2P38A

Crystal structure of pyrococcus abyssi protein homologue of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
155
structure length
155
Chain Sequence
LRVRRASSWELDLILKEAEKYGELLHEFFCVVEGKYRDVYAVNEEVWKIIEDINMRPYSLGTFVGTIRVDENLVEKFYPNLEFFSLIKLEKNYVILGPKASFLFTTGKDAPKEAVREIKWQGSKRVVVLNDLGDIIGIGLINPKSDRRFIKNLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein involved in ribosomal biogenesis
publication title Structural Insights into the Interaction of the Nip7 PUA Domain with Polyuridine RNA
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Biosynthetic protein
total genus 43
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2p38A02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p38A01
1ZE1A 1WXWA 1Q7HA 2CWWA 1ZL3A 1IT8A 2AB4A 2J5TA 1IT7A 1ZS7A 1R3EA 1SGVA 2CX1A 3UAIA 1IQ8A 4Q1TA 2P38A 1ZE2A 2AS0A 2Q07A 1SQWA 2CX0A 3VSEA 3C0KA 1WXXA 1J2BA 4DMGA 1T5YA 3D79A 1K8WA 3LDFA 2J5VA 2B78A 1R3FA
chains in the Genus database with same CATH superfamily
3WA2X 3AMOB 4L8PA 5IEPA 5M19A 3JVCA 3EE1A 4OK0A 1CH0A 1KC84 4J5GA 1UCKA 4TZ4C 1RGAA 1W6GA 2R4IA 3FZWA 3WOFB 4HKVB 2KF4A 3CCJ3 1D6ZA 1ULIB 2IY2A 3FSDA 1ROAA 1BNJA 2GBWB 3S28A 4HAAA 2F4YA 1ZO2A 3LXUX 1GOYA 3BNBA 2CW9A 2ZDJA 2ML6A 3IJEB 4HM6B 3J7Yd 3KSPA 2E2TA 3UNLA 1DVCA 1KD14 1KWIA 1LRAA 3CC43 2KKUA 1FUTA 4XDVA 1W4NA 5BXQA 4DMGA 4J9AA 3BNDA 3X41A 3FF0A 1IU7A 1N9EA 2W9QA 2KAAA 4GHOA 4ILFA 3JUNA 2IYJA 3M4XA 1OF5B 1YJ93 1B27A 2XFSA 5FGOA 3WMDA 1BNSA 4WFOA 3PCSA 5G2GA 4EC6A 1B2XA 2GSPA 4NREA 4AEQA 1Z1SA 1VQQA 3O8YA 2CIUA 1UGHI 3B8LA 3BB9A 2HMJB 1TFKA 3VSYA 3N54B 3OW22 2IA7A 1UOYA 2ZL8A 5LC6A 1OACA 4Q1TA 3CXC2 1S04A 2BMQB 3BNCA 4QWTA 1CEWI 3G0KA 1BSDA 1MGRA 4WP5A 1IYYA 4LMIA 3LWOA 4HM4B 1FA3A 1O7PB 4KT3B 3GSPA 2CC3A 1Q40A 2W03A 5IERA 1KSIA 1RGKA 4WYKA 3G8ZA 2P05A 2CH9A 3LWPA 3MHEA 5DREA 1B21A 3L0RA 2J8XB 1RN1A 4GSPA 2ANEA 4LEHA 7GSPA 1OHSA 4I4KA 3V92A 3X3ZA 4BTXA 1JRQA 3M6UA 2IMJA 3K5TA 2Z7AA 3LYGA 4N6UA 2J5TA 1IDPA 1ZX2A 5AIIA 3U1WA 3Q2PA 1EKMA 1W6CA 1AVLA 4H61A 3MWZA 2H0GA 4L8OA 1PU4A 1O7GB 3EX9A 1JB4A 3UL6A 4DKIA 3ZFZA 1RCKA 5HGRA 2K3DA 2XF3A 3DGLA 3LTAA 5AEUB 3A5EA 2AADA 4STDA 3EB8A 2Q07A 2XH9A 4KZ1A 3CPOA 3CPW2 1RGCA 4U13A 1OGXA 4R9LA 2CWVA 1B2UA 4KFDA 3WODG 2GEXA 2CFKA 4K1UA 4ORLA 4HZBB 3HIGA 1X1WA 1JBTA 2B78A 1T3BA 3GZBA 1BNEA 4HM0B 3Q90A 4GB5A 1ZE1A 4HM1B 3NV0A 3NBBA 2W04A 2APOA 3B4OA 1HKXA 3FLJA 4R1KA 1RKYA 3GZXB 3AHSA 1SIIA 1LVNA 5KP3A 4N6NB 4XB5A 1DYUA 2K54A 3EF8A 4LYLB 2WOHA 1V58A 3WA3A 1LOXA 2F56A 2LQVA 3PZWA 2EY4A 1OCVA 6STDA 2KCDA 5CLKA 3HAXA 5G1KA 1QAKA 1DETA 2GXFA 2ML5A 1SQWA 3ZV0C 2CG0A 3D5GA 3NQZA 3SYUA 5IW9A 2F86B 1GOUA 1UUWB 2UX0A 3SLUA 1BU4A 3C0KA 1BAOA 2XSHB 2YX9A 3DGNA 4O2HA 5KP1A 2HOHA 5STDA 2L1SA 3DGMA 1I8VA 1GD3A 2C4BA 1BOXA 3EN1B 1NB3I 1YGWA 2C10A 3CNXA 3NXJA 2HMKB 2JDIH 5G1LA 1CQSA 8CHOA 3OV4A 1ZBOA 2BMRB 4EYCA 2A15A 2RCDA 4I5QA 5IG0A 3CMA3 1IT8A 1FZUA 4BU4A 3I563 3CCS3 2CHCA 1QMAA 3WHOA 4H3UA 1E3RA 3A76A 3LTBA 3SEDA 3FG3A 3M65A 5FW5A 2BIRA 1N5HA 1QAFA 1UCJA 1W00A 3G16A 2XFTA 1NO3A 1RTUA 3BNEA 1ULJB 2AS0A 1TUHA 3OWSA 4MMYB 4RBNA 5D83A 2RNTA 1IV9A 3CC73 4KFFA 3NX0A 2OQEA 2D42A 3BLZA 4N6MA 2F5WA 8RNTA 2CWUA 1VQ73 3X40A 3B4PA 4IIAA 1IK3A 1UGIA 1C7HA 2QGUA 1DE3A 4HM7B 3UJMA 4ZM8A 4HM3B 1Q7HA 5DRVA 1DVDA 4N6TA 2Y74A 2WO0A 1IVXA 2PZVA 4K61A 1W7CA 5KP4A 3HI7A 1WMNA 2L4VA 1N8R4 4MMZB 2JQ5A 3ALAA 1FGQA 3MKIA 2AUSA 1JB2A 1RGEA 2WGQA 2OQEC 2BU4A 5AIGA 1IV7A 3CCQ3 3K0ZA 3LWQA 2UGIA 2I9WA 1JZDA 3CCE3 1RJOA 1TFOA 3VGNA 1US1A 1OGZA 5CF2A 2KF6A 7STDA 3NBJA 5EEOA 3LDFA 2J5VA 5AI1A 2Y73A 2CFGA 2OCTA 1M9GA 4XDWA 1G02A 3CC23 2BHMA 1V57A 2W56A 1YNVX 4JF8A 1NJI4 3HZPA 1STDA 1UCIA 3X3XA 3EN8A 5EVHA 1YGEA 2M7OA 2OWPA 3LMLA 4PEJA 3UL5A 4AKZA 1KQS2 4HJLB 5IEOA 5LC7A 1JKGA 1BSCA 7RNTA 2BNGA 1OUNA 1Q42A 1ZE2A 3DZLA 1L5GB 2KF3A 4FMBA 1QALA 2AAEA 1BNGA 2OTL3 2MF7A 1WXXA 2F99A 1UUGB 2P0XA 2Z77A 