1ZS7A

The structure of gene product ape0525 from aeropyrum pernix
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
187
structure length
187
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGKRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein APE0525
publication title The structure of gene product APE0525 from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
total genus 51
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1zs7A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1zs7A01
2B78A 1IT8A 4DMGA 1R3EA 2P38A 3D79A 2Q07A 1ZE1A 1WXXA 1IT7A 3C0KA 3LDFA 1ZL3A 1K8WA 2J5VA 1ZS7A 3UAIA 1Q7HA 1T5YA 2CX0A 2AB4A 2AS0A 2CX1A 1IQ8A 4Q1TA 2J5TA 1R3FA 3VSEA 1WXWA 1SGVA 1ZE2A 1J2BA 1SQWA 2CWWA
chains in the Genus database with same CATH superfamily
1UUWB 3PYJA 1O7GB 1S5AA 3G16A 1UCLA 2F5WA 2XRXB 3LWQA 3OV4A 2MC8A 4FMAA 1I2FA 2AADA 5BVBA 1RDSA 1O7MB 2M7OA 3FF0A 3JVCA 2OQEC 4EV5A 8CHOA 1BUQA 3KZTA 3B4PA 4N3VA 3RDEA 3X3XA 3ROBA 4CCVA 3DY5A 1TU5A 1AQZA 4R1KA 4RBNA 4I5QA 6STDA 1UOYA 4RNTA 3MG3A 1FGTA 3HJYA 1JNQA 4N6OB 4DKIA 4KFFA 3HIIA 3SYUA 3MG1A 3A76A 4EC6A 1BSEA 1OCVA 1X1UA 3EBYA 2IUKA 4KVHA 1NWWA 1ULIB 1J2BA 1HZ1A 2XSOB 2BMRB 1SQWA 1FW7A 1W6YA 5LC7A 1I0XA 3FCSB 1N9EA 3CCU3 1RNBA 3SXXA 1OACA 3GAXA 4MMZB 1FUTA 3KFQC 2HMKB 3D5GA 1OHSA 2HOHA 4XBXA 1O7WB 1IT7A 1JKGB 3L0RA 1ZL3A 4FMBA 2GXFA 1SPUA 4KZ1A 1NO3A 4L8OA 1GOVA 4J5KA 5AYSC 3CCE3 2QGUA 1B2ZA 1YVSA 3F8HA 1RHLA 1KD14 3DUKA 4K1UA 1N5HA 5KP1A 1ZO2A 1SARA 3CCV3 1BSCA 2XGLA 3Q2PA 1DYUA 1Y4KA 2KF4A 1GD3A 1YGWA 1JV2B 2KAAA 2CWWA 3Q3FA 4LZIA 1Q42A 1A2VA 4HYZA 3KE7A 3X41A 4O2HA 1A2PA 1QAFA 1UGIA 1LRAA 1SIHA 1HKXA 5M1AA 3K7CA 3OXAA 4ORLA 4XBTA 1ZE1A 2J8XB 1RTUA 3HZPA 2P0MA 3LWRA 2H0GA 3ZG5A 5CF2A 1VQN3 1NNVA 3LWVA 4CI1B 4HM8B 1UGHI 1B27A 2W0QA 1NJI4 2HVYA 1IDPA 2W03A 3S29A 1OGXA 1M1XB 2CFWA 4XB5A 1O7NB 5CK6A 2F98A 1ISKA 3CMA3 2AS0A 4KFDA 2CX1A 1GOYA 4HM4B 1NB5I 1UUGB 3AMOB 1DMNA 3S28A 1MWTA 2CWVA 3GZYB 3EX9A 