1TE7A

Solution nmr structure of protein yqfb from escherichia coli. northeast structural genomics consortium target et99
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
103
structure length
103
Chain Sequence
b'MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFEDDGYFCTIEVTATSTVTLDTLTEKHAEQENMTLTELKKVIADIYPGQTQFYVIEFKCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical UPF0267 protein yqfB
publication title G-Matrix Fourier Transform NOESY-Based Protocol for High-Quality Protein Structure Determination
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 17
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2004-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 1te7A00
2DP9A 1WK2A 2E5OA 2KKUA 1TE7A 2Z0TA 3IUWA 1S04A 1XNEA
chains in the Genus database with same CATH superfamily
1ZL3A 3VSEA 3UAIA 3HAXA 1WXXA 4Q1TA 1WXWA 3HJWA 3HJYA 2Z0TA 3M4XA 3M6XA 2J5VA 2CWWA 3M65A 1ZBOA 1J2BA 3LWPA 3MQKA 1ZE2A 1IT8A 2B78A 2AB4A 3LJCA 1IT7A 1TE7A 3U28A 2HVYA 2APOA 3LWOA 3M6WA 3LWVA 1XNEA 2J5TA 4CI3B 3LWQA 2CX0A 2FRXA 2AS0A 2DP9A 2E5OA 2EY4A 2P38A 3M6UA 1Q7HA 3ZV0C 1R3EA 4CI2B 3LWRA 1WK2A 1UOYA 2KKUA 1SGVA 3C0KA 3M6VA 1ZS7A 4TZ4C 1SQWA 2Q07A 1R3FA 1T5YA 2CX1A 1IQ8A 3LDFA 1K8WA 2ANEA 2AUSA 3D79A 4DMGA 3IUWA 4CI1B 1S04A 2RFKA 1ZE1A
chains in the Genus database with same CATH topology
1WHZA 1WK2A 2DP9A 2E5OA 2KKUA 4C26A 4P78C 1TE7A 2Z0TA 3IUWA 1S04A 1XNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DP9 A;  1WK2 A;  2E5O A;  2KKU A;  1TE7 A;  2Z0T A;  3IUW A;  1S04 A;  1XNE A; 
#chains in the Genus database with same CATH topology
 1ZL3 A;  3VSE A;  3UAI A;  3HAX A;  1WXX A;  4Q1T A;  1WXW A;  3HJW A;  3HJY A;  2Z0T A;  3M4X A;  3M6X A;  2J5V A;  2CWW A;  3M65 A;  1ZBO A;  1J2B A;  3LWP A;  3MQK A;  1ZE2 A;  1IT8 A;  2B78 A;  2AB4 A;  3LJC A;  1IT7 A;  1TE7 A;  3U28 A;  2HVY A;  2APO A;  3LWO A;  3M6W A;  3LWV A;  1XNE A;  2J5T A;  4CI3 B;  3LWQ A;  2CX0 A;  2FRX A;  2AS0 A;  2DP9 A;  2E5O A;  2EY4 A;  2P38 A;  3M6U A;  1Q7H A;  3ZV0 C;  1R3E A;  4CI2 B;  3LWR A;  1WK2 A;  1UOY A;  2KKU A;  1SGV A;  3C0K A;  3M6V A;  1ZS7 A;  4TZ4 C;  1SQW A;  2Q07 A;  1R3F A;  1T5Y A;  2CX1 A;  1IQ8 A;  3LDF A;  1K8W A;  2ANE A;  2AUS A;  3D79 A;  4DMG A;  3IUW A;  4CI1 B;  1S04 A;  2RFK A;  1ZE1 A; 
#chains in the Genus database with same CATH homology
 1WHZ A;  1WK2 A;  2DP9 A;  2E5O A;  2KKU A;  4C26 A;  4P78 C;  1TE7 A;  2Z0T A;  3IUW A;  1S04 A;  1XNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...