1YIJ3 3NUVA 3Q1CA 6GSPA 1UI7A 4KFEA 1G0TA 5M1AA 2E2UA 1RMSA 3D4AA 1Q814 1GS3A 3ZG0A 3IPTA 3LT8A 3OWYA 4EW5A 1LOYA 1RCLA 3KSED 4MEIA 4N6LA 5AIHA 2CG1A 1RLSA 1BSAA 1Q9EA 3LOYA 1UCLA 5HOHA 2R41A 2YFIB 1E97A 1TRQA 2D1WA 3KZTA 5TGNA 3SOYA 3CCV3 1QVG2 2XEPA 1I2EA 2XRXB 2FRXA 1NNVA 4LGQA 3KN4A 3S67A 2B1XB 1WMOA 1TU5A 3LWVA 1HYFA 4RZMA 3X42A 3H51A 1MNLA 2W2CA 4XBTA 1BNIA 4N6V0 3M8CA 2UUGC 2Z6BA 3K9MC 3DY5A 3T8NA 1UUVB 3LJCA 1OH0A 1TP6A 5AIFA 3M6XA 3JUMA 1TE7A 1PYLA 4HOHA 1OHPA 3V99A 4CI1B 1AVKA 4LZIA 2GEYA 1ZGXA 1BIRA 3MG3A 1XNEA 1ISKA 4HVNA 3ZG5A 1YIT3 1BRKA 2YFLB 3HK4A 4XBXA 3F8HA 3K7CA 3S5CA 3V98A 1D6YA 1GY5A 3H3HA 3LZAA 4KVHA 4CI3B 1RRHA 1VZZA 1Q40B 1EEJA 1TRPA 3T8UA 2KRTA 1IVVA 1AY7A 1JZOA 1RGFA 2SBLA 1W01A 3GAXA 1FUSA 4RNZA 1TJDA 2WOFA 3FH1A 2GU3A 3F40A 1IVUA 3I0YA 3VSEA 3EBYA 3OXAA 2CFDA 4X2OA 3FCSB 5D81A 1BRNL 1T5YA 3WOEB 1RRLA 3D79A 1PY3A 1K8WA 3LH4A 3HIIA 3M6WA 4N6OB 5BU4A 1TIJA 1YJN3 1ASKA 1WQLB 5ELUA 1VQ53 3OX9A 4N3VA 5RNTA 1SPUA 2FNQA 3CU3A 3EBTA 2Z0TA 4FMDA 3U28A 1I3FA 2XR8B 4FR9A 2BO9B 1R3EA 3E99A 1SGVA 3AMOA 3B7CA 2P09A 4FMAA 1IQ8A 2QEX3 3EHCA 1GMQA 1YVBI 3PGBA 1VQ83 3CD63 3F7SA 5BVBA 1TTOA 4WWUC 1K734 4FCJA 2QIYA 5D82A 1UI8A 2HMLB 3TDGA 1CYUA 3LTDA 1AQZA 1FGOA 3NV0B 3HJYA 3G713 3F9SA 1LQMB 3DGYA 6RNTA 3HJWA 3I553 1O7MB 3JUPA 5JBSA 1AR0A 4HYZA 1B2ZA 1EUIC 4L7KA 1R4CA 2BT3A 1U5OA 1MWRA 1RNBA 1A90A 1S723 3KKGA 3NQYA 5AYRB 1IQYA 3FG1A 1EG9B 2OTJ3 3MYTA 1IT7A 4O8SA 1B3SA 2E2VA 4HM8B 4MJDA 3CCR3 1YI23 1YHQ3 2WGOA 5IG4A 4BTYA 3DMCA 4WYKB 5JPPA 2OOVA 1Y4KA 1BNRA 1K41A 4K90B 1Q864 4WHAA 1I70A 4RNTA 1BNFA 2RSXA 3WDGB 1ROVA 3LWRA 1V74A 1HZ1A 2O3OA 3PCRA 2CK3H 3D3LA 4BIRA 1I2FA 4J5KA 5IG3A 1J2BA 3MPHA 1W2ZA 3FG4A 9RNTA 2ZA4A 3SX1A 4EBGA 3CCL3 3NBRA 1R3FA 4CPKA 2HMOB 5IENA 3MSOA 3FF2A 2K0MA 4CCVA 2CWWA 3ROBA 2OOVC 4O3VA 3DGOA 4CDLA 4G1MB 3CNMA 3K63A 3AGOA 4R80A 3G6E3 2XSOB 1ZS7A 1BANA 1GD4A 3BU4A 3S29A 3S27A 1RGGA 1M904 2HMNB 1B2MA 3GWRA 5M18A 1IVWA 1I2GA 1G96A 4HM5B 2O9UX 3GZRA 4OVMA 1BUJA 3Q3FA 4HM2B 1NDOB 3PXMA 3RGRA 5CK6A 2RFKA 5EQLA 3PS8A 1M1XB 3CME3 1VQN3 3MQKA 2IUJA 1S5AA 3KCHA 5CXOA 1FGRA 1X1YA 2DP9A 1GYBA 1LNIA 1OPYA 3NM2A 1DMNA 4XBYA 3UB1A 1FGMA 3F14A 2V1LA 1I0VA 1BRSA 4CI2B 2H0IA 3N9HA 1BRJA 4HZ9B 3STDA 3DUKA 1MOLA 3AGNA 1DMQA 1QJGA 4FCMA 3N8BA 4NPBA 1ZL3A 1U8CB 1T2IA 5AEWB 2W6JH 2W9PA 1T2HA 3URPA 5BIRA 1VQK3 4GL6A 2Z76A 2RGQA 5CF1A 5IF6A 1D6UA 1YVSA 2YFJB 1QVF2 1GOVA 5A0OB 1VQL3 1GY6A 2P0MA 1VQO3 1JNQA 2GBXB 2C11A 4RNYA 4CJNA 1LOWA 1MGWA 1BGSA 3M6VA 3ER7A 2P38A 1FYSA 1X1XA 3DH2A 3JUOA 3DXOA 1N5PA 3SXXA 1BVIA 1W6YA 5AYSC 1BUQA 3CCM3 2F5MA 1W2B2 3IUWA 3PYJA 2CKFB 1MWTA 1B20A 1W5ZA 1O7NB 1I3IA 2INXA 2GU1A 2W56B 2RBIA 1OHOA 2PNCA 3U97A 1F8NA 3EQQB 4JRFA 4BTWA 3AHWA 1JV2B 1N9JA 1VQ93 3QK9A 1EQKA 3MG1A 1AV4A 1JJ22 1JN5A 4FCZA 4XM4A 1Q7Y4 1JKGB 3LTCA 1LOVA 3QRDA 3X3YA 1W02A 3BIRA 3FGYA 2MC8A 4BL3A 1NU3A 1RHLA 4NHFA 2KF5A 1VQ43 5IG5A 3RNTA 1O7HB 2W0QA 2CWTA 2ZHXB 4EV2A 1WMPA 1Q824 2FGTA 2IUKA 3JUQA 1IQXA 4K1VA 2XGNA 3NHXA 1RN7A 2RFRA 1RGHA 1RSNA 1RN4A 1UW1A 5I97A 1K9M4 2E5OA 1WTHA 5JPUA 2XGLA 4LSOA 3VF1A 1I0XA 1UDII 2HMMB 3F7XA 1FW7A 1SIHA 3G4S3 4IT7A 1GMRA 2STDA 2CFLA 3NM7A 1STFI 3KFQC 2CX1A 3DM8A 3RDEA 1M1K4 1NWWA 2FXTA 3F8XA 3CCU3 1VQP3 2HVYA 1O7WB 1JB5A 2QA43 1A67A 1A2PA 3GRDA 1FGTA 1YJW3 4MMXB 1GSPA 3IMAB 1GY7A 3HOHA 4O02B 3T0UA 1FUWA 3SOAA 1RGLA 4BL2A 1JBSA 1K8A4 4IPBA 2CX0A 3MG2A 1K28A 4Q53A 1JN5B 1E3VA 1LQGC 1BRIA 1SARA 4OUQA 4EV5A 2CFWA 4EXRA 1VQM3 4FMCA 3OWUA 5ELJA 4AKYA 1BRHA 3EC9A 3RGAA 1WXWA 5GSPA 1N8QA 1MWSA 2BMOB 4R9KA 2H0HA 4HBRA 2AB4A 1SJWA 3D9RA 4X2HA 3WR2A 2F98A 3D5IA 2B24B 1OF5A 1CYVA 3UAIA 1B2SA 2KXGA 1WNHA 3FKAA 3EJVA 3HX8A 1X1UA 1A2KA 4TX4A 3LT9A 4J8TA 1DMMA 3KIIA 1R4YA 1RDSA 1VQ63 1JBRA 1HU9A 1WK2A 1LNHA 1PFPA 3SVAA 3GZYB 1EA2A 3KE7A 1BRGA 1NB5I 1RNTA 1BSBA 2LYXA 4R4KA 2SARA 1A2VA 1MWUA 1BSEA 3ECFA 1LXEA 1GMPA 1C54A
