2P38A

Crystal structure of pyrococcus abyssi protein homologue of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
155
structure length
155
Chain Sequence
LRVRRASSWELDLILKEAEKYGELLHEFFCVVEGKYRDVYAVNEEVWKIIEDINMRPYSLGTFVGTIRVDENLVEKFYPNLEFFSLIKLEKNYVILGPKASFLFTTGKDAPKEAVREIKWQGSKRVVVLNDLGDIIGIGLINPKSDRRFIKNLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein involved in ribosomal biogenesis
publication title Structural Insights into the Interaction of the Nip7 PUA Domain with Polyuridine RNA
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Biosynthetic protein
total genus 43
structure length 155
sequence length 155
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 2p38A02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2p38A01
1R3EA 1WXWA 2P38A 1SQWA 4Q1TA 1SGVA 1WXXA 1Q7HA 1IT8A 3UAIA 1IT7A 1ZE2A 2Q07A 1ZE1A 2J5VA 3LDFA 2CX1A 3C0KA 2CWWA 1T5YA 1IQ8A 1J2BA 3VSEA 1K8WA 1ZS7A 2AB4A 2B78A 1ZL3A 3D79A 2J5TA 1R3FA 2CX0A 4DMGA 2AS0A
chains in the Genus database with same CATH superfamily
3ALAA 1G02A 1BU4A 3EHCA 5KP3A 1AVLA 1GMQA 2GEXA 4XBTA 1FW7A 1D6YA 3EE1A 3CCE3 3JUOA 2GSPA 2XSOB 3VSYA 3PCSA 2J8XB 4R80A 5BVBA 1LQMB 3NQZA 1SQWA 4KT3B 5FW5A 2UGIA 2LQVA 2BU4A 1IT7A 1JKGA 2R4IA 5CLKA 2WOFA 5AYSC 2GEYA 3HK4A 3CNXA 1Q40B 4N6MA 5IF6A 2HMKB 5AIGA 1IV7A 3BNCA 3FG4A 1N8QA 5ELJA 2YFIB 5IG0A 1BUJA 2CHCA 1HU9A 3N54B 2E2VA 3Q1CA 4XM4A 1RGEA 2B78A 2CH9A 2L1SA 4G1MB 2K3DA 4HM8B 1K41A 1JRQA 3SEDA 2IA7A 4BL2A 4N6LA 5KP4A 2UUGC 3PS8A 2F4YA 2HMOB 2PZVA 2Y74A 4WWUC 1MWSA 1OPYA 3KSED 3MWZA 2JQ5A 2F5MA 4HVNA 1GD3A 4FMCA 2W03A 1NJI4 1I70A 2HMLB 3DMCA 7RNTA 4LMIA 3ER7A 4KFEA 4N6TA 3AMOA 3NQYA 4CI2B 4NHFA 1I3FA 3CNMA 2W9PA 5A0OB 2QIYA 2K54A 4H3UA 1YIT3 1VQL3 3LTCA 1RNTA 4XB5A 3MSOA 3D9RA 4HKVB 3CCL3 4LYLB 1UDII 3F14A 4L8PA 4MEIA 3U97A 1J2BA 4X2OA 2H0GA 2R41A 4KFFA 4EYCA 6RNTA 2QA43 3K63A 1FZUA 1TFOA 5IW9A 4J5KA 3M6VA 1DMNA 3LTDA 4FCMA 1ROVA 4HM2B 1K734 1A90A 2B24B 1LOWA 3S5CA 1GOVA 1GYBA 1BNSA 1RGKA 1PY3A 1T5YA 1YGEA 3LT8A 5EQLA 3LJCA 1OCVA 4R9KA 1QMAA 3UL5A 2OTJ3 4HJLB 1IDPA 4I4KA 2CW9A 2GU3A 2CG1A 1STDA 1W6CA 1OGXA 1DVCA 1FGOA 3OWYA 4J8TA 3UAIA 1KWIA 1B2MA 2KF5A 1Q864 2OWPA 2OQEA 1GY6A 1VQ73 2V1LA 4HM1B 5CK6A 3AGNA 5D81A 1TRPA 4HBRA 1A2VA 1BSDA 1U5OA 2BMRB 3OV4A 3HX8A 1B2ZA 2RFKA 4CJNA 4KVHA 5JBSA 4N6OB 1Q40A 1B20A 1VQ53 3Q90A 3X41A 1IQXA 1V58A 2H0IA 2RBIA 1W2ZA 1HKXA 1R4CA 1TE7A 4EBGA 5LC6A 3D5GA 1R4YA 3BNBA 1EKMA 1FUTA 1O7GB 1TJDA 1UUGB 5AYRB 1A2PA 3FLJA 1RLSA 3WDGB 1UI7A 1TU5A 1BSEA 5G1LA 1B21A 1GY5A 3EC9A 3A5EA 4MJDA 1B2SA 2GBXB 1JNQA 1BNFA 3GSPA 3IPTA 3DM8A 1D6UA 1RGLA 1UUVB 3M6WA 2KF3A 3Q3FA 2CWTA 4AKYA 5M19A 2HOHA 2F86B 2RSXA 7STDA 4MMYB 1T2IA 1BRSA 4RNZA 4WFOA 2D42A 1PFPA 2AAEA 1IYYA 3JUMA 1AVKA 4AKZA 3D79A 1SARA 2OCTA 2INXA 3SOYA 1E3RA 2E2UA 5IEPA 2XF3A 3AMOB 1IVVA 2MC8A 2D1WA 3GZRA 4KFDA 1BGSA 3CCM3 1XNEA 1LRAA 3ZFZA 4BTXA 5BU4A 1NO3A 2O9UX 3EJVA 4IIAA 1UCLA 1IT8A 2F5WA 1V57A 4IPBA 3TDGA 1JBTA 3SX1A 3UB1A 3JUQA 9RNTA 1FGRA 1RSNA 2OQEC 1S5AA 3C0KA 2CWWA 1T2HA 4IT7A 1YJ93 2C4BA 3NBBA 1MNLA 4L7KA 5G1KA 1YIJ3 2CFWA 3IUWA 1RDSA 3AGOA 4N6NB 1Z1SA 5IG5A 1S723 3M65A 1ROAA 1TUHA 3EBYA 2P09A 2F98A 5AIHA 1LOVA 1Q42A 1I2EA 2SARA 1A67A 3DGNA 4R4KA 3RGRA 1X1UA 4KZ1A 2WGQA 2XR8B 1RRLA 3ZV0C 4X2HA 3LWOA 2KAAA 3ZG0A 4EC6A 3VF1A 3V98A 3F8XA 3LDFA 2CK3H 2QGUA 3K7CA 1VQN3 3DGMA 3JUNA 3LH4A 3SXXA 1B2UA 1NDOB 1RMSA 1RGFA 1W4NA 3HIIA 3KKGA 3NBJA 4LZIA 3RDEA 1VQ63 1QALA 5AIIA 1K9M4 1CYUA 2RNTA 3JVCA 1RCKA 1RGGA 3F7XA 3WMDA 4CCVA 1BNGA 3B4PA 1LNIA 2Z77A 3M8CA 3X3ZA 1JBSA 1JB2A 5DREA 3ZG5A 5CF2A 7GSPA 5FGOA 6GSPA 1O7HB 3RNTA 3CPW2 2HMMB 1TP6A 1JB5A 1JZOA 3BU4A 4WYKB 2CC3A 1CH0A 1AR0A 2RGQA 4FCZA 1M1K4 1LOXA 1U8CB 4GSPA 1G96A 4BTWA 3NM7A 1SPUA 3F40A 1TIJA 1WMNA 3UNLA 2XGLA 2RCDA 4HM0B 1T3BA 3H3HA 1SIHA 3T8NA 3EBTA 3UJMA 1LXEA 1S04A 1OUNA 1WK2A 1AY7A 3FF0A 1MWRA 1W5ZA 