1TRQA 1JRQA 2O3OA 5D82A 4AKZA 1D6YA 2OTJ3 7STDA 1G02A 1W2B2 2YX9A 1IVVA 3NBBA 3B4OA 4RNYA 5D81A 3BIRA 4HOHA 2CFKA 2CKFB 1I3IA 1I2GA 1JN5B 1C7HA 2CFLA 1PU4A 3KIIA 4NREA 1WXXA 1OF5B 1W00A 1VZZA 1W6GA 1X1XA 2ML5A 1YJW3 3CPOA 5A0OB 3CME3 3KN4A 4GSPA 5RNTA 1W6CA 3G0KA 2W56B 3PXMA 4LSOA 5IEPA 2Z6BA 4FCMA 1VQ73 1M1K4 3I563 4H61A 3V99A 2RBIA 1RLSA 3KKGA 1JN5A 5AI1A 4HZ9B 1RNTA 1MGRA 1TRPA 3AHSA 2R41A 1BANA 5STDA 5IW9A 1I3FA 3CCL3 3DGOA 3LT8A 4HM1B 3U1WA 1VQ83 1BRKA 8RNTA 1CEWI 3T0UA 1BU4A 3LMLA 4HZBB 1TJDA 2P38A 5BU4A 3CCJ3 1M9GA 1IV7A 4WYKB 4BTXA 2GEYA 1KC84 1RGKA 3DMCA 4R4KA 5IG3A 1B2MA 4XM4A 1LNHA 2XEPA 5GSPA 3M65A 1RGEA 2CHCA 1V74A 3M6WA 3DM8A 3EQQB 3SLUA 5CXOA 1YJ93 1JBRA 5EQLA 2KF5A 3BNEA 3SOAA 1RN4A 1OHPA 1FYSA 3ZG0A 2STDA 3GRDA 4HKVB 1ASKA 2PNCA 1LXEA 2CFDA 2CW9A 4EW5A 3CPW2 1DVDA 1BNGA 4ZM8A 2C11A 1K28A 1I0VA 3T8NA 2P09A 5AYRB 1N9JA 2OQEA 1LQMB 3I0YA 1ZBOA 3NV0A 1B2SA 3EB8A 5AIHA 1RN1A 1W2ZA 6RNTA 3LTAA 2QA43 4GL6A 1KQS2 3M6VA 1PY3A 1Z1SA 2CG1A 3S5CA 1V57A 4BTYA 1T2HA 3N8BA 2OTL3 2DP9A 1YNVX 1TP6A 2GEXA 2PZVA 3EE1A 2CX0A 2KCDA 3MQKA 2RFRA 3DGMA 3ALAA 3NM7A 4TX4A 3M6UA 3GZBA 4X2HA 1HU9A 3FGYA 4WFOA 3I553 1W7CA 2F56A 3GWRA 1NU3A 1WTHA 1BNFA 3JUQA 4HM0B 2KF3A 4OK0A 1LQGC 4CI3B 2WOHA 2Z7AA 4STDA 3M8CA 3CCR3 1UW1A 1C54A 5IEOA 1GS3A 1GOUA 1N8QA 2KKUA 1BNJA 3JUPA 4EXRA 3DH2A 5HOHA 5D83A 1GMQA 1N8R4 3LTBA 1GSPA 3M6XA 1XNEA 1OH0A 2IMJA 3F7SA 4KFEA 3WODG 3C0KA 1GYBA 3A5EA 1TE7A 1YHQ3 3WR2A 1GY6A 1BOXA 3K63A 1U5OA 2IA7A 2SARA 4R80A 2B24B 2Z0TA 5DREA 1SJWA 2QEX3 1FGOA 4PEJA 4HM7B 2ZHXB 4MMXB 3IUWA 2LYXA 2ZA4A 3PGBA 1IV9A 1EG9B 1BSBA 1LNIA 1STDA 5BIRA 3G713 3HAXA 1D6ZA 1OHOA 2WGQA 2HMMB 3QRDA 2B1XB 4ILFA 2WOFA 1AR0A 1JKGA 5TGNA 1LOVA 3F40A 1GY7A 3F8XA 1QVG2 3AHWA 5IG4A 1FUWA 4CPKA 1ZGXA 3CCM3 2C10A 2P05A 3JUOA 3LWPA 2W04A 4HAAA 4HM2B 4CI2B 1TFKA 3SOYA 3WA2X 2GSPA 3AGOA 1CYVA 1BNSA 3LH4A 4LMIA 5JPPA 3KSPA 1BUJA 3VSEA 5IF6A 1IVXA 3OW22 2I9WA 1IYYA 1KSIA 3DGYA 1VQ53 3KCHA 5ELJA 3VGNA 