chains in the Genus database with same CATH topology
3WA2X 3AMOB 4L8PA 5IEPA 3JVCA 3EE1A 4OK0A 1KC84 3WOFB 1W6GA 3CCJ3 3FZWA 2R4IA 4HKVB 1D6ZA 1ULIB 3FSDA 1ROAA 2GBWB 3S28A 1ZO2A 3LXUX 3BNBA 2CW9A 2ZDJA 2ML6A 3IJEB 4HM6B 3J7Yd 3KSPA 2E2TA 3UNLA 1DVCA 1KD14 1KWIA 3CC43 5BXQA 4XDVA 1W4NA 4DMGA 4J9AA 3BNDA 3X41A 3FF0A 1IU7A 1N9EA 2W9QA 3JUNA 1OF5B 1YJ93 2XFSA 5FGOA 3WMDA 4WFOA 3PCSA 5G2GA 4EC6A 4NREA 4AEQA 1Z1SA 3O8YA 2CIUA 3B8LA 3BB9A 2HMJB 1TFKA 3VSYA 3N54B 3OW22 2IA7A 2ZL8A 5LC6A 1OACA 4Q1TA 3CXC2 3BNCA 2BMQB 4QWTA 1CEWI 3G0KA 4WP5A 4LMIA 4HM4B 1FA3A 1O7PB 2CC3A 1Q40A 2W03A 5IERA 1KSIA 4WYKA 3G8ZA 2P05A 2CH9A 3MHEA 5DREA 3L0RA 4LEHA 1OHSA 4I4KA 3V92A 3X3ZA 4BTXA 1JRQA 2IMJA 3K5TA 2Z7AA 3LYGA 4N6UA 2J5TA 1IDPA 1ZX2A 5AIIA 3U1WA 3Q2PA 1EKMA 1W6CA 1AVLA 4H61A 3MWZA 4L8OA 1PU4A 1O7GB 3EX9A 1JB4A 3UL6A 5HGRA 2XF3A 3DGLA 3LTAA 5AEUB 4STDA 3EB8A 2Q07A 2XH9A 4KZ1A 3CPOA 3CPW2 4U13A 1OGXA 4R9LA 2CWVA 4KFDA 3WODG 2GEXA 2CFKA 4K1UA 4ORLA 4HZBB 3HIGA 2B78A 3GZBA 4HM0B 3Q90A 4GB5A 1ZE1A 4HM1B 3NV0A 3NBBA 2W04A 3B4OA 3FLJA 1HKXA 4R1KA 1RKYA 3GZXB 1SIIA 1LVNA 5KP3A 4N6NB 4XB5A 1DYUA 2K54A 3EF8A 2WOHA 3WA3A 1LOXA 2LQVA 6STDA 3PZWA 1OCVA 2KCDA 5CLKA 1QAKA 2GXFA 2ML5A 1SQWA 2CG0A 5IW9A 3NQZA 2F86B 1UUWB 2UX0A 3C0KA 4O2HA 2XSHB 2YX9A 3DGNA 5STDA 3DGMA 3OX9A 1GD3A 4RZMA 3EN1B 3SLUA 1NB3I 2C10A 3CNXA 3NXJA 2HMKB 2JDIH 8CHOA 1CQSA 3OV4A 2BMRB 4EYCA 2A15A 2RCDA 5IG0A 3CMA3 1IT8A 3I563 3CCS3 2CHCA 1QMAA 4H3UA 1E3RA 3A76A 3LTBA 3SEDA 3FG3A 5FW5A 1N5HA 1QAFA 1W00A 3G16A 2XFTA 1NO3A 3BNEA 1ULJB 2AS0A 1TUHA 3OWSA 4MMYB 4RBNA 5D83A 1IV9A 3CC73 4KFFA 3NX0A 2OQEA 2D42A 3BLZA 4N6MA 2CWUA 1VQ73 3X40A 3B4PA 4IIAA 1IK3A 2QGUA 1C7HA 4HM7B 3UJMA 4ZM8A 4HM3B 1Q7HA 5DRVA 1DVDA 4N6TA 2Y74A 2WO0A 1IVXA 2PZVA 4K61A 1W7CA 5KP4A 3HI7A 1WMNA 2L4VA 1N8R4 4MMZB 2JQ5A 3ALAA 1FGQA 3MKIA 1JB2A 2WGQA 2OQEC 5AIGA 1IV7A 3CCQ3 3K0ZA 2I9WA 3CCE3 1RJOA 1TFOA 3VGNA 1US1A 1OGZA 5CF2A 7STDA 3NBJA 5EEOA 3LDFA 2J5VA 5AI1A 2Y73A 2CFGA 2OCTA 1M9GA 4XDWA 3CC23 2BHMA 2W56A 4JF8A 1NJI4 3HZPA 1STDA 3X3XA 3EN8A 5EVHA 1YGEA 2M7OA 2OWPA 3LMLA 4PEJA 3UL5A 4AKZA 1KQS2 4HJLB 5IEOA 5LC7A 1JKGA 2BNGA 1OUNA 1Q42A 1ZE2A 3DZLA 1L5GB 4FMBA 1QALA 2OTL3 2MF7A 1WXXA 2F99A 2Z77A 2P0XA 1YIJ3 3NUVA 3Q1CA 1UI7A 4KFEA 2E2UA 1Q814 1GS3A 3IPTA 3LT8A 3OWYA 4MEIA 3KSED 5AIHA 4N6LA 2CG1A 3LOYA 2YFIB 1E97A 2D1WA 5TGNA 3KZTA 3SOYA 3CCV3 1QVG2 2XEPA 2XRXB 3S67A 4LGQA 3KN4A 2B1XB 1WMOA 1TU5A 3X42A 3H51A 1MNLA 2W2CA 4XBTA 4N6V0 3M8CA 2Z6BA 3K9MC 3DY5A 3T8NA 1UUVB 1OH0A 1TP6A 5AIFA 3JUMA 1OHPA 3V99A 1AVKA 4LZIA 2GEYA 3MG3A 1ISKA 4HVNA 1YIT3 4XBXA 2YFLB 3HK4A 3F8HA 3K7CA 3S5CA 3V98A 1D6YA 1GY5A 3H3HA 3LZAA 4KVHA 1RRHA 1VZZA 1Q40B 3T8UA 2KRTA 1IVVA 2SBLA 3GAXA 1W01A 4RNZA 2WOFA 3FH1A 2GU3A 3F40A 1IVUA 3I0YA 3VSEA 3EBYA 3OXAA 2CFDA 4X2OA 3FCSB 5D81A 1T5YA 3WOEB 1RRLA 3D79A 3LH4A 1K8WA 3HIIA 4N6OB 1TIJA 1YJN3 1ASKA 1WQLB 5ELUA 1VQ53 4N3VA 1SPUA 2FNQA 3CU3A 3EBTA 4FMDA 2XR8B 4FR9A 2BO9B 1R3EA 3E99A 1SGVA 3AMOA 3B7CA 2P09A 4FMAA 1IQ8A 2QEX3 3EHCA 1YVBI 3PGBA 1VQ83 3CD63 3F7SA 5BVBA 4WWUC 1K734 4FCJA 2QIYA 5D82A 1UI8A 2HMLB 3TDGA 1CYUA 3LTDA 1FGOA 3NV0B 3G713 3F9SA 3I553 1O7MB 3JUPA 5JBSA 1AR0A 4HYZA 4L7KA 1A90A 1R4CA 2BT3A 1U5OA 1S723 3KKGA 3NQYA 5AYRB 1IQYA 3FG1A 1EG9B 2OTJ3 3MYTA 1IT7A 4O8SA 2E2VA 4MJDA 4HM8B 3CCR3 1YI23 1YHQ3 2WGOA 5IG4A 4BTYA 3DMCA 4WYKB 5JPPA 2OOVA 1Y4KA 1K41A 4K90B 1Q864 4WHAA 2RSXA 3WDGB 1ROVA 1V74A 2O3OA 3PCRA 2CK3H 3D3LA 5IG3A 1J2BA 3MPHA 1W2ZA 3FG4A 3SX1A 4EBGA 3CCL3 3NBRA 1R3FA 2HMOB 5IENA 3MSOA 3FF2A 2K0MA 4CCVA 2CWWA 3ROBA 2OOVC 4O3VA 3DGOA 4CDLA 4G1MB 3CNMA 3K63A 4R80A 3G6E3 2XSOB 1ZS7A 1GD4A 3S29A 3S27A 1M904 2HMNB 3GWRA 1IVWA 4HM5B 1G96A 2O9UX 3GZRA 4OVMA 4HM2B 1NDOB 3PXMA 3RGRA 5CK6A 5EQLA 3PS8A 1M1XB 3CME3 1VQN3 2IUJA 1S5AA 5CXOA 1FGRA 3NM2A 1GYBA 1OPYA 4XBYA 1DMNA 3UB1A 1FGMA 3F14A 2V1LA 3N9HA 3STDA 4HZ9B 