3SLUA 1JN5B 3WA2X 4RZMA 2XH9A 5JPUA 4CPKA 1UUWB 4I5QA 1EA2A 2BHMA 3E99A 3LT9A 1C54A 2BNGA 4BIRA 3JUPA 1IV9A 3RGAA 1WMPA 3LYGA 1GY7A 2H0HA 2PNCA 2OTL3 2FRXA 2BT3A 3U1WA 1YI23 1R3EA 1OACA 2OOVA 4HM6B 3CCS3 8RNTA 3SYUA 1OHOA 1UW1A 3DGOA 3MG2A 1UCJA 1QVF2 3ECFA 2BIRA 4J9AA 3T0UA 1WMOA 1BSAA 2E2TA 2IYJA 2KCDA 2W0QA 4N6V0 4PEJA 1VQ43 2BMOB 3PYJA 4N6UA 1RCLA 1ZS7A 1DETA 1DMMA 1UGIA 3GAXA 3A76A 1VQ83 1CEWI 1DYUA 1I0XA 1M904 4JF8A 5AIFA 3HOHA 3WR2A 3WA3A 1Q9EA 2CX1A 2UX0A 1EG9B 1GD4A 2Y73A 3DXOA 4O8SA 3GZXB 3MYTA 4OVMA 3F7SA 2IMJA 3WHOA 2KKUA 2QEX3 1RGCA 1FUSA 3CC43 2W2CA 4HYZA 1KD14 3FCSB 1BRKA 2Z76A 4GB5A 5EEOA 3LTAA 3EF8A 3X3YA 2MF7A 2HVYA 1N5PA 3MHEA 1ZGXA 4WYKA 3S29A 2ANEA 2SBLA 2C10A 1ZO2A 3EQQB 4O2HA 1DE3A 3PGBA 1SJWA 1TRQA 2LYXA 2WO0A 5IERA 1UGHI 3FSDA 5KP1A 1PU4A 1BRNL 1YJN3 5ELUA 3SVAA 3GZYB 3S27A 4WHAA 3LXUX 5GSPA 3KCHA 3NUVA 2EY4A 4XDVA 1JN5A 2AS0A 3B8LA 1I3IA 1QJGA 1JJ22 1FUWA 1NU3A 4L8OA 1PYLA 1ZBOA 2DP9A 2OOVC 1RN4A 2YFLB 1SGVA 3STDA 3HAXA 1GSPA 1MGWA 3HI7A 4GL6A 2Q07A 1LOYA 1B27A 3M6XA 1X1WA 2HMNB 3GRDA 3CC73 2CFLA 4BTYA 1ISKA 3Q2PA 1BNJA 3G0KA 1O7PB 1IQ8A 3FG3A 4TZ4C 3LTBA 4RNTA 4K90B 1QAKA 3IMAB 5G2GA 3BNDA 1Q7Y4 1NB5I 1O7NB 2A15A 2GU1A 2KXGA 2STDA 3DGLA 4ORLA 1CQSA 4MMZB 2BMQB 2I9WA 2AUSA 3OX9A 3CME3 1Q824 1RTUA 3K5TA 3O8YA 1BRHA 2W56B 2CWUA 4ILFA 4MMXB 3CXC2 4GHOA 4LEHA 1MWUA 3FG1A 1Q814 4ZM8A 3IJEB 1DVDA 5DRVA 2M7OA 4K61A 2CFKA 1BAOA 1Y4KA 1BVIA 2F56A 1RGHA 1YJW3 4N3VA 5I97A 2CFDA 3X3XA 3HIGA 1ZX2A 3OWUA 1GMRA 1GOYA 2JDIH 3PZWA 3EN8A 4R9LA 2L4VA 3WOFB 1WQLB 3N9HA 4J5GA 4XBYA 4OK0A 5CXOA 4HZBB 1BRIA 3CCU3 5IEOA 1IU7A 3FGYA 3WODG 3NXJA 3T8UA 6STDA 1EQKA 4FMBA 1KC84 3MPHA 1OHSA 3WOEB 3K0ZA 4NREA 1CYVA 2CX0A 3NBRA 3URPA 3OWSA 4HM7B 1BNIA 2WGOA 5AEWB 4HZ9B 3V99A 1K28A 3G16A 3NX0A 3J7Yd 3DGYA 5RNTA 2CWVA 1O7WB 1WXXA 3KSPA 2AADA 3LOYA 3EX9A 1UI8A 1EUIC 4HM3B 1KQS2 1ULJB 3H51A 3LZAA 3BLZA 1W7CA 3KIIA 2K0MA 3OXAA 2ZA4A 4XBXA 5HOHA 1MGRA 1BSBA 3DH2A 3DY5A 3K9MC 1JBRA 2ZDJA 1BANA 2AB4A 3NV0A 2YX9A 1RN1A 5TGNA 5AEUB 3LWQA 1G0TA 4CI3B 2CFGA 5D83A 3GWRA 4HOHA 4NPBA 4XDWA 1AQZA 1JB4A 2XFSA 2ZL8A 3PXMA 3MG1A 1N9JA 2W04A 2ZHXB 3CCQ3 1RNBA 1A2KA 1W00A 1NB3I 2B1XB 5LC7A 2P38A 4R1KA 4Q1TA 3CCV3 1LQGC 8CHOA 1MOLA 2XFTA 2W9QA 4EXRA 1VQK3 4FCJA 1IVWA 1RKYA 2IY2A 1M9GA 1IQYA 2RFRA 4HAAA 3NHXA 1ZE1A 3KZTA 4H61A 2W56A 5D82A 3S67A 1UCKA 3I563 2CKFB 4CI1B 1M1XB 1EEJA 2GBWB 1I2FA 3S28A 3MKIA 1E97A 1OF5B 1STFI 3L0RA 4HM5B 2XEPA 3EN1B 3M4XA 1K8WA 1ASKA 1F8NA 2KF6A 3X42A 5HGRA 1FGTA 4QWTA 1YHQ3 2Z0TA 1L5GB 1VQP3 4EV5A 1MWTA 2P05A 2HMJB 3DZLA 3G6E3 5BXQA 5CF1A 3AHSA 3F9SA 2Z6BA 1GMPA 3B7CA 3CU3A 4HM4B 1BOXA 3F8HA 3LWVA 2IUJA 5IENA 1QVG2 3KE7A 3FKAA 2XGNA 1YNVX 1WXWA 2O3OA 1BIRA 1O7MB 1BNEA 4FMAA 3HJWA 1GOUA 1OHPA 3EB8A 5STDA 3VGNA 1HZ1A 3CD63 3G4S3 1IVUA 5M18A 3FZWA 1BRJA 1US1A 3ROBA 3CMA3 1UOYA 3U28A 4OUQA 2APOA 3BB9A 3LWPA 3LMLA 4WP5A 3SOAA 3M6UA 4BL3A 1VQO3 2ML6A 1V74A 1JV2B 3AHWA 3KFQC 1C7HA 4K1VA 4DKIA 1BRGA 1BUQA 3N8BA 1E3VA 3D3LA 1YVBI 4BU4A 3X40A 4CDLA 3CCR3 3D4AA 1TTOA 3KN4A 1N9EA 1LNHA 2YFJB 3HJYA 4FMDA 1R3FA 1UCIA 2ML5A 1JKGB 5AI1A 1RGAA 5IG3A 1VQM3 3QRDA 2WOHA 1RJOA 1X1YA 1NWWA 3HZPA 2BO9B 2W6JH 4LGQA 2XSHB 2CG0A 2F99A 3I553 1Q7HA 1FYSA 1ULIB 1IVXA 2FNQA 1OGZA 3I0YA 3D5IA 3MG3A 4FR9A 5EVHA 1RRHA 3QK9A 1W2B2 1K8A4 1I0VA 1WNHA 3NV0B 4RBNA 3UL6A 1BSCA 2P0XA 3V92A 4AEQA 1WTHA 1TFKA 1I2GA 1SIIA 2C11A 3CPOA 1YGWA 2FXTA 3MQKA 4U13A 4K1UA 1W6GA 1FGQA 1W01A 5IG4A 1ZL3A 1DMQA 3FH1A 1BNRA 1N8R4 1RHLA 1OF5A 1N5HA 3FF2A 4RNYA 2J5TA 1W6YA 4DMGA 1VZZA 1D6ZA 1LVNA 3G713 1RN7A 2GXFA 1GS3A 1X1XA 4STDA 1VQQA 5BIRA 2E5OA 1ZE2A 1B3SA 1HYFA 1I8VA 3B4OA 4LSOA 4Q53A 5M1AA 4EV2A 1NNVA 1KSIA 2J5VA 3BNEA 1FA3A 4JRFA 3PCRA 2P0MA 2IUKA 2KRTA 2CIUA 4O3VA 3G8ZA 4TX4A 1QAFA 1AV4A 2KF4A 1VQ93 1W02A 1IK3A 3CCJ3 4EW5A 3CC23 3LWRA 5JPPA 1JZDA 1YVSA 2FGTA 2XRXB 2Z7AA 3NM2A 4O02B 3OW22 3BIRA 1FGMA 3GZBA 1B2XA 3VSEA 1OH0A 3DUKA