1VQO3 3S27A 3X40A 3LOYA 4MJDA 1WMOA 3UJMA 1UCJA 1VQQA 4FMDA 1MGWA 4N6UA 5AIFA 2KF6A 2MF7A 2HMOB 3EBTA 2APOA 1GY5A 1NB3I 1K8A4 7RNTA 1VQP3 1IQYA 1B3SA 1BRHA 3MPHA 3WOEB 3CD63 2RGQA 2UX0A 1LOXA 3DXOA 1K41A 3NBJA 4HVNA 4BU4A 3AMOA 1ZS7A 3EJVA 4HJLB 3UB1A 5M19A 3CCQ3 5AEWB 4N6MA 2HMNB 2JQ5A 2XR8B 3SEDA 2FGTA 1VQ63 1IQ8A 1HYFA 1K9M4 1N5PA 3D3LA 4WHAA 4NPBA 1RGGA 3FKAA 3WOFB 1RGHA 1BGSA 1R4CA 3K9MC 4OUQA 3J7Yd 1Q7Y4 2A15A 3NHXA 3MYTA 9RNTA 2FNQA 1F8NA 3LJCA 4R9KA 4FCJA 4K1VA 1OF5A 5BXQA 1BSDA 1PFPA 1QALA 1IT8A 3RGRA 2BHMA 1E97A 2YFIB 3GZRA 4GHOA 4HM3B 3F7XA 3D79A 1RN7A 4O8SA 2Z77A 1VQ93 1RKYA 1QVF2 3LWOA 4O02B 4XDWA 2W56A 1O7HB 2GBWB 2YFJB 2JDIH 4WWUC 1RRHA 2XFTA 3PCRA 2V1LA 3BB9A 3F9SA 5HGRA 1E3VA 1OUNA 2CH9A 2CFGA 2CWUA 2ML6A 5FGOA 1Q7HA 1T5YA 1TIJA 2OOVC 1CH0A 2C4BA 4WP5A 2F4YA 3B8LA 1L5GB 1DVCA 1AV4A 1KWIA 4Q1TA 3LZAA 2HMJB 4J5GA 1YI23 2F99A 1RCLA 3CU3A 1WNHA 3FG1A 3CXC2 1JZOA 1ULJB 1AVLA 4G1MB 1IK3A 4IPBA 3EN1B 3WDGB 4RNZA 3FZWA 1VQM3 3EF8A 1Q9EA 5IENA 1R3FA 3LTDA 3FLJA 1S723 4WYKA 4BIRA 1RMSA 3WMDA 3CC73 2B78A 1BNRA 3STDA 3DGNA 2K0MA 5KP3A 2Q07A 2RFKA 3CCS3 1IQXA 3K5TA 3G4S3 4FMCA 2K3DA 3O8YA 1FA3A 2OCTA 2Y74A 4FCZA 4LEHA 2LQVA 2BMOB 5G2GA 2CIUA 3N54B 2E5OA 2IUJA 4AEQA 1BRNL 1G0TA 1MWRA 5AEUB 3G6E3 3V98A 3Q90A 4HBRA 2W6JH 1DETA 1B2UA 1RCKA 4K61A 5EVHA 1WXWA 1SGVA 1ZE2A 1X1WA 1GD4A 1SIIA 1BSAA 3UL6A 1AY7A 1WMNA 1U8CB 2BMQB 3FG4A 1AVKA 1UI8A 1WQLB 1UCIA 4IIAA 3FH1A 1BAOA 5FW5A 3MWZA 4CJNA 4LYLB 3Q1CA 3N9HA 1R3EA 4BTWA 4FR9A 1B20A 2O9UX 1STFI 1YIJ3 1FGMA 3IPTA 2BT3A 1QAKA 1S04A 4HM5B 2W9PA 3FF2A 7GSPA 3NX0A 5CF1A 3T8UA 4JRFA 1T2IA 1LVNA 2L1SA 4K90B 1BNEA 3EHCA 5IG5A 2R4IA 3OWUA 4EV2A 3ZFZA 1WMPA 6GSPA 1UUVB 3VSYA 1EUIC 3NQZA 1W02A 3NUVA 3EN8A 4H3UA 1FUSA 1ZX2A 2YFLB 3FSDA 5EEOA 4AKYA 1O7PB 3SVAA 2BIRA 2GU1A 4EYCA 1MNLA 2D42A 1MOLA 3TDGA 4N6NB 3G8ZA 5G1LA 4MMYB 4BL3A 4DMGA 2L4VA 2SBLA 3HI7A 4L7KA 4Q53A 3NXJA 2XH9A 3HJWA 4TZ4C 3BU4A 4L8PA 1GMRA 5ELUA 3V92A 3DZLA 2ZDJA 