3DUKA 1MOLA 1DMQA 1QJGA 4FCMA 3N8BA 1ZL3A 1U8CB 5AEWB 2W6JH 2W9PA 1VQK3 4GL6A 2Z76A 2RGQA 5CF1A 5IF6A 1D6UA 2YFJB 1QVF2 5A0OB 1VQL3 1GY6A 2P0MA 1VQO3 1JNQA 2GBXB 2C11A 4RNYA 3ER7A 2P38A 3SXXA 3JUOA 3DXOA 1N5PA 1W6YA 5AYSC 1BUQA 3CCM3 1W2B2 3PYJA 2CKFB 1W5ZA 1O7NB 2INXA 2GU1A 2W56B 1OHOA 2PNCA 3U97A 1F8NA 3EQQB 4JRFA 4BTWA 1JV2B 1N9JA 1VQ93 3QK9A 1EQKA 3MG1A 1AV4A 1JJ22 1JN5A 4FCZA 4XM4A 1Q7Y4 1JKGB 3LTCA 3X3YA 3QRDA 1W02A 2MC8A 3FGYA 1NU3A 4NHFA 1VQ43 5IG5A 1O7HB 2W0QA 2CWTA 4EV2A 1WMPA 1Q824 2FGTA 2IUKA 3JUQA 1IQXA 4K1VA 2XGNA 3NHXA 1RN7A 2RFRA 1UW1A 5I97A 1K9M4 1WTHA 5JPUA 2XGLA 4LSOA 3VF1A 2HMMB 3F7XA 1SIHA 3G4S3 4IT7A 2STDA 2CFLA 3NM7A 1STFI 3KFQC 2CX1A 3DM8A 3RDEA 1M1K4 1NWWA 2FXTA 3F8XA 3CCU3 1VQP3 1O7WB 1JB5A 2QA43 1A67A 3GRDA 1FGTA 1YJW3 4MMXB 3IMAB 1GY7A 4O02B 3T0UA 1FUWA 3SOAA 1K8A4 4IPBA 2CX0A 3MG2A 1K28A 4Q53A 1JN5B 1E3VA 4OUQA 4EV5A 2CFWA 4EXRA 1VQM3 4FMCA 3OWUA 5ELJA 4AKYA 3EC9A 3RGAA 1WXWA 1N8QA 4R9KA 2BMOB 4HBRA 2AB4A 1SJWA 3D9RA 4X2HA 2F98A 2B24B 1OF5A 1CYVA 3UAIA 2KXGA 1WNHA 3FKAA 3EJVA 3HX8A 1A2KA 4TX4A 3LT9A 4J8TA 1DMMA 3KIIA 1VQ63 1HU9A 1LNHA 1PFPA 3SVAA 3GZYB 1EA2A 3KE7A 1NB5I 2LYXA 4R4KA 1A2VA 3ECFA 1LXEA 5KP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZE1 A;  1WXW A;  1Q7H A;  2CWW A;  1ZL3 A;  1IT8 A;  2AB4 A;  2J5T A;  1IT7 A;  1ZS7 A;  1R3E A;  1SGV A;  2CX1 A;  3UAI A;  1IQ8 A;  4Q1T A;  2P38 A;  1ZE2 A;  2AS0 A;  2Q07 A;  1SQW A;  2CX0 A;  3VSE A;  3C0K A;  1WXX A;  1J2B A;  4DMG A;  1T5Y A;  3D79 A;  1K8W A;  3LDF A;  2J5V A;  2B78 A;  1R3F A; 
#chains in the Genus database with same CATH topology
 3WA2 X;  3AMO B;  4L8P A;  5IEP A;  5M19 A;  3JVC A;  3EE1 A;  4OK0 A;  1CH0 A;  1KC8 4;  4J5G A;  1UCK A;  4TZ4 C;  1RGA A;  1W6G A;  2R4I A;  3FZW A;  3WOF B;  4HKV B;  2KF4 A;  3CCJ 3;  1D6Z A;  1ULI B;  2IY2 A;  3FSD A;  1ROA A;  1BNJ A;  2GBW B;  3S28 A;  4HAA A;  2F4Y A;  1ZO2 A;  3LXU X;  1GOY A;  3BNB A;  2CW9 A;  2ZDJ A;  2ML6 A;  3IJE B;  4HM6 B;  3J7Y d;  3KSP A;  2E2T A;  3UNL A;  1DVC A;  1KD1 4;  1KWI A;  1LRA A;  3CC4 3;  2KKU A;  1FUT A;  4XDV A;  1W4N A;  5BXQ A;  4DMG A;  4J9A A;  3BND A;  3X41 A;  3FF0 A;  1IU7 A;  1N9E A;  2W9Q A;  2KAA A;  4GHO A;  4ILF A;  3JUN A;  2IYJ A;  3M4X A;  1OF5 B;  1YJ9 3;  1B27 A;  2XFS A;  5FGO A;  3WMD A;  1BNS A;  4WFO A;  3PCS A;  5G2G A;  4EC6 A;  1B2X A;  2GSP A;  4NRE A;  4AEQ A;  1Z1S A;  1VQQ A;  3O8Y A;  2CIU A;  1UGH I;  3B8L A;  3BB9 A;  2HMJ B;  1TFK A;  3VSY A;  3N54 B;  3OW2 2;  2IA7 A;  1UOY A;  2ZL8 A;  5LC6 A;  1OAC A;  4Q1T A;  3CXC 2;  1S04 A;  2BMQ B;  3BNC A;  4QWT A;  1CEW I;  3G0K A;  1BSD A;  1MGR A;  4WP5 A;  1IYY A;  4LMI A;  3LWO A;  4HM4 B;  1FA3 A;  1O7P B;  4KT3 B;  3GSP A;  2CC3 A;  1Q40 A;  2W03 A;  5IER A;  1KSI A;  1RGK A;  4WYK A;  3G8Z A;  2P05 A;  2CH9 A;  3LWP A;  3MHE A;  5DRE A;  1B21 A;  3L0R A;  2J8X B;  1RN1 A;  4GSP A;  2ANE A;  4LEH A;  7GSP A;  1OHS A;  4I4K A;  3V92 A;  3X3Z A;  4BTX A;  1JRQ A;  3M6U A;  2IMJ A;  3K5T A;  2Z7A A;  3LYG A;  4N6U A;  2J5T A;  1IDP A;  1ZX2 A;  5AII A;  3U1W A;  3Q2P A;  1EKM A;  1W6C A;  1AVL A;  4H61 A;  3MWZ A;  2H0G A;  4L8O A;  1PU4 A;  1O7G B;  3EX9 A;  1JB4 A;  3UL6 A;  4DKI A;  3ZFZ A;  1RCK A;  5HGR A;  2K3D A;  2XF3 A;  3DGL A;  3LTA A;  5AEU B;  3A5E A;  2AAD A;  4STD A;  3EB8 A;  2Q07 A;  2XH9 A;  4KZ1 A;  3CPO A;  3CPW 2;  1RGC A;  4U13 A;  1OGX A;  4R9L A;  2CWV A;  1B2U A;  4KFD A;  3WOD G;  2GEX A;  2CFK A;  4K1U A;  4ORL A;  4HZB B;  3HIG A;  1X1W A;  1JBT A;  2B78 A;  1T3B A;  3GZB A;  1BNE A;  4HM0 B;  3Q90 A;  4GB5 A;  1ZE1 A;  4HM1 B;  3NV0 A;  3NBB A;  2W04 A;  2APO A;  3B4O A;  1HKX A;  3FLJ A;  4R1K A;  1RKY A;  3GZX B;  3AHS A;  1SII A;  1LVN A;  5KP3 A;  4N6N B;  4XB5 A;  1DYU A;  2K54 A;  3EF8 A;  4LYL B;  2WOH A;  1V58 A;  3WA3 A;  1LOX A;  2F56 A;  2LQV