chains in the Genus database with same CATH topology
3ALAA 3EHCA 5KP3A 1AVLA 2GEXA 4XBTA 1D6YA 3EE1A 3CCE3 3JUOA 2XSOB 3VSYA 3PCSA 4R80A 5BVBA 3NQZA 1SQWA 5FW5A 2LQVA 1IT7A 1JKGA 2R4IA 5CLKA 2WOFA 5AYSC 2GEYA 3HK4A 3CNXA 1Q40B 4N6MA 5IF6A 2HMKB 5AIGA 1IV7A 3BNCA 3FG4A 1N8QA 5ELJA 2YFIB 5IG0A 2CHCA 1HU9A 3N54B 2E2VA 3Q1CA 4XM4A 2B78A 2CH9A 4G1MB 4HM8B 3SEDA 1K41A 1JRQA 2IA7A 4N6LA 5KP4A 3PS8A 2Y74A 2HMOB 2PZVA 4WWUC 1OPYA 3KSED 3MWZA 2JQ5A 4HVNA 1GD3A 4FMCA 2W03A 1NJI4 2HMLB 3DMCA 4LMIA 3ER7A 4KFEA 4N6TA 3AMOA 3NQYA 4NHFA 3CNMA 2W9PA 5A0OB 2QIYA 2K54A 4H3UA 1YIT3 1VQL3 3LTCA 4XB5A 3MSOA 3D9RA 4HKVB 3CCL3 3F14A 4MEIA 4L8PA 3U97A 1J2BA 4X2OA 4EYCA 4KFFA 2QA43 3K63A 5IW9A 1TFOA 1DMNA 3LTDA 4FCMA 1ROVA 4HM2B 1K734 1A90A 2B24B 3S5CA 1GYBA 1YGEA 1T5YA 3LT8A 3UL5A 5EQLA 1OCVA 4R9KA 1QMAA 2OTJ3 4HJLB 1IDPA 4I4KA 2CW9A 2GU3A 2CG1A 1STDA 1W6CA 1OGXA 1DVCA 1FGOA 3OWYA 4J8TA 3UAIA 1KWIA 1Q864 2OWPA 2OQEA 1GY6A 1VQ73 2V1LA 4HM1B 5CK6A 5D81A 4HBRA 1A2VA 1U5OA 2BMRB 3OV4A 3HX8A 4KVHA 5JBSA 4N6OB 1Q40A 1VQ53 3Q90A 3X41A 1IQXA 1W2ZA 1HKXA 1R4CA 4EBGA 5LC6A 3BNBA 1EKMA 1O7GB 5AYRB 3FLJA 3WDGB 1TU5A 1UI7A 1GY5A 3EC9A 4MJDA 2GBXB 1JNQA 3IPTA 3DM8A 1D6UA 1UUVB 4AKYA 2CWTA 2F86B 2RSXA 7STDA 4MMYB 4RNZA 4WFOA 2D42A 1PFPA 3JUMA 1AVKA 4AKZA 3D79A 2OCTA 3SOYA 2INXA 2E2UA 1E3RA 5IEPA 2XF3A 3AMOB 1IVVA 2MC8A 2D1WA 3GZRA 4KFDA 3CCM3 4BTXA 1NO3A 2O9UX 3EJVA 4IIAA 4IPBA 1IT8A 3TDGA 3SX1A 3UB1A 3JUQA 1FGRA 2OQEC 1S5AA 3C0KA 2CWWA 4IT7A 1YJ93 3NBBA 1MNLA 4L7KA 1YIJ3 2CFWA 4N6NB 1Z1SA 5IG5A 1S723 1ROAA 1TUHA 3EBYA 2P09A 2F98A 5AIHA 1Q42A 1A67A 3DGNA 4R4KA 3RGRA 4KZ1A 2WGQA 2XR8B 1RRLA 4X2HA 4EC6A 3VF1A 3V98A 3F8XA 3LDFA 2CK3H 2QGUA 3K7CA 1VQN3 3DGMA 3JUNA 3LH4A 3SXXA 1NDOB 1W4NA 3HIIA 3KKGA 3NBJA 4LZIA 3RDEA 1VQ63 1QALA 5AIIA 1K9M4 1CYUA 3JVCA 3WMDA 3F7XA 4CCVA 3B4PA 3M8CA 2Z77A 3X3ZA 1JB2A 5DREA 5CF2A 5FGOA 1O7HB 3CPW2 2HMMB 1TP6A 1JB5A 4WYKB 2CC3A 1AR0A 2RGQA 4FCZA 1M1K4 1LOXA 1U8CB 1G96A 4BTWA 3NM7A 1SPUA 3F40A 1TIJA 1WMNA 3UNLA 2XGLA 2RCDA 4HM0B 3H3HA 1SIHA 3T8NA 3EBTA 3UJMA 1LXEA 1OUNA 3FF0A 1W5ZA 3SLUA 3WA2X 1JN5B 4RZMA 2XH9A 5JPUA 1UUWB 1EA2A 2BHMA 3E99A 3LT9A 2BNGA 3JUPA 1IV9A 3RGAA 1WMPA 3LYGA 1GY7A 2PNCA 2OTL3 2BT3A 1YI23 1R3EA 1OACA 2OOVA 4HM6B 3CCS3 1OHOA 1UW1A 3DGOA 3MG2A 1QVF2 3ECFA 4J9AA 3T0UA 1WMOA 2E2TA 2KCDA 2W0QA 4N6V0 4PEJA 1VQ43 2BMOB 3PYJA 4N6UA 1ZS7A 1DMMA 3GAXA 3A76A 1VQ83 1CEWI 1DYUA 1M904 4JF8A 5AIFA 3WA3A 2CX1A 2Y73A 2UX0A 1GD4A 1EG9B 3DXOA 4O8SA 3GZXB 3MYTA 4OVMA 3F7SA 2IMJA 2QEX3 3CC43 2W2CA 4HYZA 1KD14 3FCSB 2Z76A 4GB5A 5EEOA 3LTAA 3EF8A 3X3YA 2MF7A 1N5PA 3MHEA 4WYKA 3S29A 2SBLA 2C10A 1ZO2A 3EQQB 4O2HA 3PGBA 1SJWA 2LYXA 2WO0A 5IERA 1PU4A 3FSDA 5KP1A 1YJN3 5ELUA 3SVAA 3GZYB 3S27A 4WHAA 3LXUX 3NUVA 4XDVA 1JN5A 2AS0A 3B8LA 1QJGA 1FUWA 1JJ22 1NU3A 4L8OA 2OOVC 2YFLB 1SGVA 3STDA 3HI7A 4GL6A 2Q07A 2HMNB 3GRDA 3CC73 2CFLA 4BTYA 1ISKA 3Q2PA 3G0KA 1O7PB 1IQ8A 3FG3A 3LTBA 4K90B 1QAKA 3IMAB 5G2GA 3BNDA 1Q7Y4 1NB5I 1O7NB 2A15A 2GU1A 2KXGA 2STDA 3DGLA 4ORLA 1CQSA 4MMZB 2BMQB 2I9WA 3OX9A 3CME3 1Q824 3K5TA 3O8YA 2W56B 2CWUA 4MMXB 3CXC2 4LEHA 3FG1A 1Q814 4ZM8A 3IJEB 1DVDA 5DRVA 2M7OA 4K61A 2CFKA 1Y4KA 1YJW3 4N3VA 5I97A 2CFDA 3X3XA 3HIGA 1ZX2A 3OWUA 2JDIH 3PZWA 3EN8A 4R9LA 2L4VA 3WOFB 1WQLB 3N9HA 4XBYA 5CXOA 4OK0A 4HZBB 3CCU3 5IEOA 1IU7A 3FGYA 3WODG 3NXJA 3T8UA 6STDA 1EQKA 4FMBA 1KC84 3MPHA 1OHSA 3WOEB 3K0ZA 4NREA 1CYVA 2CX0A 3NBRA 3OWSA 4HM7B 2WGOA 5AEWB 4HZ9B 3V99A 1K28A 3G16A 3NX0A 3J7Yd 2CWVA 1O7WB 1WXXA 3KSPA 3LOYA 3EX9A 1UI8A 4HM3B 1KQS2 1ULJB 3H51A 3LZAA 3BLZA 1W7CA 3KIIA 2K0MA 3OXAA 4XBXA 3DY5A 3K9MC 2ZDJA 2AB4A 3NV0A 2YX9A 5TGNA 5AEUB 2CFGA 5D83A 3GWRA 4XDWA 1JB4A 2XFSA 2ZL8A 3PXMA 3MG1A 1N9JA 2W04A 3CCQ3 1A2KA 1W00A 1NB3I 2B1XB 5LC7A 2P38A 4R1KA 4Q1TA 3CCV3 8CHOA 1MOLA 2XFTA 2W9QA 4EXRA 1VQK3 4FCJA 1IVWA 1RKYA 2RFRA 1M9GA 