3ZV0C

Structure of the shq1p-cbf5p complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
161
structure length
152
Chain Sequence
SEWPLLLKNFDKLLVRSGSPLKRDLKSYISSGPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELYDEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRWGLGPVAQKKKQMKADGKLDKYGRVNEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords PROTEIN SHQ1
publication title The H/Aca Rnp Assembly Factor Shq1 Functions as an RNA Mimic.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 152
sequence length 161
chains with identical sequence D
ec nomenclature ec 5.4.99.-:
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01472 PUA PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3zv0C01
2AUSA 3LWQA 2EY4A 3LWRA 3U28A 3LWVA 3HAXA 3HJWA 3MQKA 2HVYA 3LWPA 2RFKA 3ZV0C 3LWOA 2APOA 3HJYA
chains in the Genus database with same CATH superfamily
3M6WA 1WXWA 2CWWA 4DMGA 3C0KA 3LJCA 2E5OA 1ZL3A 1K8WA 2HVYA 1ZE2A 1J2BA 1IQ8A 1ZBOA 3LWPA 2AUSA 2J5TA 2J5VA 4Q1TA 3HJWA 1UOYA 3VSEA 1ZS7A 2EY4A 1IT7A 3U28A 2AB4A 4CI2B 1SGVA 2P38A 3M65A 1R3FA 2B78A 1XNEA 2CX0A 2FRXA 3LDFA 1WK2A 2Z0TA 1IT8A 3M6UA 3M6XA 3ZV0C 3LWOA 3HJYA 1SQWA 3LWVA 2AS0A 3HAXA 2DP9A 3MQKA 2ANEA 2KKUA 4TZ4C 2CX1A 2RFKA 1ZE1A 3IUWA 2APOA 1TE7A 1R3EA 3LWQA 4CI1B 3LWRA 1WXXA 3D79A 2Q07A 3M4XA 3M6VA 4CI3B 3UAIA 1S04A 1T5YA 1Q7HA
chains in the Genus database with same CATH topology
3M6WA 2HVYA 3LWPA 3HJWA 2AUSA 1UOYA 2EY4A 3U28A 3ZV0C 2FRXA 3LWOA 3HJYA 3M6UA 3M6XA 3LWVA 3HAXA 3MQKA 2RFKA 2APOA 3LWQA 3LWRA 3M4XA 3M6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUS A;  3LWQ A;  2EY4 A;  3LWR A;  3U28 A;  3LWV A;  3HAX A;  3HJW A;  3MQK A;  2HVY A;  3LWP A;  2RFK A;  3ZV0 C;  3LWO A;  2APO A;  3HJY A; 
#chains in the Genus database with same CATH topology
 3M6W A;  1WXW A;  2CWW A;  4DMG A;  3C0K A;  3LJC A;  2E5O A;  1ZL3 A;  1K8W A;  2HVY A;  1ZE2 A;  1J2B A;  1IQ8 A;  1ZBO A;  3LWP A;  2AUS A;  2J5T A;  2J5V A;  4Q1T A;  3HJW A;  1UOY A;  3VSE A;  1ZS7 A;  2EY4 A;  1IT7 A;  3U28 A;  2AB4 A;  4CI2 B;  1SGV A;  2P38 A;  3M65 A;  1R3F A;  2B78 A;  1XNE A;  2CX0 A;  2FRX A;  3LDF A;  1WK2 A;  2Z0T A;  1IT8 A;  3M6U A;  3M6X A;  3ZV0 C;  3LWO A;  3HJY A;  1SQW A;  3LWV A;  2AS0 A;  3HAX A;  2DP9 A;  3MQK A;  2ANE A;  2KKU A;  4TZ4 C;  2CX1 A;  2RFK A;  1ZE1 A;  3IUW A;  2APO A;  1TE7 A;  1R3E A;  3LWQ A;  4CI1 B;  3LWR A;  1WXX A;  3D79 A;  2Q07 A;  3M4X A;  3M6V A;  4CI3 B;  3UAI A;  1S04 A;  1T5Y A;  1Q7H A; 
#chains in the Genus database with same CATH homology
 3M6W A;  2HVY A;  3LWP A;  3HJW A;  2AUS A;  1UOY A;  2EY4 A;  3U28 A;  3ZV0 C;  2FRX A;  3LWO A;  3HJY A;  3M6U A;  3M6X A;  3LWV A;  3HAX A;  3MQK A;  2RFK A;  2APO A;  3LWQ A;  3LWR A;  3M4X A;  3M6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...