A;  3PZW A;  2EY4 A;  1OCV A;  6STD A;  2KCD A;  5CLK A;  3HAX A;  5G1K A;  1QAK A;  1DET A;  2GXF A;  2ML5 A;  1SQW A;  3ZV0 C;  2CG0 A;  3D5G A;  3NQZ A;  3SYU A;  5IW9 A;  2F86 B;  1GOU A;  1UUW B;  2UX0 A;  3SLU A;  1BU4 A;  3C0K A;  1BAO A;  2XSH B;  2YX9 A;  3DGN A;  4O2H A;  5KP1 A;  2HOH A;  5STD A;  2L1S A;  3DGM A;  1I8V A;  1GD3 A;  2C4B A;  1BOX A;  3EN1 B;  1NB3 I;  1YGW A;  2C10 A;  3CNX A;  3NXJ A;  2HMK B;  2JDI H;  5G1L A;  1CQS A;  8CHO A;  3OV4 A;  1ZBO A;  2BMR B;  4EYC A;  2A15 A;  2RCD A;  4I5Q A;  5IG0 A;  3CMA 3;  1IT8 A;  1FZU A;  4BU4 A;  3I56 3;  3CCS 3;  2CHC A;  1QMA A;  3WHO A;  4H3U A;  1E3R A;  3A76 A;  3LTB A;  3SED A;  3FG3 A;  3M65 A;  5FW5 A;  2BIR A;  1N5H A;  1QAF A;  1UCJ A;  1W00 A;  3G16 A;  2XFT A;  1NO3 A;  1RTU A;  3BNE A;  1ULJ B;  2AS0 A;  1TUH A;  3OWS A;  4MMY B;  4RBN A;  5D83 A;  2RNT A;  1IV9 A;  3CC7 3;  4KFF A;  3NX0 A;  2OQE A;  2D42 A;  3BLZ A;  4N6M A;  2F5W A;  8RNT A;  2CWU A;  1VQ7 3;  3X40 A;  3B4P A;  4IIA A;  1IK3 A;  1UGI A;  1C7H A;  2QGU A;  1DE3 A;  4HM7 B;  3UJM A;  4ZM8 A;  4HM3 B;  1Q7H A;  5DRV A;  1DVD A;  4N6T A;  2Y74 A;  2WO0 A;  1IVX A;  2PZV A;  4K61 A;  1W7C A;  5KP4 A;  3HI7 A;  1WMN A;  2L4V A;  1N8R 4;  4MMZ B;  2JQ5 A;  3ALA A;  1FGQ A;  3MKI A;  2AUS A;  1JB2 A;  1RGE A;  2WGQ A;  2OQE C;  2BU4 A;  5AIG A;  1IV7 A;  3CCQ 3;  3K0Z A;  3LWQ A;  2UGI A;  2I9W A;  1JZD A;  3CCE 3;  1RJO A;  1TFO A;  3VGN A;  1US1 A;  1OGZ A;  5CF2 A;  2KF6 A;  7STD A;  3NBJ A;  5EEO A;  3LDF A;  2J5V A;  5AI1 A;  2Y73 A;  2CFG A;  2OCT A;  1M9G A;  4XDW A;  1G02 A;  3CC2 3;  2BHM A;  1V57 A;  2W56 A;  1YNV X;  4JF8 A;  1NJI 4;  3HZP A;  1STD A;  1UCI A;  3X3X A;  3EN8 A;  5EVH A;  1YGE A;  2M7O A;  2OWP A;  3LML A;  4PEJ A;  3UL5 A;  4AKZ A;  1KQS 2;  4HJL B;  5IEO A;  5LC7 A;  1JKG A;  1BSC A;  7RNT A;  2BNG A;  1OUN A;  1Q42 A;  1ZE2 A;  3DZL A;  1L5G B;  2KF3 A;  4FMB A;  1QAL A;  2AAE A;  1BNG A;  2OTL 3;  2MF7 A;  1WXX A;  2F99 A;  1UUG B;  2P0X A;  2Z77 A;  1YIJ 3;  3NUV A;  3Q1C A;  6GSP A;  1UI7 A;  4KFE A;  1G0T A;  5M1A A;  2E2U A;  1RMS A;  3D4A A;  1Q81 4;  1GS3 A;  3ZG0 A;  3IPT A;  3LT8 A;  3OWY A;  4EW5 A;  1LOY A;  1RCL A;  3KSE D;  4MEI A;  4N6L A;  5AIH A;  2CG1 A;  1RLS A;  1BSA A;  1Q9E A;  3LOY A;  1UCL A;  5HOH A;  2R41 A;  2YFI B;  1E97 A;  1TRQ A;  2D1W A;  3KZT A;  5TGN A;  3SOY A;  3CCV 3;  1QVG 2;  2XEP A;  1I2E A;  2XRX B;  2FRX A;  1NNV A;  4LGQ A;  3KN4 A;  3S67 A;  2B1X B;  1WMO A;  1TU5 A;  3LWV A;  1HYF A;  4RZM A;  3X42 A;  3H51 A;  1MNL A;  2W2C A;  4XBT A;  1BNI A;  4N6V 0;  3M8C A;  2UUG C;  2Z6B A;  3K9M C;  3DY5 A;  3T8N A;  1UUV B;  3LJC A;  1OH0 A;  1TP6 A;  5AIF A;  3M6X A;  3JUM A;  1TE7 A;  1PYL A;  4HOH A;  1OHP A;  3V99 A;  4CI1 B;  1AVK A;  4LZI A;  2GEY A;  1ZGX A;  1BIR A;  3MG3 A;  1XNE A;  1ISK A;  4HVN A;  3ZG5 A;  1YIT 3;  1BRK A;  2YFL B;  3HK4 A;  4XBX A;  3F8H A;  3K7C A;  3S5C A;  3V98 A;  1D6Y A;  1GY5 A;  3H3H A;  3LZA A;  4KVH A;  4CI3 B;  1RRH A;  1VZZ A;  1Q40 B;  1EEJ A;  1TRP A;  3T8U A;  2KRT A;  1IVV A;  1AY7 A;  1JZO A;  1RGF A;  2SBL A;  1W01 A;  3GAX A;  1FUS A;  4RNZ A;  1TJD A;  2WOF A;  3FH1 A;  2GU3 A;  3F40 A;  1IVU A;  3I0Y A;  3VSE A;  3EBY A;  3OXA A;  2CFD A;  4X2O A;  3FCS B;  5D81 A;  1BRN L;  1T5Y A;  3WOE B;  1RRL A;  3D79 A;  1PY3 A;  1K8W A;  3LH4 A;  3HII A;  3M6W A;  4N6O B;  5BU4 A;  1TIJ A;  1YJN 3;  1ASK A;  1WQL B;  5ELU A;  1VQ5 3;  3OX9 A;  4N3V A;  5RNT A;  1SPU A;  2FNQ A;  3CU3 A;  3EBT A;  2Z0T A;  4FMD A;  3U28 A;  1I3F A;  2XR8 B;  4FR9 A;  2BO9 B;  1R3E A;  3E99 A;  1SGV A;  3AMO A;  3B7C A;  2P09 A;  4FMA A;  1IQ8 A;  2QEX 3;  3EHC A;  1GMQ A;  1YVB I;  3PGB A;  1VQ8 3;  3CD6 3;  3F7S A;  5BVB A;  1TTO A;  4WWU C;  1K73 4;  4FCJ A;  2QIY A;  5D82 A;  1UI8 A;  2HML B;  3TDG A;  1CYU