1IQYA 3S67A 3NHXA 1ZE1A 3KZTA 4H61A 2W56A 5D82A 3I563 2CKFB 1M1XB 2GBWB 3S28A 3MKIA 1E97A 1OF5B 1STFI 3L0RA 4HM5B 2XEPA 3EN1B 1K8WA 1ASKA 1F8NA 3X42A 1YHQ3 5HGRA 1FGTA 4QWTA 1L5GB 1VQP3 4EV5A 2P05A 3DZLA 2HMJB 3G6E3 5BXQA 5CF1A 3F9SA 2Z6BA 3B7CA 3CU3A 4HM4B 2IUJA 3F8HA 5IENA 1QVG2 3KE7A 3FKAA 2XGNA 2O3OA 1WXWA 1O7MB 4FMAA 1OHPA 3EB8A 5STDA 3VGNA 3CD63 3G4S3 1IVUA 3FZWA 1US1A 3ROBA 3CMA3 4OUQA 3BB9A 3LMLA 4WP5A 3SOAA 1VQO3 2ML6A 1V74A 1JV2B 3KFQC 4K1VA 1C7HA 1BUQA 3N8BA 1E3VA 3D3LA 1YVBI 3CCR3 3X40A 4CDLA 3KN4A 1N9EA 1LNHA 2YFJB 4FMDA 3U1WA 1R3FA 2ML5A 5AI1A 1JKGB 5IG3A 1VQM3 3QRDA 2WOHA 1RJOA 1NWWA 3HZPA 2BO9B 2W6JH 4LGQA 2XSHB 2CG0A 2F99A 3I553 1Q7HA 1ULIB 1IVXA 2FNQA 1OGZA 3I0YA 3MG3A 4FR9A 5EVHA 1W2B2 1RRHA 3QK9A 1K8A4 1WNHA 3NV0B 4RBNA 3UL6A 2P0XA 3V92A 4AEQA 1WTHA 1TFKA 1SIIA 2C11A 3CPOA 2FXTA 4U13A 5IG4A 4K1UA 1W6GA 1FGQA 1W01A 1ZL3A 1DMQA 3FH1A 1N8R4 1OF5A 1N5HA 3FF2A 4RNYA 2J5TA 1W6YA 4DMGA 1VZZA 1D6ZA 1LVNA 3G713 1RN7A 2GXFA 1GS3A 4STDA 4Q53A 1ZE2A 4LSOA 3B4OA 4EV2A 1KSIA 2J5VA 3BNEA 1FA3A 4JRFA 3PCRA 2P0MA 2IUKA 2KRTA 2CIUA 4O3VA 3G8ZA 4TX4A 1QAFA 1AV4A 1VQ93 1W02A 1IK3A 3CCJ3 3CC23 5JPPA 2FGTA 2XRXB 2Z7AA 3NM2A 4O02B 3OW22 1FGMA 3GZBA 3VSEA 1OH0A 3DUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3E A;  1WXW A;  2P38 A;  1SQW A;  4Q1T A;  1SGV A;  1WXX A;  1Q7H A;  1IT8 A;  3UAI A;  1IT7 A;  1ZE2 A;  2Q07 A;  1ZE1 A;  2J5V A;  3LDF A;  2CX1 A;  3C0K A;  2CWW A;  1T5Y A;  1IQ8 A;  1J2B A;  3VSE A;  1K8W A;  1ZS7 A;  2AB4 A;  2B78 A;  1ZL3 A;  3D79 A;  2J5T A;  1R3F A;  2CX0 A;  4DMG A;  2AS0 A; 
#chains in the Genus database with same CATH topology
 3ALA A;  1G02 A;  1BU4 A;  3EHC A;  5KP3 A;  1AVL A;  1GMQ A;  2GEX A;  4XBT A;  1FW7 A;  1D6Y A;  3EE1 A;  3CCE 3;  3JUO A;  2GSP A;  2XSO B;  3VSY A;  3PCS A;  2J8X B;  4R80 A;  5BVB A;  1LQM B;  3NQZ A;  1SQW A;  4KT3 B;  5FW5 A;  2UGI A;  2LQV A;  2BU4 A;  1IT7 A;  1JKG A;  2R4I A;  5CLK A;  2WOF A;  5AYS C;  2GEY A;  3HK4 A;  3CNX A;  1Q40 B;  4N6M A;  5IF6 A;  2HMK B;  5AIG A;  1IV7 A;  3BNC A;  3FG4 A;  1N8Q A;  5ELJ A;  2YFI B;  5IG0 A;  1BUJ A;  2CHC A;  1HU9 A;  3N54 B;  2E2V A;  3Q1C A;  4XM4 A;  1RGE A;  2B78 A;  2CH9 A;  2L1S A;  4G1M B;  2K3D A;  4HM8 B;  1K41 A;  1JRQ A;  3SED A;  2IA7 A;  4BL2 A;  4N6L A;  5KP4 A;  2UUG C;  3PS8 A;  2F4Y A;  2HMO B;  2PZV A;  2Y74 A;  4WWU C;  1MWS A;  1OPY A;  3KSE D;  3MWZ A;  2JQ5 A;  2F5M A;  4HVN A;  1GD3 A;  4FMC A;  2W03 A;  1NJI 4;  1I70 A;  2HML B;  3DMC A;  7RNT A;  4LMI A;  3ER7 A;  4KFE A;  4N6T A;  3AMO A;  3NQY A;  4CI2 B;  4NHF A;  1I3F A;  3CNM A;  2W9P A;  5A0O B;  2QIY A;  2K54 A;  4H3U A;  1YIT 3;  1VQL 3;  3LTC A;  1RNT A;  4XB5 A;  3MSO A;  3D9R A;  4HKV B;  3CCL 3;  4LYL B;  1UDI I;  3F14 A;  4L8P A;  4MEI A;  3U97 A;  1J2B A;  4X2O A;  2H0G A;  2R41 A;  4KFF A;  4EYC A;  6RNT A;  2QA4 3;  3K63 A;  1FZU A;  1TFO A;  5IW9 A;  4J5K A;  3M6V A;  1DMN A;  3LTD A;  4FCM A;  1ROV A;  4HM2 B;  1K73 4;  1A90 A;  2B24 B;  1LOW A;  3S5C A;  1GOV A;  1GYB A;  1BNS A;  1RGK A;  1PY3 A;  1T5Y A;  1YGE A;  3LT8 A;  5EQL A;  3LJC A;  1OCV A;  4R9K A;  1QMA A;  3UL5 A;  2OTJ 3;  4HJL B;  1IDP A;  4I4K A;  2CW9 A;  2GU3 A;  2CG1 A;  1STD A;  1W6C A;  1OGX A;  1DVC A;  1FGO A;  3OWY A;  4J8T A;  3UAI A;  1KWI A;  1B2M A;  2KF5 A;  1Q86 4;  2OWP A;  2OQE A;  1GY6 A;  1VQ7 3;  2V1L A;  4HM1 B;  5CK6 A;  3AGN A;  5D81 A;  1TRP A;  4HBR A;  1A2V A;  1BSD A;  1U5O A;  2BMR B;  3OV4 A;  3HX8 A;  1B2Z A;  2RFK A;  4CJN A;  4KVH A;  5JBS A;  4N6O B;  1Q40 A;  1B20 A;  1VQ5 3;  3Q90 A;  3X41 A;  1IQX A;  1V58 A;  2H0I A;  2RBI A;  1W2Z A;  1HKX A;  1R4C A;  1TE7 A;  4EBG A;  5LC6 A;  3D5G A;  1R4Y A;  3BNB A;  1EKM A;  1FUT A;  1O7G B;  1TJD A;  1UUG B;  5AYR B;  1A2P A;  3FLJ A;  1RLS A;  3WDG B;  1UI7 A;  1TU5 A;  1BSE A;  5G1L A;  1B21 A;  