1UDII 3ZV0C 1FZUA 1R4YA 5CLKA 4N6V0 1FGQA 2J5VA 1W5ZA 3B7CA 3KSED 3JUMA 5AIGA 3X42A 1MWUA 3H3HA 2WO0A 2BNGA 4R9LA 3E99A 2J5TA 3X3YA 3HK4A 1LOWA 3JUNA 3BNBA 3K0ZA 2W9QA 3PS8A 3FG3A 3D5IA 5M18A 3AGNA 2AAEA 1YIT3 3BNDA 1GMPA 1RGLA 4XBYA 2CK3H 3NQYA 4QWTA 2OWPA 1BVIA 2RNTA 1RGAA 2K54A 1QMAA 2CG0A 3MKIA 2RCDA 3CNMA 2E2VA 4EBGA 3X3ZA 1DE3A 2F5MA 3IJEB 3D9RA 1US1A 2BU4A 3WA3A 1CYUA 1PYLA 3LDFA 3HX8A 1K8WA 4XDVA 1JB2A 1YGEA 3UL5A 1JBTA 1CQSA 5AIIA 3CC43 2QIYA 1X1YA 2AB4A 3MHEA 2GBXB 5DRVA 2IY2A 4J8TA 2E2UA 1MWSA 1E3RA 1UCKA 2BO9B 1RJOA 2H0HA 3MSOA 4MEIA 1VQL3 3VF1A 1EQKA 5JPUA 3U28A 4O3VA 4OVMA 1TUHA 4I4KA 3LXUX 5IG0A 4BL2A 4GB5A 1K734 1FGRA 3GSPA 5IERA 2FRXA 2IYJA 3NM2A 1UI7A 2E2TA 3BLZA 3U97A 3RGAA 2ZL8A 4LGQA 1YJN3 3MG2A 1B21A 1JZDA 1T3BA 1W01A 3BNCA 2OOVA 2CC3A 1BNIA 3RNTA 1Q824 1LOYA 3URPA 2AUSA 3ER7A 1VQ43 1EEJA 2GU3A 1RSNA 1BRGA 1BIRA 1W4NA 1TTOA 1DMMA 3D4AA 1I70A 2D1WA 2XFSA 4IT7A 3SX1A 3M4XA 1NDOB 2H0IA 1V58A 3NBRA 2F86B 1Q864 1OGZA 2RSXA 1RGFA 2FXTA 2KRTA 3H51A 1Q40B 3GZXB 1QJGA 4N6LA 4NHFA 1JB4A 1RGCA 1DMQA 1IU7A 1G96A 2Y73A 3F14A 3LTCA 1OPYA 1ROAA 1BRSA 2HMLB 3DGLA 3UNLA 3OWSA 2INXA 1IVUA 3OWYA 1Q814 1EKMA 3EC9A 2EY4A 5KP4A 1A67A 2CWTA 4CDLA 1A90A 2UUGC 2XF3A 4KT3B 2WGOA 5JBSA 3ECFA 3IMAB 1VQK3 1Q40A 2XSHB 3CNXA 2KXGA 4J9AA 1D6UA 1I8VA 3NV0B 3QK9A 5I97A 3PCSA 1JJ22 1I2EA 2P0XA 2W2CA 1WK2A 4JF8A 3UAIA 1B2XA 1YVBI 1BRJA 2XGNA 3OX9A 3WHOA 2UGIA 3S67A 1BRIA 4X2OA 3LYGA 1M904 1IVWA 1TFOA 2Z76A 4N6TA 5G1KA 3CC23 4HM6B 1RRLA 4U13A 1EA2A 3HIGA 3LT9A 1JB5A 2ANEA 4RZMA 3HOHA 1JBSA 1A2KA 5LC6A 3PZWA 1ROVA
chains in the Genus database with same CATH topology
2B78A 1IT8A 4DMGA 1R3EA 2P38A 3D79A 2Q07A 1ZE1A 1WXXA 1IT7A 3C0KA 3LDFA 1ZL3A 1K8WA 2J5VA 1ZS7A 3UAIA 1Q7HA 1T5YA 2CX0A 2AB4A 2AS0A 2CX1A 1IQ8A 4Q1TA 2J5TA 1R3FA 3VSEA 1WXWA 1SGVA 1ZE2A 1J2BA 1SQWA 2CWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B78 A;  1IT8 A;  4DMG A;  1R3E A;  2P38 A;  3D79 A;  2Q07 A;  1ZE1 A;  1WXX A;  1IT7 A;  3C0K A;  3LDF A;  1ZL3 A;  1K8W A;  2J5V A;  1ZS7 A;  3UAI A;  1Q7H A;  1T5Y A;  2CX0 A;  2AB4 A;  2AS0 A;  2CX1 A;  1IQ8 A;  4Q1T A;  2J5T A;  1R3F A;  3VSE A;  1WXW A;  1SGV A;  1ZE2 A;  1J2B A;  1SQW A;  2CWW A; 
