A2V A;  1MOL A;  2A15 A;  2FGT A;  3EQQ B;  3FG4 A;  2HMK B;  3G0K A;  5AI1 A;  3WA3 A;  3OWU A;  3SLU A;  4FCJ A;  5AYS C;  4RNZ A;  2CW9 A;  5ELU A;  1KQS 2;  3WMD A;  1NB5 I;  4KFF A;  2XH9 A;  5IEO A;  4MMX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...