1TE7A

Solution nmr structure of protein yqfb from escherichia coli. northeast structural genomics consortium target et99
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
103
structure length
103
Chain Sequence
MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFEDDGYFCTIEVTATSTVTLDTLTEKHAEQENMTLTELKKVIADIYPGQTQFYVIEFKCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0267 protein yqfB
publication title G-Matrix Fourier Transform NOESY-Based Protocol for High-Quality Protein Structure Determination
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 17
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 1te7A00
1S04A 1WK2A 2E5OA 1XNEA 2Z0TA 1TE7A 2DP9A 3IUWA 2KKUA
chains in the Genus database with same CATH superfamily
2EY4A 1R3EA 1WK2A 3M6VA 2CWWA 3HAXA 1ZS7A 3LWPA 2Q07A 3VSEA 1SQWA 3LWVA 4DMGA 2Z0TA 1UOYA 2HVYA 2RFKA 1TE7A 3UAIA 3M65A 3M6WA 3HJYA 1WXWA 2KKUA 1IT7A 3IUWA 1ZL3A 2AUSA 1ZE2A 2FRXA 3LDFA 3D79A 1K8WA 1IT8A 2J5VA 1WXXA 3U28A 2DP9A 3M6UA 2B78A 1S04A 1R3FA 1ZBOA 2CX0A 2P38A 3LWRA 2ANEA 2APOA 4CI2B 3M4XA 1XNEA 2AB4A 4TZ4C 2CX1A 3M6XA 3LWQA 4CI1B 1ZE1A 1SGVA 4Q1TA 1IQ8A 3C0KA 2E5OA 4CI3B 3LWOA 2AS0A 3ZV0C 1T5YA 1Q7HA 3HJWA 1J2BA 3LJCA 2J5TA 3MQKA
chains in the Genus database with same CATH topology
1S04A 1WK2A 4P78C 1WHZA 2E5OA 4C26A 1XNEA 2Z0TA 1TE7A 2DP9A 3IUWA 2KKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S04 A;  1WK2 A;  2E5O A;  1XNE A;  2Z0T A;  1TE7 A;  2DP9 A;  3IUW A;  2KKU A; 
#chains in the Genus database with same CATH topology
 2EY4 A;  1R3E A;  1WK2 A;  3M6V A;  2CWW A;  3HAX A;  1ZS7 A;  3LWP A;  2Q07 A;  3VSE A;  1SQW A;  3LWV A;  4DMG A;  2Z0T A;  1UOY A;  2HVY A;  2RFK A;  1TE7 A;  3UAI A;  3M65 A;  3M6W A;  3HJY A;  1WXW A;  2KKU A;  1IT7 A;  3IUW A;  1ZL3 A;  2AUS A;  1ZE2 A;  2FRX A;  3LDF A;  3D79 A;  1K8W A;  1IT8 A;  2J5V A;  1WXX A;  3U28 A;  2DP9 A;  3M6U A;  2B78 A;  1S04 A;  1R3F A;  1ZBO A;  2CX0 A;  2P38 A;  3LWR A;  2ANE A;  2APO A;  4CI2 B;  3M4X A;  1XNE A;  2AB4 A;  4TZ4 C;  2CX1 A;  3M6X A;  3LWQ A;  4CI1 B;  1ZE1 A;  1SGV A;  4Q1T A;  1IQ8 A;  3C0K A;  2E5O A;  4CI3 B;  3LWO A;  2AS0 A;  3ZV0 C;  1T5Y A;  1Q7H A;  3HJW A;  1J2B A;  3LJC A;  2J5T A;  3MQK A; 
#chains in the Genus database with same CATH homology
 1S04 A;  1WK2 A;  4P78 C;  1WHZ A;  2E5O A;  4C26 A;  1XNE A;  2Z0T A;  1TE7 A;  2DP9 A;  3IUW A;  2KKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...