#chains in the Genus database with same CATH topology
 1UUW B;  3PYJ A;  1O7G B;  1S5A A;  3G16 A;  1UCL A;  2F5W A;  2XRX B;  3LWQ A;  3OV4 A;  2MC8 A;  4FMA A;  1I2F A;  2AAD A;  5BVB A;  1RDS A;  1O7M B;  2M7O A;  3FF0 A;  3JVC A;  2OQE C;  4EV5 A;  8CHO A;  1BUQ A;  3KZT A;  3B4P A;  4N3V A;  3RDE A;  3X3X A;  3ROB A;  4CCV A;  3DY5 A;  1TU5 A;  1AQZ A;  4R1K A;  4RBN A;  4I5Q A;  6STD A;  1UOY A;  4RNT A;  3MG3 A;  1FGT A;  3HJY A;  1JNQ A;  4N6O B;  4DKI A;  4KFF A;  3HII A;  3SYU A;  3MG1 A;  3A76 A;  4EC6 A;  1BSE A;  1OCV A;  1X1U A;  3EBY A;  2IUK A;  4KVH A;  1NWW A;  1ULI B;  1J2B A;  1HZ1 A;  2XSO B;  2BMR B;  1SQW A;  1FW7 A;  1W6Y A;  5LC7 A;  1I0X A;  3FCS B;  1N9E A;  3CCU 3;  1RNB A;  3SXX A;  1OAC A;  3GAX A;  4MMZ B;  1FUT A;  3KFQ C;  2HMK B;  3D5G A;  1OHS A;  2HOH A;  4XBX A;  1O7W B;  1IT7 A;  1JKG B;  3L0R A;  1ZL3 A;  4FMB A;  2GXF A;  1SPU A;  4KZ1 A;  1NO3 A;  4L8O A;  1GOV A;  4J5K A;  5AYS C;  3CCE 3;  2QGU A;  1B2Z A;  1YVS A;  3F8H A;  1RHL A;  1KD1 4;  3DUK A;  4K1U A;  1N5H A;  5KP1 A;  1ZO2 A;  1SAR A;  3CCV 3;  1BSC A;  2XGL A;  3Q2P A;  1DYU A;  1Y4K A;  2KF4 A;  1GD3 A;  1YGW A;  1JV2 B;  2KAA A;  2CWW A;  3Q3F A;  4LZI A;  1Q42 A;  1A2V A;  4HYZ A;  3KE7 A;  3X41 A;  4O2H A;  1A2P A;  1QAF A;  1UGI A;  1LRA A;  1SIH A;  1HKX A;  5M1A A;  3K7C A;  3OXA A;  4ORL A;  4XBT A;  1ZE1 A;  2J8X B;  1RTU A;  3HZP A;  2P0M A;  3LWR A;  2H0G A;  3ZG5 A;  5CF2 A;  1VQN 3;  1NNV A;  3LWV A;  4CI1 B;  4HM8 B;  1UGH I;  1B27 A;  2W0Q A;  1NJI 4;  2HVY A;  1IDP A;  2W03 A;  3S29 A;  1OGX A;  1M1X B;  2CFW A;  4XB5 A;  1O7N B;  5CK6 A;  2F98 A;  1ISK A;  3CMA 3;  2AS0 A;  4KFD A;  2CX1 A;  1GOY A;  4HM4 B;  1NB5 