3ZV0C

Structure of the shq1p-cbf5p complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
161
structure length
152
Chain Sequence
SEWPLLLKNFDKLLVRSGSPLKRDLKSYISSGPLETLLVGYKRIVVKDSAVNAVCYGAKLMIPGLLRYEEGIELYDEIVLITTKGEAIAVAIAQMSTVDLASCDHGVVASVKRCIMERDLYPRRWGLGPVAQKKKQMKADGKLDKYGRVNEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN SHQ1
publication title The H/Aca Rnp Assembly Factor Shq1 Functions as an RNA Mimic.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 33
structure length 152
sequence length 161
chains with identical sequence D
ec nomenclature ec 5.4.99.-:
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01472 PUA PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3zv0C01
2HVYA 2RFKA 2APOA 3LWPA 3HAXA 3MQKA 3LWVA 2AUSA 3ZV0C 3LWRA 3HJWA 3HJYA 2EY4A 3LWQA 3LWOA 3U28A
chains in the Genus database with same CATH superfamily
2Q07A 3UAIA 2RFKA 3MQKA 2CWWA 3LDFA 3M6VA 3VSEA 2ANEA 2CX1A 3LWQA 1ZL3A 3M6WA 1SQWA 1ZS7A 3HJWA 2FRXA 3C0KA 2KKUA 3U28A 2DP9A 3LWOA 1J2BA 1WXWA 2J5TA 3M4XA 3D79A 3LJCA 4CI3B 4CI1B 1K8WA 3M65A 4Q1TA 2E5OA 1SGVA 2J5VA 2HVYA 1IT8A 3IUWA 1T5YA 1UOYA 3LWRA 3HJYA 3M6UA 2Z0TA 1IQ8A 1S04A 1WXXA 1XNEA 2B78A 1R3EA 4DMGA 2APOA 2AS0A 1ZE1A 2CX0A 3LWPA 4TZ4C 3M6XA 2AUSA 1Q7HA 3LWVA 1TE7A 2P38A 3ZV0C 1IT7A 1R3FA 2EY4A 1ZBOA 2AB4A 4CI2B 1WK2A 1ZE2A 3HAXA
chains in the Genus database with same CATH topology
2RFKA 3MQKA 3M6VA 3HJWA 2FRXA 3LWOA 3U28A 3M4XA 2HVYA 1UOYA 3LWRA 3HJYA 3M6UA 2APOA 3LWPA 3LWVA 3M6XA 2AUSA 3ZV0C 2EY4A 3LWQA 3M6WA 3HAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVY A;  2RFK A;  2APO A;  3LWP A;  3HAX A;  3MQK A;  3LWV A;  2AUS A;  3ZV0 C;  3LWR A;  3HJW A;  3HJY A;  2EY4 A;  3LWQ A;  3LWO A;  3U28 A; 
#chains in the Genus database with same CATH topology
 2Q07 A;  3UAI A;  2RFK A;  3MQK A;  2CWW A;  3LDF A;  3M6V A;  3VSE A;  2ANE A;  2CX1 A;  3LWQ A;  1ZL3 A;  3M6W A;  1SQW A;  1ZS7 A;  3HJW A;  2FRX A;  3C0K A;  2KKU A;  3U28 A;  2DP9 A;  3LWO A;  1J2B A;  1WXW A;  2J5T A;  3M4X A;  3D79 A;  3LJC A;  4CI3 B;  4CI1 B;  1K8W A;  3M65 A;  4Q1T A;  2E5O A;  1SGV A;  2J5V A;  2HVY A;  1IT8 A;  3IUW A;  1T5Y A;  1UOY A;  3LWR A;  3HJY A;  3M6U A;  2Z0T A;  1IQ8 A;  1S04 A;  1WXX A;  1XNE A;  2B78 A;  1R3E A;  4DMG A;  2APO A;  2AS0 A;  1ZE1 A;  2CX0 A;  3LWP A;  4TZ4 C;  3M6X A;  2AUS A;  1Q7H A;  3LWV A;  1TE7 A;  2P38 A;  3ZV0 C;  1IT7 A;  1R3F A;  2EY4 A;  1ZBO A;  2AB4 A;  4CI2 B;  1WK2 A;  1ZE2 A;  3HAX A; 
#chains in the Genus database with same CATH homology
 2RFK A;  3MQK A;  3M6V A;  3HJW A;  2FRX A;  3LWO A;  3U28 A;  3M4X A;  2HVY A;  1UOY A;  3LWR A;  3HJY A;  3M6U A;  2APO A;  3LWP A;  3LWV A;  3M6X A;  2AUS A;  3ZV0 C;  2EY4 A;  3LWQ A;  3M6W A;  3HAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...