A;  3LTD A;  1AQZ A;  1FGO A;  3NV0 B;  3HJY A;  3G71 3;  3F9S A;  1LQM B;  3DGY A;  6RNT A;  3HJW A;  3I55 3;  1O7M B;  3JUP A;  5JBS A;  1AR0 A;  4HYZ A;  1B2Z A;  1EUI C;  4L7K A;  1R4C A;  2BT3 A;  1U5O A;  1MWR A;  1RNB A;  1A90 A;  1S72 3;  3KKG A;  3NQY A;  5AYR B;  1IQY A;  3FG1 A;  1EG9 B;  2OTJ 3;  3MYT A;  1IT7 A;  4O8S A;  1B3S A;  2E2V A;  4HM8 B;  4MJD A;  3CCR 3;  1YI2 3;  1YHQ 3;  2WGO A;  5IG4 A;  4BTY A;  3DMC A;  4WYK B;  5JPP A;  2OOV A;  1Y4K A;  1BNR A;  1K41 A;  4K90 B;  1Q86 4;  4WHA A;  1I70 A;  4RNT A;  1BNF A;  2RSX A;  3WDG B;  1ROV A;  3LWR A;  1V74 A;  1HZ1 A;  2O3O A;  3PCR A;  2CK3 H;  3D3L A;  4BIR A;  1I2F A;  4J5K A;  5IG3 A;  1J2B A;  3MPH A;  1W2Z A;  3FG4 A;  9RNT A;  2ZA4 A;  3SX1 A;  4EBG A;  3CCL 3;  3NBR A;  1R3F A;  4CPK A;  2HMO B;  5IEN A;  3MSO A;  3FF2 A;  2K0M A;  4CCV A;  2CWW A;  3ROB A;  2OOV C;  4O3V A;  3DGO A;  4CDL A;  4G1M B;  3CNM A;  3K63 A;  3AGO A;  4R80 A;  3G6E 3;  2XSO B;  1ZS7 A;  1BAN A;  1GD4 A;  3BU4 A;  3S29 A;  3S27 A;  1RGG A;  1M90 4;  2HMN B;  1B2M A;  3GWR A;  5M18 A;  1IVW A;  1I2G A;  1G96 A;  4HM5 B;  2O9U X;  3GZR A;  4OVM A;  1BUJ A;  3Q3F A;  4HM2 B;  1NDO B;  3PXM A;  3RGR A;  5CK6 A;  2RFK A;  5EQL A;  3PS8 A;  1M1X B;  3CME 3;  1VQN 3;  3MQK A;  2IUJ A;  1S5A A;  3KCH A;  5CXO A;  1FGR A;  1X1Y A;  2DP9 A;  1GYB A;  1LNI A;  1OPY A;  3NM2 A;  1DMN A;  4XBY A;  3UB1 A;  1FGM A;  3F14 A;  2V1L A;  1I0V A;  1BRS A;  4CI2 B;  2H0I A;  3N9H A;  1BRJ A;  4HZ9 B;  3STD A;  3DUK A;  1MOL A;  3AGN A;  1DMQ A;  1QJG A;  4FCM A;  3N8B A;  4NPB A;  1ZL3 A;  1U8C B;  1T2I A;  5AEW B;  2W6J H;  2W9P A;  1T2H A;  3URP A;  5BIR A;  1VQK 3;  4GL6 A;  2Z76 A;  2RGQ A;  5CF1 A;  5IF6 A;  1D6U A;  1YVS A;  2YFJ B;  1QVF 2;  1GOV A;  5A0O B;  1VQL 3;  1GY6 A;  2P0M A;  1VQO 3;  1JNQ A;  2GBX B;  2C11 A;  4RNY A;  4CJN A;  1LOW A;  1MGW A;  1BGS A;  3M6V A;  3ER7 A;  2P38 A;  1FYS A;  1X1X A;  3DH2 A;  3JUO A;  3DXO A;  1N5P A;  3SXX A;  1BVI A;  1W6Y A;  5AYS C;  1BUQ A;  3CCM 3;  2F5M A;  1W2B 2;  3IUW A;  3PYJ A;  2CKF B;  1MWT A;  1B20 A;  1W5Z A;  1O7N B;  1I3I A;  2INX A;  2GU1 A;  2W56 B;  2RBI A;  1OHO A;  2PNC A;  3U97 A;  1F8N A;  3EQQ B;  4JRF A;  4BTW A;  3AHW A;  1JV2 B;  1N9J A;  1VQ9 3;  3QK9 A;  1EQK A;  3MG1 A;  1AV4 A;  1JJ2 2;  1JN5 A;  4FCZ A;  4XM4 A;  1Q7Y 4;  1JKG B;  3LTC A;  1LOV A;  3QRD A;  3X3Y A;  1W02 A;  3BIR A;  3FGY A;  2MC8 A;  4BL3 A;  1NU3 A;  1RHL A;  4NHF A;  2KF5 A;  1VQ4 3;  5IG5 A;  3RNT A;  1O7H B;  2W0Q A;  2CWT A;  2ZHX B;  4EV2 A;  1WMP A;  1Q82 4;  2FGT A;  2IUK A;  3JUQ A;  1IQX A;  4K1V A;  2XGN A;  3NHX A;  1RN7 A;  2RFR A;  1RGH A;  1RSN A;  1RN4 A;  1UW1 A;  5I97 A;  1K9M 4;  2E5O A;  1WTH A;  5JPU A;  2XGL A;  4LSO A;  3VF1 A;  1I0X A;  1UDI I;  2HMM B;  3F7X A;  1FW7 A;  1SIH A;  3G4S 3;  4IT7 A;  1GMR A;  2STD A;  2CFL A;  3NM7 A;  1STF I;  3KFQ C;  2CX1 A;  3DM8 A;  3RDE A;  1M1K 4;  1NWW A;  2FXT A;  3F8X A;  3CCU 3;  1VQP 3;  2HVY A;  1O7W B;  1JB5 A;  2QA4 3;  1A67 A;  1A2P A;  3GRD A;  1FGT A;  1YJW 3;  4MMX B;  1GSP A;  3IMA B;  1GY7 A;  3HOH A;  4O02 B;  3T0U A;  1FUW A;  3SOA A;  1RGL A;  4BL2 A;  1JBS A;  1K8A 4;  4IPB A;  2CX0 A;  3MG2 A;  1K28 A;  4Q53 A;  1JN5 B;  1E3V A;  1LQG C;  1BRI A;  1SAR A;  4OUQ A;  4EV5 A;  2CFW A;  4EXR A;  1VQM 3;  4FMC A;  3OWU A;  5ELJ A;  4AKY A;  1BRH A;  3EC9 A;  3RGA A;  1WXW A;  5GSP A;  1N8Q A;  1MWS A;  2BMO B;  4R9K A;  2H0H A;  4HBR A;  2AB4 A;  1SJW A;  3D9R A;  4X2H A;  3WR2 A;  2F98 A;  3D5I A;  2B24 B;  1OF5 A;  1CYV A;  3UAI A;  1B2S A;  2KXG A;  1WNH A;  3FKA A;  3EJV A;  3HX8 A;  1X1U A;  1A2K A;  4TX4 A;  3LT9 A;  4J8T A;  1DMM A;  3KII A;  1R4Y A;  1RDS A;  1VQ6 3;  1JBR A;  1HU9 A;  1WK2 A;  1LNH A;  1PFP A;  3SVA A;  3GZY B;  1EA2 A;  3KE7 A;  1BRG A;  1NB5 I;  1RNT A;  1BSB A;  2LYX A;  4R4K A;  2SAR A;  1A2V A;  1MWU A;  1BSE A;  3ECF A;  1LXE A;  1GMP A;  1C54 A; 