1GY5 A;  3EC9 A;  3A5E A;  4MJD A;  1B2S A;  2GBX B;  1JNQ A;  1BNF A;  3GSP A;  3IPT A;  3DM8 A;  1D6U A;  1RGL A;  1UUV B;  3M6W A;  2KF3 A;  3Q3F A;  2CWT A;  4AKY A;  5M19 A;  2HOH A;  2F86 B;  2RSX A;  7STD A;  4MMY B;  1T2I A;  1BRS A;  4RNZ A;  4WFO A;  2D42 A;  1PFP A;  2AAE A;  1IYY A;  3JUM A;  1AVK A;  4AKZ A;  3D79 A;  1SAR A;  2OCT A;  2INX A;  3SOY A;  1E3R A;  2E2U A;  5IEP A;  2XF3 A;  3AMO B;  1IVV A;  2MC8 A;  2D1W A;  3GZR A;  4KFD A;  1BGS A;  3CCM 3;  1XNE A;  1LRA A;  3ZFZ A;  4BTX A;  5BU4 A;  1NO3 A;  2O9U X;  3EJV A;  4IIA A;  1UCL A;  1IT8 A;  2F5W A;  1V57 A;  4IPB A;  3TDG A;  1JBT A;  3SX1 A;  3UB1 A;  3JUQ A;  9RNT A;  1FGR A;  1RSN A;  2OQE C;  1S5A A;  3C0K A;  2CWW A;  1T2H A;  4IT7 A;  1YJ9 3;  2C4B A;  3NBB A;  1MNL A;  4L7K A;  5G1K A;  1YIJ 3;  2CFW A;  3IUW A;  1RDS A;  3AGO A;  4N6N B;  1Z1S A;  5IG5 A;  1S72 3;  3M65 A;  1ROA A;  1TUH A;  3EBY A;  2P09 A;  2F98 A;  5AIH A;  1LOV A;  1Q42 A;  1I2E A;  2SAR A;  1A67 A;  3DGN A;  4R4K A;  3RGR A;  1X1U A;  4KZ1 A;  2WGQ A;  2XR8 B;  1RRL A;  3ZV0 C;  4X2H A;  3LWO A;  2KAA A;  3ZG0 A;  4EC6 A;  3VF1 A;  3V98 A;  3F8X A;  3LDF A;  2CK3 H;  2QGU A;  3K7C A;  1VQN 3;  3DGM A;  3JUN A;  3LH4 A;  3SXX A;  1B2U A;  1NDO B;  1RMS A;  1RGF A;  1W4N A;  3HII A;  3KKG A;  3NBJ A;  4LZI A;  3RDE A;  1VQ6 3;  1QAL A;  5AII A;  1K9M 4;  1CYU A;  2RNT A;  3JVC A;  1RCK A;  1RGG A;  3F7X A;  3WMD A;  4CCV A;  1BNG A;  3B4P A;  1LNI A;  2Z77 A;  3M8C A;  3X3Z A;  1JBS A;  1JB2 A;  5DRE A;  3ZG5 A;  5CF2 A;  7GSP A;  5FGO A;  6GSP A;  1O7H B;  3RNT A;  3CPW 2;  2HMM B;  1TP6 A;  1JB5 A;  1JZO A;  3BU4 A;  4WYK B;  2CC3 A;  1CH0 A;  1AR0 A;  2RGQ A;  4FCZ A;  1M1K 4;  1LOX A;  1U8C B;  4GSP A;  1G96 A;  4BTW A;  3NM7 A;  1SPU A;  3F40 A;  1TIJ A;  1WMN A;  3UNL A;  2XGL A;  2RCD A;  4HM0 B;  1T3B A;  3H3H A;  1SIH A;  3T8N A;  3EBT A;  3UJM A;  1LXE A;  1S04 A;  1OUN A;  1WK2 A;  1AY7 A;  3FF0 A;  1MWR A;  1W5Z A;  3SLU A;  1JN5 B;  3WA2 X;  4RZM A;  2XH9 A;  5JPU A;  4CPK A;  1UUW B;  4I5Q A;  1EA2 A;  2BHM A;  3E99 A;  3LT9 A;  1C54 A;  2BNG A;  4BIR A;  3JUP A;  1IV9 A;  3RGA A;  1WMP A;  3LYG A;  1GY7 A;  2H0H A;  2PNC A;  2OTL 3;  2FRX A;  2BT3 A;  3U1W A;  1YI2 3;  1R3E A;  1OAC A;  2OOV A;  4HM6 B;  3CCS 3;  8RNT A;  3SYU A;  1OHO A;  1UW1 A;  3DGO A;  3MG2 A;  1UCJ A;  1QVF 2;  3ECF A;  2BIR A;  4J9A A;  3T0U A;  1WMO A;  1BSA A;  2E2T A;  2IYJ A;  2KCD A;  2W0Q A;  4N6V 0;  4PEJ A;  1VQ4 3;  2BMO B;  3PYJ A;  4N6U A;  1RCL A;  1ZS7 A;  1DET A;  1DMM A;  1UGI A;  3GAX A;  3A76 A;  1VQ8 3;  1CEW I;  1DYU A;  1I0X A;  1M90 4;  4JF8 A;  5AIF A;  3HOH A;  3WR2 A;  3WA3 A;  1Q9E A;  2CX1 A;  2UX0 A;  1EG9 B;  1GD4 A;  2Y73 A;  3DXO A;  4O8S A;  3GZX B;  3MYT A;  4OVM A;  3F7S A;  2IMJ A;  3WHO A;  2KKU A;  2QEX 3;  1RGC A;  1FUS A;  3CC4 3;  2W2C A;  4HYZ A;  1KD1 4;  3FCS B;  1BRK A;  2Z76 A;  4GB5 A;  5EEO A;  3LTA A;  3EF8 A;  3X3Y A;  2MF7 A;  2HVY A;  1N5P A;  3MHE A;  1ZGX A;  4WYK A;  3S29 A;  2ANE A;  2SBL A;  2C10 A;  1ZO2 A;  3EQQ B;  4O2H A;  1DE3 A;  3PGB A;  1SJW A;  1TRQ A;  2LYX A;  2WO0 A;  5IER A;  1UGH I;  3FSD A;  5KP1 A;  1PU4 A;  1BRN L;  1YJN 3;  5ELU A;  3SVA A;  3GZY B;  3S27 A;  4WHA A;  3LXU X;  5GSP A;  3KCH A;  3NUV A;  2EY4 A;  4XDV A;  1JN5 A;  2AS0 A;  3B8L A;  1I3I A;  1QJG A;  1JJ2 2;  1FUW A;  1NU3 A;  4L8O A;  1PYL A;  1ZBO A;  2DP9 A;  2OOV C;  1RN4 A;  2YFL B;  1SGV A;  3STD A;  3HAX A;  1GSP A;  1MGW A;  3HI7 A;  4GL6 A;  2Q07 A;  1LOY A;  1B27 A;  3M6X A;  1X1W A;  2HMN B;  3GRD A;  3CC7 3;  2CFL A;  4BTY A;  1ISK A;  3Q2P A;  1BNJ A;  3G0K A;  1O7P B;  1IQ8 A;  3FG3 A;  4TZ4 C;  3LTB A;  4RNT A;  4K90 B;  1QAK A;  3IMA B;  5G2G A;  3BND A;  1Q7Y 4;  1NB5 I;  1O7N B;  2A15 A;  2GU1 A;  2KXG A;  2STD A;  3DGL A;  4ORL A;  1CQS A;  4MMZ B;  2BMQ B;  2I9W A;  2AUS A;  3OX9 A;  3CME 3;  1Q82 4;  1RTU A;  3K5T A;  3O8Y A;  1BRH A;  2W56 B;  2CWU A;  4ILF A;  4MMX B;  3CXC 2;  4GHO A;  4LEH A;  1MWU A;  3FG1 A;  1Q81 4;  4ZM8 A;  3IJE B;  1DVD A;  5DRV A;  2M7O A;  4K61 A;  2CFK A;  1BAO A;  1Y4K A;  1BVI A;  2F56 A;  1RGH A;  1YJW 3;  4N3V A;  5I97 A;  2CFD A;  3X3X A;  3HIG A;  1ZX2 A;  3OWU A;  1GMR A;  1GOY A;  2JDI H;  3PZW A;  3EN8 A;  4R9L A;  2L4V A;  3WOF B;  1WQL B;  3N9H A;  4J5G A;  4XBY A;  4OK0 A;  5CXO A;  4HZB B;  1BRI A;  3CCU 3;  5IEO A;  1IU7 A;  3FGY A;  3WOD G;  3NXJ A;  3T8U A;  6STD A;  1EQK A;  4FMB A;  1KC8 4;  3MPH A;  1OHS A;  3WOE B;  3K0Z A;  4NRE A;  1CYV A;  2CX0 A;  3NBR A;  3URP A;  3OWS A;  4HM7 B;  1BNI A;  2WGO A;  5AEW B;  4HZ9 B;  3V99 A;  1K28 A;  3G16 A;  3NX0 A;  3J7Y d;  3DGY A;  5RNT A;  2CWV A;  1O7W B;  1WXX A;  3KSP A;  2AAD A;  3LOY A;  3EX9 A;  1UI8 A;  1EUI C;  4HM3 B;  1KQS 2;  1ULJ B;  3H51 A;  3LZA A;  3BLZ A;  1W7C A;  3KII A;  2K0M A;  3OXA A;  2ZA4 A;  4XBX A;  5HOH A;  1MGR A;  1BSB A;  3DH2 A;  3DY5 A;  3K9M C;  1JBR A;  2ZDJ A;  1BAN A;  2AB4 A;  3NV0 A;  2YX9 A;  1RN1 A;  5TGN A;  5AEU B;  3LWQ A;  1G0T A;  4CI3 B;  2CFG A;  5D83 A;  3GWR A;  4HOH A;  4NPB A;  4XDW A;  1AQZ A;  1JB4 A;  2XFS A;  2ZL8 A;  3PXM A;  3MG1 A;  1N9J A;  2W04 A;  2ZHX B;  3CCQ 3;  1RNB A;  1A2K A;  1W00 A;  1NB3 I;  2B1X B;  5LC7 A;  2P38 A;  4R1K A;  4Q1T A;  3CCV 3;  1LQG C;  8CHO A;  1MOL A;  2XFT A;  2W9Q A;  4EXR A;  1VQK 3;  4FCJ A;  1IVW A;  1RKY A;  2IY2 A;  1M9G A;  1IQY A;  2RFR A;  4HAA A;  3NHX A;  1ZE1 A;  3KZT A;  4H61 A;  2W56 A;  5D82 A;  3S67 A;  1UCK A;  3I56 3;  2CKF B;  4CI1 B;  1M1X B;  1EEJ A;  2GBW B;  1I2F A;  3S28 A;  3MKI A;  1E97 A;  1OF5 B;  1STF I;  3L0R A;  4HM5 B;  2XEP A;  3EN1 B;  3M4X A;  1K8W A;  1ASK A;  1F8N A;  2KF6 A;  3X42 A;  5HGR A;  1FGT A;  4QWT A;  1YHQ 3;  2Z0T A;  1L5G B;  1VQP 3;  4EV5 A;  1MWT A;  2P05 A;  2HMJ B;  3DZL A;  3G6E 3;  5BXQ A;  5CF1 A;  3AHS A;  3F9S A;  2Z6B A;  1GMP A;  3B7C A;  3CU3 A;  4HM4 B;  1BOX A;  3F8H A;  3LWV A;  2IUJ A;  5IEN A;  1QVG 2;  3KE7 A;  3FKA A;  2XGN A;  1YNV X;  1WXW A;  2O3O A;  1BIR A;  1O7M B;  1BNE A;  4FMA A;  3HJW A;  1GOU A;  1OHP A;  3EB8 A;  5STD A;  3VGN A;  1HZ1 A;  3CD6 3;  3G4S 3;  1IVU A;  5M18 A;  3FZW A;  1BRJ A;  1US1 A;  3ROB A;  3CMA 3;  1UOY A;  3U28 A;  4OUQ A;  2APO A;  3BB9 A;  3LWP A;  3LML A;  4WP5 A;  3SOA A;  3M6U A;  4BL3 A;  1VQO 3;  2ML6 A;  1V74 A;  1JV2 B;  3AHW A;  3KFQ C;  1C7H A;  4K1V A;  4DKI A;  1BRG A;  1BUQ A;  3N8B A;  1E3V A;  3D3L A;  1YVB I;  4BU4 A;  3X40 A;  4CDL A;  3CCR 3;  3D4A A;  1TTO A;  3KN4 A;  1N9E A;  1LNH A;  2YFJ B;  3HJY A;  4FMD A;  1R3F A;  1UCI A;  2ML5 A;  1JKG B;  5AI1 A;  1RGA A;  5IG3 A;  1VQM 3;  3QRD A;  2WOH A;  1RJO A;  1X1Y A;  1NWW A;  3HZP A;  2BO9 B;  2W6J H;  4LGQ A;  2XSH B;  2CG0 A;  2F99 A;  3I55 3;  1Q7H A;  1FYS A;  1ULI B;  1IVX A;  2FNQ A;  1OGZ A;  3I0Y A;  3D5I A;  3MG3 A;  4FR9 A;  5EVH A;  1RRH A;  3QK9 A;  1W2B 2;  1K8A 4;  1I0V A;  1WNH A;  3NV0 B;  4RBN A;  3UL6 A;  1BSC A;  2P0X A;  3V92 A;  4AEQ A;  1WTH A;  1TFK A;  1I2G A;  1SII A;  2C11 A;  3CPO A;  1YGW A;  2FXT A;  3MQK A;  4U13 A;  4K1U A;  1W6G A;  1FGQ A;  1W01 A;  5IG4 A;  1ZL3 A;  1DMQ A;  3FH1 A;  1BNR A;  1N8R 4;  1RHL A;  1OF5 A;  1N5H A;  3FF2 A;  4RNY A;  2J5T A;  1W6Y A;  4DMG A;  1VZZ A;  1D6Z A;  1LVN A;  3G71 3;  1RN7 A;  2GXF A;  1GS3 A;  1X1X A;  4STD A;  1VQQ A;  5BIR A;  2E5O A;  1ZE2 A;  1B3S A;  1HYF A;  1I8V A;  3B4O A;  4LSO A;  4Q53 A;  5M1A A;  4EV2 A;  1NNV A;  1KSI A;  2J5V A;  3BNE A;  1FA3 A;  4JRF A;  3PCR A;  2P0M A;  2IUK A;  2KRT A;  2CIU A;  4O3V A;  3G8Z A;  4TX4 A;  1QAF A;  1AV4 A;  2KF4 A;  1VQ9 3;  1W02 A;  1IK3 A;  3CCJ 3;  4EW5 A;  3CC2 3;  3LWR A;  5JPP A;  1JZD A;  1YVS A;  2FGT A;  2XRX B;  2Z7A A;  3NM2 A;  4O02 B;  3OW2 2;  3BIR A;  1FGM A;  3GZB A;  1B2X A;  3VSE A;  1OH0 A;  3DUK A; 