I;  1UUG B;  3AMO B;  1DMN A;  3S28 A;  1MWT A;  2CWV A;  3GZY B;  3EX9 A;  1TRQ A;  1JRQ A;  2O3O A;  5D82 A;  4AKZ A;  1D6Y A;  2OTJ 3;  7STD A;  1G02 A;  1W2B 2;  2YX9 A;  1IVV A;  3NBB A;  3B4O A;  4RNY A;  5D81 A;  3BIR A;  4HOH A;  2CFK A;  2CKF B;  1I3I A;  1I2G A;  1JN5 B;  1C7H A;  2CFL A;  1PU4 A;  3KII A;  4NRE A;  1WXX A;  1OF5 B;  1W00 A;  1VZZ A;  1W6G A;  1X1X A;  2ML5 A;  1YJW 3;  3CPO A;  5A0O B;  3CME 3;  3KN4 A;  4GSP A;  5RNT A;  1W6C A;  3G0K A;  2W56 B;  3PXM A;  4LSO A;  5IEP A;  2Z6B A;  4FCM A;  1VQ7 3;  1M1K 4;  3I56 3;  4H61 A;  3V99 A;  2RBI A;  1RLS A;  3KKG A;  1JN5 A;  5AI1 A;  4HZ9 B;  1RNT A;  1MGR A;  1TRP A;  3AHS A;  2R41 A;  1BAN A;  5STD A;  5IW9 A;  1I3F A;  3CCL 3;  3DGO A;  3LT8 A;  4HM1 B;  3U1W A;  1VQ8 3;  1BRK A;  8RNT A;  1CEW I;  3T0U A;  1BU4 A;  3LML A;  4HZB B;  1TJD A;  2P38 A;  5BU4 A;  3CCJ 3;  1M9G A;  1IV7 A;  4WYK B;  4BTX A;  2GEY A;  1KC8 4;  1RGK A;  3DMC A;  4R4K A;  5IG3 A;  1B2M A;  4XM4 A;  1LNH A;  2XEP A;  5GSP A;  3M65 A;  1RGE A;  2CHC A;  1V74 A;  3M6W A;  3DM8 A;  3EQQ B;  3SLU A;  5CXO A;  1YJ9 3;  1JBR A;  5EQL A;  2KF5 A;  3BNE A;  3SOA A;  1RN4 A;  1OHP A;  1FYS A;  3ZG0 A;  2STD A;  3GRD A;  4HKV B;  1ASK A;  2PNC A;  1LXE A;  2CFD A;  2CW9 A;  4EW5 A;  3CPW 2;  1DVD A;  1BNG A;  4ZM8 A;  2C11 A;  1K28 A;  1I0V A;  3T8N A;  2P09 A;  5AYR B;  1N9J A;  2OQE A;  1LQM B;  3I0Y A;  1ZBO A;  3NV0 A;  1B2S A;  3EB8 A;  5AIH A;  1RN1 A;  1W2Z A;  6RNT A;  3LTA A;  2QA4 3;  4GL6 A;  1KQS 2;  3M6V A;  1PY3 A;  1Z1S A;  2CG1 A;  3S5C A;  1V57 A;  4BTY A;  1T2H A;  3N8B A;  2OTL 3;  2DP9 A;  1YNV X;  1TP6 A;  2GEX A;  2PZV A;  3EE1 A;  2CX0 A;  2KCD A;  3MQK A;  2RFR A;  3DGM A;  3ALA A;  3NM7 A;  4TX4 A;  3M6U A;  3GZB A;  4X2H A;  1HU9 A;  3FGY A;  4WFO A;  3I55 3;  1W7C A;  2F56 A;  3GWR A;  1NU3 A;  1WTH A;  1BNF A;  3JUQ A;  4HM0 B;  2KF3 A;  4OK0 A;  1LQG C;  4CI3 B;  2WOH A;  2Z7A A;  4STD A;  3M8C