#chains in the Genus database with same CATH homology
 3WA2 X;  3AMO B;  4L8P A;  5IEP A;  3JVC A;  3EE1 A;  4OK0 A;  1KC8 4;  3WOF B;  1W6G A;  3CCJ 3;  3FZW A;  2R4I A;  4HKV B;  1D6Z A;  1ULI B;  3FSD A;  1ROA A;  2GBW B;  3S28 A;  1ZO2 A;  3LXU X;  3BNB A;  2CW9 A;  2ZDJ A;  2ML6 A;  3IJE B;  4HM6 B;  3J7Y d;  3KSP A;  2E2T A;  3UNL A;  1DVC A;  1KD1 4;  1KWI A;  3CC4 3;  5BXQ A;  4XDV A;  1W4N A;  4DMG A;  4J9A A;  3BND A;  3X41 A;  3FF0 A;  1IU7 A;  1N9E A;  2W9Q A;  3JUN A;  1OF5 B;  1YJ9 3;  2XFS A;  5FGO A;  3WMD A;  4WFO A;  3PCS A;  5G2G A;  4EC6 A;  4NRE A;  4AEQ A;  1Z1S A;  3O8Y A;  2CIU A;  3B8L A;  3BB9 A;  2HMJ B;  1TFK A;  3VSY A;  3N54 B;  3OW2 2;  2IA7 A;  2ZL8 A;  5LC6 A;  1OAC A;  4Q1T A;  3CXC 2;  3BNC A;  2BMQ B;  4QWT A;  1CEW I;  3G0K A;  4WP5 A;  4LMI A;  4HM4 B;  1FA3 A;  1O7P B;  2CC3 A;  1Q40 A;  2W03 A;  5IER A;  1KSI A;  4WYK A;  3G8Z A;  2P05 A;  2CH9 A;  3MHE A;  5DRE A;  3L0R A;  4LEH A;  1OHS A;  4I4K A;  3V92 A;  3X3Z A;  4BTX A;  1JRQ A;  2IMJ A;  3K5T A;  2Z7A A;  3LYG A;  4N6U A;  2J5T A;  1IDP A;  1ZX2 A;  5AII A;  3U1W A;  3Q2P A;  1EKM A;  1W6C A;  1AVL A;  4H61 A;  3MWZ A;  4L8O A;  1PU4 A;  1O7G B;  3EX9 A;  1JB4 A;  3UL6 A;  5HGR A;  2XF3 A;  3DGL A;  3LTA A;  5AEU B;  4STD A;  3EB8 A;  2Q07 A;  2XH9 A;  4KZ1 A;  3CPO A;  3CPW 2;  4U13 A;  1OGX A;  4R9L A;  2CWV A;  4KFD A;  3WOD G;  2GEX A;  2CFK A;  4K1U A;  4ORL A;  4HZB B;  3HIG A;  2B78 A;  3GZB A;  4HM0 B;  3Q90 A;  4GB5 A;  1ZE1 A;  4HM1 B;  3NV0 A;  3NBB A;  2W04 A;  3B4O A;  3FLJ A;  1HKX A;  4R1K A;  1RKY A;  3GZX B;  1SII A;  1LVN A;  5KP3 A;  4N6N B;  4XB5 A;  1DYU A;  2K54 A;  3EF8 A;  2WOH A;  3WA3 A;  1LOX A;  2LQV A;  6STD A;  3PZW A;  1OCV A;  2KCD A;  5CLK A;  1QAK A;  2GXF A;  2ML5 A;  1SQW A;  2CG0 A;  5IW9 A;  3NQZ A;  2F86 B;  1UUW B;  2UX0 A;  3C0K A;  4O2H A;  2XSH B;  2YX9 A;  3DGN A;  5STD A;  3DGM A;  3OX9 A;  1GD3 A;  4RZM A;  3EN1 B;  3SLU A;  1NB3 I;  2C10 A;  3CNX A;  3NXJ A;  2HMK B;  2JDI H;  8CHO A;  1CQS A;  3OV4 A;  2BMR B;  4EYC A;  2A15 A;  2RCD A;  5IG0 A;  3CMA 3;  1IT8 A;  3I56 3;  3CCS 3;  2CHC A;  1QMA A;  4H3U A;  1E3R A;  3A76 A;  3LTB A;  3SED A;  3FG3 A;  5FW5 A;  1N5H A;  1QAF A;  1W00 A;  3G16 A;  2XFT A;  1NO3 A;  3BNE A;  1ULJ B;  2AS0 A;  1TUH A;  3OWS A;  4MMY B;  4RBN A;  5D83 A;  1IV9 A;  3CC7 3;  4KFF A;  3NX0 A;  2OQE A;  2D42 A;  3BLZ A;  4N6M A;  2CWU A;  1VQ7 3;  3X40 A;  3B4P A;  4IIA A;  1IK3 A;  2QGU A;  1C7H A;  4HM7 B;  3UJM A;  4ZM8 A;  4HM3 B;  1Q7H A;  5DRV A;  1DVD A;  4N6T A;  2Y74 A;  2WO0 A;  1IVX A;  2PZV A;  4K61 A;  1W7C A;  5KP4 A;  3HI7 A;  1WMN A;  2L4V A;  1N8R 4;  4MMZ B;  2JQ5 A;  3ALA A;  1FGQ A;  3MKI A;  1JB2 A;  2WGQ A;  2OQE C;  5AIG A;  1IV7 A;  3CCQ 3;  3K0Z A;  2I9W A;  3CCE 3;  1RJO A;  1TFO A;  3VGN A;  1US1 A;  1OGZ A;  5CF2 A;  7STD A;  3NBJ A;  5EEO A;  3LDF A;  2J5V A;  5AI1 A;  2Y73 A;  2CFG A;  2OCT A;  1M9G A;  4XDW A;  3CC2 3;  2BHM A;  2W56 A;  4JF8 A;  1NJI 4;  3HZP A;  1STD A;  3X3X A;  3EN8 A;  5EVH A;  1YGE A;  2M7O A;  2OWP A;  3LML A;  4PEJ A;  3UL5 A;  4AKZ A;  1KQS 2;  4HJL B;  5IEO A;  5LC7 A;  1JKG A;  2BNG A;  1OUN A;  1Q42 A;  1ZE2 A;  3DZL A;  1L5G B;  4FMB A;  1QAL A;  2OTL 3;  2MF7 A;  1WXX A;  2F99 A;  2Z77 A;  2P0X A;  1YIJ 3;  3NUV A;  3Q1C A;  1UI7 A;  4KFE A;  2E2U A;  1Q81 4;  1GS3 A;  3IPT A;  3LT8 A;  3OWY A;  4MEI A;  3KSE D;  5AIH A;  4N6L A;  2CG1 A;  3LOY A;  2YFI B;  1E97 A;  2D1W A;  5TGN A;  3KZT A;  3SOY A;  3CCV 3;  1QVG 2;  2XEP A;  2XRX B;  3S67 A;  4LGQ A;  3KN4 A;  2B1X B;  1WMO A;  1TU5 A;  3X42 A;  3H51 A;  1MNL A;  2W2C A;  4XBT A;  4N6V 0;  3M8C A;  2Z6B A;  3K9M C;  3DY5 A;  3T8N A;  1UUV B;  1OH0 A;  1TP6 