#chains in the Genus database with same CATH homology
 3ALA A;  3EHC A;  5KP3 A;  1AVL A;  2GEX A;  4XBT A;  1D6Y A;  3EE1 A;  3CCE 3;  3JUO A;  2XSO B;  3VSY A;  3PCS A;  4R80 A;  5BVB A;  3NQZ A;  1SQW A;  5FW5 A;  2LQV A;  1IT7 A;  1JKG A;  2R4I A;  5CLK A;  2WOF A;  5AYS C;  2GEY A;  3HK4 A;  3CNX A;  1Q40 B;  4N6M A;  5IF6 A;  2HMK B;  5AIG A;  1IV7 A;  3BNC A;  3FG4 A;  1N8Q A;  5ELJ A;  2YFI B;  5IG0 A;  2CHC A;  1HU9 A;  3N54 B;  2E2V A;  3Q1C A;  4XM4 A;  2B78 A;  2CH9 A;  4G1M B;  4HM8 B;  3SED A;  1K41 A;  1JRQ A;  2IA7 A;  4N6L A;  5KP4 A;  3PS8 A;  2Y74 A;  2HMO B;  2PZV A;  4WWU C;  1OPY A;  3KSE D;  3MWZ A;  2JQ5 A;  4HVN A;  1GD3 A;  4FMC A;  2W03 A;  1NJI 4;  2HML B;  3DMC A;  4LMI A;  3ER7 A;  4KFE A;  4N6T A;  3AMO A;  3NQY A;  4NHF A;  3CNM A;  2W9P A;  5A0O B;  2QIY A;  2K54 A;  4H3U A;  1YIT 3;  1VQL 3;  3LTC A;  4XB5 A;  3MSO A;  3D9R A;  4HKV B;  3CCL 3;  3F14 A;  4MEI A;  4L8P A;  3U97 A;  1J2B A;  4X2O A;  4EYC A;  4KFF A;  2QA4 3;  3K63 A;  5IW9 A;  1TFO A;  1DMN A;  3LTD A;  4FCM A;  1ROV A;  4HM2 B;  1K73 4;  1A90 A;  2B24 B;  3S5C A;  1GYB A;  1YGE A;  1T5Y A;  3LT8 A;  3UL5 A;  5EQL A;  1OCV A;  4R9K A;  1QMA A;  2OTJ 3;  4HJL B;  1IDP A;  4I4K A;  2CW9 A;  2GU3 A;  2CG1 A;  1STD A;  1W6C A;  1OGX A;  1DVC A;  1FGO A;  3OWY A;  4J8T A;  3UAI A;  1KWI A;  1Q86 4;  2OWP A;  2OQE A;  1GY6 A;  1VQ7 3;  2V1L A;  4HM1 B;  5CK6 A;  5D81 A;  4HBR A;  1A2V A;  1U5O A;  2BMR B;  3OV4 A;  3HX8 A;  4KVH A;  5JBS A;  4N6O B;  1Q40 A;  1VQ5 3;  3Q90 A;  3X41 A;  1IQX A;  1W2Z A;  1HKX A;  1R4C A;  4EBG A;  5LC6 A;  3BNB A;  1EKM A;  1O7G B;  5AYR B;  3FLJ A;  3WDG B;  1TU5 A;  1UI7 A;  1GY5 A;  3EC9 A;  4MJD A;  2GBX B;  1JNQ A;  3IPT A;  3DM8 A;  1D6U A;  1UUV B;  4AKY A;  2CWT A;  2F86 B;  2RSX A;  7STD A;  4MMY B;  4RNZ A;  4WFO A;  2D42 A;  1PFP A;  3JUM A;  1AVK A;  4AKZ A;  3D79 A;  2OCT A;  3SOY A;  2INX A;  2E2U A;  1E3R A;  5IEP A;  2XF3 A;  3AMO B;  1IVV A;  2MC8 A;  2D1W A;  3GZR A;  4KFD A;  3CCM 3;  4BTX A;  1NO3 A;  2O9U X;  3EJV A;  4IIA A;  4IPB A;  1IT8 A;  3TDG A;  3SX1 A;  3UB1 A;  3JUQ A;  1FGR A;  2OQE C;  1S5A A;  3C0K A;  2CWW A;  4IT7 A;  1YJ9 3;  3NBB A;  1MNL A;  4L7K A;  1YIJ 3;  2CFW A;  4N6N B;  1Z1S A;  5IG5 A;  1S72 3;  1ROA A;  1TUH A;  3EBY A;  2P09 A;  2F98 A;  5AIH A;  1Q42 A;  1A67 A;  3DGN A;  4R4K A;  3RGR A;  4KZ1 A;  2WGQ A;  2XR8 B;  1RRL A;  4X2H A;  4EC6 A;  3VF1 A;  3V98 A;  3F8X A;  3LDF A;  2CK3 H;  2QGU A;  3K7C A;  1VQN 3;  3DGM A;  3JUN A;  3LH4 A;  3SXX A;  1NDO B;  1W4N A;  3HII A;  3KKG A;  3NBJ A;  4LZI A;  3RDE A;  1VQ6 3;  1QAL A;  5AII A;  1K9M 4;  1CYU A;  3JVC A;  3WMD A;  3F7X A;  4CCV A;  3B4P A;  3M8C A;  2Z77 A;  3X3Z A;  1JB2 A;  5DRE A;  5CF2 A;  5FGO A;  1O7H B;  3CPW 2;  2HMM B;  1TP6 A;  1JB5 A;  4WYK B;  2CC3 A;  1AR0 A;  2RGQ A;  4FCZ A;  1M1K 4;  1LOX A;  1U8C B;  1G96 A;  4BTW A;  3NM7 A;  1SPU A;  3F40 A;  1TIJ A;  1WMN A;  3UNL A;  2XGL A;  2RCD A;  4HM0 B;  3H3H A;  1SIH A;  3T8N A;  3EBT A;  3UJM A;  1LXE A;  1OUN A;  3FF0 A;  1W5Z A;  3SLU A;  3WA2 X;  1JN5 B;  4RZM A;  2XH9 A;  5JPU A;  1UUW B;  1EA2 A;  2BHM A;  3E99 A;  3LT9 A;  2BNG A;  3JUP A;  1IV9 A;  3RGA A;  1WMP A;  3LYG A;  1GY7 A;  2PNC A;  2OTL 3;  2BT3 A;  1YI2 3;  1R3E A;  1OAC A;  2OOV A;  4HM6 B;  3CCS 3;  1OHO A;  1UW1 A;  3DGO A;  3MG2 A;  1QVF 2;  3ECF A;  4J9A A;  3T0U A;  1WMO A;  2E2T A;  2KCD A;  2W0Q A;  4N6V 0;  4PEJ A;  1VQ4 3;  2BMO B;  3PYJ A;  4N6U A;  1ZS7 A;  1DMM A;  3GAX A;  3A76 A;  1VQ8 3;  1CEW I;  1DYU A;  1M90 4;  4JF8 A;  5AIF A;  3WA3 A;  2CX1 A;  2Y73 A;  2UX0 A;  1GD4 A;  1EG9 B;  3DXO A;  4O8S A;  3GZX B;  3MYT A;  4OVM A;  3F7S A;  2IMJ A;  2QEX 3;  