A;  5AIF A;  3JUM A;  1OHP A;  3V99 A;  1AVK A;  4LZI A;  2GEY A;  3MG3 A;  1ISK A;  4HVN A;  1YIT 3;  4XBX A;  2YFL B;  3HK4 A;  3F8H A;  3K7C A;  3S5C A;  3V98 A;  1D6Y A;  1GY5 A;  3H3H A;  3LZA A;  4KVH A;  1RRH A;  1VZZ A;  1Q40 B;  3T8U A;  2KRT A;  1IVV A;  2SBL A;  3GAX A;  1W01 A;  4RNZ A;  2WOF A;  3FH1 A;  2GU3 A;  3F40 A;  1IVU A;  3I0Y A;  3VSE A;  3EBY A;  3OXA A;  2CFD A;  4X2O A;  3FCS B;  5D81 A;  1T5Y A;  3WOE B;  1RRL A;  3D79 A;  3LH4 A;  1K8W A;  3HII A;  4N6O B;  1TIJ A;  1YJN 3;  1ASK A;  1WQL B;  5ELU A;  1VQ5 3;  4N3V A;  1SPU A;  2FNQ A;  3CU3 A;  3EBT A;  4FMD A;  2XR8 B;  4FR9 A;  2BO9 B;  1R3E A;  3E99 A;  1SGV A;  3AMO A;  3B7C A;  2P09 A;  4FMA A;  1IQ8 A;  2QEX 3;  3EHC A;  1YVB I;  3PGB A;  1VQ8 3;  3CD6 3;  3F7S A;  5BVB A;  4WWU C;  1K73 4;  4FCJ A;  2QIY A;  5D82 A;  1UI8 A;  2HML B;  3TDG A;  1CYU A;  3LTD A;  1FGO A;  3NV0 B;  3G71 3;  3F9S A;  3I55 3;  1O7M B;  3JUP A;  5JBS A;  1AR0 A;  4HYZ A;  4L7K A;  1A90 A;  1R4C A;  2BT3 A;  1U5O A;  1S72 3;  3KKG A;  3NQY A;  5AYR B;  1IQY A;  3FG1 A;  1EG9 B;  2OTJ 3;  3MYT A;  1IT7 A;  4O8S A;  2E2V A;  4MJD A;  4HM8 B;  3CCR 3;  1YI2 3;  1YHQ 3;  2WGO A;  5IG4 A;  4BTY A;  3DMC A;  4WYK B;  5JPP A;  2OOV A;  1Y4K A;  1K41 A;  4K90 B;  1Q86 4;  4WHA A;  2RSX A;  3WDG B;  1ROV A;  1V74 A;  2O3O A;  3PCR A;  2CK3 H;  3D3L A;  5IG3 A;  1J2B A;  3MPH A;  1W2Z A;  3FG4 A;  3SX1 A;  4EBG A;  3CCL 3;  3NBR A;  1R3F A;  2HMO B;  5IEN A;  3MSO A;  3FF2 A;  2K0M A;  4CCV A;  2CWW A;  3ROB A;  2OOV C;  4O3V A;  3DGO A;  4CDL A;  4G1M B;  3CNM A;  3K63 A;  4R80 A;  3G6E 3;  2XSO B;  1ZS7 A;  1GD4 A;  3S29 A;  3S27 A;  1M90 4;  2HMN B;  3GWR A;  1IVW A;  4HM5 B;  1G96 A;  2O9U X;  3GZR A;  4OVM A;  4HM2 B;  1NDO B;  3PXM A;  3RGR A;  5CK6 A;  5EQL A;  3PS8 A;  1M1X B;  3CME 3;  1VQN 3;  2IUJ A;  1S5A A;  5CXO A;  1FGR A;  3NM2 A;  1GYB A;  1OPY A;  4XBY A;  1DMN A;  3UB1 A;  1FGM A;  3F14 A;  2V1L A;  3N9H A;  3STD A;  4HZ9 B;  3DUK A;  1MOL A;  1DMQ A;  1QJG A;  4FCM A;  3N8B A;  1ZL3 A;  1U8C B;  5AEW B;  2W6J H;  2W9P A;  1VQK 3;  4GL6 A;  2Z76 A;  2RGQ A;  5CF1 A;  5IF6 A;  1D6U A;  2YFJ B;  1QVF 2;  5A0O B;  1VQL 3;  1GY6 A;  2P0M A;  1VQO 3;  1JNQ A;  2GBX B;  2C11 A;  4RNY A;  3ER7 A;  2P38 A;  3SXX A;  3JUO A;  3DXO A;  1N5P A;  1W6Y A;  5AYS C;  1BUQ A;  3CCM 3;  1W2B 2;  3PYJ A;  2CKF B;  1W5Z A;  1O7N B;  2INX A;  2GU1 A;  2W56 B;  1OHO A;  2PNC A;  3U97 A;  1F8N A;  3EQQ B;  4JRF A;  4BTW A;  1JV2 B;  1N9J A;  1VQ9 3;  3QK9 A;  1EQK A;  3MG1 A;  1AV4 A;  1JJ2 2;  1JN5 A;  4FCZ A;  4XM4 A;  1Q7Y 4;  1JKG B;  3LTC A;  3X3Y A;  3QRD A;  1W02 A;  2MC8 A;  3FGY A;  1NU3 A;  4NHF A;  1VQ4 3;  5IG5 A;  1O7H B;  2W0Q A;  2CWT A;  4EV2 A;  1WMP A;  1Q82 4;  2FGT A;  2IUK A;  3JUQ A;  1IQX A;  4K1V A;  2XGN A;  3NHX A;  1RN7 A;  2RFR A;  1UW1 A;  5I97 A;  1K9M 4;  1WTH A;  5JPU A;  2XGL A;  4LSO A;  3VF1 A;  2HMM B;  3F7X A;  1SIH A;  3G4S 3;  4IT7 A;  2STD A;  2CFL A;  3NM7 A;  1STF I;  3KFQ C;  2CX1 A;  3DM8 A;  3RDE A;  1M1K 4;  1NWW A;  2FXT A;  3F8X A;  3CCU 3;  1VQP 3;  1O7W B;  1JB5 A;  2QA4 3;  1A67 A;  3GRD A;  1FGT A;  1YJW 3;  4MMX B;  3IMA B;  1GY7 A;  4O02 B;  3T0U A;  1FUW A;  3SOA A;  1K8A 4;  4IPB A;  2CX0 A;  3MG2 A;  1K28 A;  4Q53 A;  1JN5 B;  1E3V A;  4OUQ A;  4EV5 A;  2CFW A;  4EXR A;  1VQM 3;  4FMC A;  3OWU A;  5ELJ A;  4AKY A;  3EC9 A;  3RGA A;  1WXW A;  1N8Q A;  4R9K A;  2BMO B;  4HBR A;  2AB4 A;  1SJW A;  3D9R A;  4X2H A;  2F98 A;  2B24 B;  1OF5 A;  1CYV A;  3UAI A;  2KXG A;  1WNH A;  3FKA A;  3EJV A;  3HX8 A;  1A2K A;  4TX4 A;  3LT9 A;  4J8T A;  1DMM A;  3KII A;  1VQ6 3;  1HU9 A;  1LNH A;  1PFP A;  3SVA A;  3GZY B;  1EA2 A;  3KE7 A;  1NB5 I;  2LYX A;  4R4K A;  1A2V A;  3ECF A;  1LXE A;  5KP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...