3CC4 3;  2W2C A;  4HYZ A;  1KD1 4;  3FCS B;  2Z76 A;  4GB5 A;  5EEO A;  3LTA A;  3EF8 A;  3X3Y A;  2MF7 A;  1N5P A;  3MHE A;  4WYK A;  3S29 A;  2SBL A;  2C10 A;  1ZO2 A;  3EQQ B;  4O2H A;  3PGB A;  1SJW A;  2LYX A;  2WO0 A;  5IER A;  1PU4 A;  3FSD A;  5KP1 A;  1YJN 3;  5ELU A;  3SVA A;  3GZY B;  3S27 A;  4WHA A;  3LXU X;  3NUV A;  4XDV A;  1JN5 A;  2AS0 A;  3B8L A;  1QJG A;  1FUW A;  1JJ2 2;  1NU3 A;  4L8O A;  2OOV C;  2YFL B;  1SGV A;  3STD A;  3HI7 A;  4GL6 A;  2Q07 A;  2HMN B;  3GRD A;  3CC7 3;  2CFL A;  4BTY A;  1ISK A;  3Q2P A;  3G0K A;  1O7P B;  1IQ8 A;  3FG3 A;  3LTB A;  4K90 B;  1QAK A;  3IMA B;  5G2G A;  3BND A;  1Q7Y 4;  1NB5 I;  1O7N B;  2A15 A;  2GU1 A;  2KXG A;  2STD A;  3DGL A;  4ORL A;  1CQS A;  4MMZ B;  2BMQ B;  2I9W A;  3OX9 A;  3CME 3;  1Q82 4;  3K5T A;  3O8Y A;  2W56 B;  2CWU A;  4MMX B;  3CXC 2;  4LEH A;  3FG1 A;  1Q81 4;  4ZM8 A;  3IJE B;  1DVD A;  5DRV A;  2M7O A;  4K61 A;  2CFK A;  1Y4K A;  1YJW 3;  4N3V A;  5I97 A;  2CFD A;  3X3X A;  3HIG A;  1ZX2 A;  3OWU A;  2JDI H;  3PZW A;  3EN8 A;  4R9L A;  2L4V A;  3WOF B;  1WQL B;  3N9H A;  4XBY A;  5CXO A;  4OK0 A;  4HZB B;  3CCU 3;  5IEO A;  1IU7 A;  3FGY A;  3WOD G;  3NXJ A;  3T8U A;  6STD A;  1EQK A;  4FMB A;  1KC8 4;  3MPH A;  1OHS A;  3WOE B;  3K0Z A;  4NRE A;  1CYV A;  2CX0 A;  3NBR A;  3OWS A;  4HM7 B;  2WGO A;  5AEW B;  4HZ9 B;  3V99 A;  1K28 A;  3G16 A;  3NX0 A;  3J7Y d;  2CWV A;  1O7W B;  1WXX A;  3KSP A;  3LOY A;  3EX9 A;  1UI8 A;  4HM3 B;  1KQS 2;  1ULJ B;  3H51 A;  3LZA A;  3BLZ A;  1W7C A;  3KII A;  2K0M A;  3OXA A;  4XBX A;  3DY5 A;  3K9M C;  2ZDJ A;  2AB4 A;  3NV0 A;  2YX9 A;  5TGN A;  5AEU B;  2CFG A;  5D83 A;  3GWR A;  4XDW A;  1JB4 A;  2XFS A;  2ZL8 A;  3PXM A;  3MG1 A;  1N9J A;  2W04 A;  3CCQ 3;  1A2K A;  1W00 A;  1NB3 I;  2B1X B;  5LC7 A;  2P38 A;  4R1K A;  4Q1T A;  3CCV 3;  8CHO A;  1MOL A;  2XFT A;  2W9Q A;  4EXR A;  1VQK 3;  4FCJ A;  1IVW A;  1RKY A;  2RFR A;  1M9G A;  1IQY A;  3S67 A;  3NHX A;  1ZE1 A;  3KZT A;  4H61 A;  2W56 A;  5D82 A;  3I56 3;  2CKF B;  1M1X B;  2GBW B;  3S28 A;  3MKI A;  1E97 A;  1OF5 B;  1STF I;  3L0R A;  4HM5 B;  2XEP A;  3EN1 B;  1K8W A;  1ASK A;  1F8N A;  3X42 A;  1YHQ 3;  5HGR A;  1FGT A;  4QWT A;  1L5G B;  1VQP 3;  4EV5 A;  2P05 A;  3DZL A;  2HMJ B;  3G6E 3;  5BXQ A;  5CF1 A;  3F9S A;  2Z6B A;  3B7C A;  3CU3 A;  4HM4 B;  2IUJ A;  3F8H A;  5IEN A;  1QVG 2;  3KE7 A;  3FKA A;  2XGN A;  2O3O A;  1WXW A;  1O7M B;  4FMA A;  1OHP A;  3EB8 A;  5STD A;  3VGN A;  3CD6 3;  3G4S 3;  1IVU A;  3FZW A;  1US1 A;  3ROB A;  3CMA 3;  4OUQ A;  3BB9 A;  3LML A;  4WP5 A;  3SOA A;  1VQO 3;  2ML6 A;  1V74 A;  1JV2 B;  3KFQ C;  4K1V A;  1C7H A;  1BUQ A;  3N8B A;  1E3V A;  3D3L A;  1YVB I;  3CCR 3;  3X40 A;  4CDL A;  3KN4 A;  1N9E A;  1LNH A;  2YFJ B;  4FMD A;  3U1W A;  1R3F A;  2ML5 A;  5AI1 A;  1JKG B;  5IG3 A;  1VQM 3;  3QRD A;  2WOH A;  1RJO A;  1NWW A;  3HZP A;  2BO9 B;  2W6J H;  4LGQ A;  2XSH B;  2CG0 A;  2F99 A;  3I55 3;  1Q7H A;  1ULI B;  1IVX A;  2FNQ A;  1OGZ A;  3I0Y A;  3MG3 A;  4FR9 A;  5EVH A;  1W2B 2;  1RRH A;  3QK9 A;  1K8A 4;  1WNH A;  3NV0 B;  4RBN A;  3UL6 A;  2P0X A;  3V92 A;  4AEQ A;  1WTH A;  1TFK A;  1SII A;  2C11 A;  3CPO A;  2FXT A;  4U13 A;  5IG4 A;  4K1U A;  1W6G A;  1FGQ A;  1W01 A;  1ZL3 A;  1DMQ A;  3FH1 A;  1N8R 4;  1OF5 A;  1N5H A;  3FF2 A;  4RNY A;  2J5T A;  1W6Y A;  4DMG A;  1VZZ A;  1D6Z A;  1LVN A;  3G71 3;  1RN7 A;  2GXF A;  1GS3 A;  4STD A;  4Q53 A;  1ZE2 A;  4LSO A;  3B4O A;  4EV2 A;  1KSI A;  2J5V A;  3BNE A;  1FA3 A;  4JRF A;  3PCR A;  2P0M A;  2IUK A;  2KRT A;  2CIU A;  4O3V A;  3G8Z A;  4TX4 A;  1QAF A;  1AV4 A;  1VQ9 3;  1W02 A;  1IK3 A;  3CCJ 3;  3CC2 3;  5JPP A;  2FGT A;  2XRX B;  2Z7A A;  3NM2 A;  4O02 B;  3OW2 2;  1FGM A;  3GZB A;  3VSE A;  1OH0 A;  3DUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...