A;  3CCR 3;  1UW1 A;  1C54 A;  5IEO A;  1GS3 A;  1GOU A;  1N8Q A;  2KKU A;  1BNJ A;  3JUP A;  4EXR A;  3DH2 A;  5HOH A;  5D83 A;  1GMQ A;  1N8R 4;  3LTB A;  1GSP A;  3M6X A;  1XNE A;  1OH0 A;  2IMJ A;  3F7S A;  4KFE A;  3WOD G;  3C0K A;  1GYB A;  3A5E A;  1TE7 A;  1YHQ 3;  3WR2 A;  1GY6 A;  1BOX A;  3K63 A;  1U5O A;  2IA7 A;  2SAR A;  4R80 A;  2B24 B;  2Z0T A;  5DRE A;  1SJW A;  2QEX 3;  1FGO A;  4PEJ A;  4HM7 B;  2ZHX B;  4MMX B;  3IUW A;  2LYX A;  2ZA4 A;  3PGB A;  1IV9 A;  1EG9 B;  1BSB A;  1LNI A;  1STD A;  5BIR A;  3G71 3;  3HAX A;  1D6Z A;  1OHO A;  2WGQ A;  2HMM B;  3QRD A;  2B1X B;  4ILF A;  2WOF A;  1AR0 A;  1JKG A;  5TGN A;  1LOV A;  3F40 A;  1GY7 A;  3F8X A;  1QVG 2;  3AHW A;  5IG4 A;  1FUW A;  4CPK A;  1ZGX A;  3CCM 3;  2C10 A;  2P05 A;  3JUO A;  3LWP A;  2W04 A;  4HAA A;  4HM2 B;  4CI2 B;  1TFK A;  3SOY A;  3WA2 X;  2GSP A;  3AGO A;  1CYV A;  1BNS A;  3LH4 A;  4LMI A;  5JPP A;  3KSP A;  1BUJ A;  3VSE A;  5IF6 A;  1IVX A;  3OW2 2;  2I9W A;  1IYY A;  1KSI A;  3DGY A;  1VQ5 3;  3KCH A;  5ELJ A;  3VGN A;  1VQO 3;  3S27 A;  3X40 A;  3LOY A;  4MJD A;  1WMO A;  3UJM A;  1UCJ A;  1VQQ A;  4FMD A;  1MGW A;  4N6U A;  5AIF A;  2KF6 A;  2MF7 A;  2HMO B;  3EBT A;  2APO A;  1GY5 A;  1NB3 I;  1K8A 4;  7RNT A;  1VQP 3;  1IQY A;  1B3S A;  1BRH A;  3MPH A;  3WOE B;  3CD6 3;  2RGQ A;  2UX0 A;  1LOX A;  3DXO A;  1K41 A;  3NBJ A;  4HVN A;  4BU4 A;  3AMO A;  1ZS7 A;  3EJV A;  4HJL B;  3UB1 A;  5M19 A;  3CCQ 3;  5AEW B;  4N6M A;  2HMN B;  2JQ5 A;  2XR8 B;  3SED A;  2FGT A;  1VQ6 3;  1IQ8 A;  1HYF A;  1K9M 4;  1N5P A;  3D3L A;  4WHA A;  4NPB A;  1RGG A;  3FKA A;  3WOF B;  1RGH A;  1BGS A;  1R4C A;  3K9M C;  4OUQ A;  3J7Y d;  1Q7Y 4;  2A15 A;  3NHX A;  3MYT A;  9RNT A;  2FNQ A;  1F8N A;  3LJC A;  4R9K A;  4FCJ A;  4K1V A;  1OF5 A;  5BXQ A;  1BSD A;  1PFP A;  1QAL A;  1IT8 A;  3RGR A;  2BHM A;  1E97 A;  2YFI B;  3GZR A;  4GHO A;  4HM3 B;  3F7X A;  3D79 A;  1RN7 A;  4O8S A;  2Z77 A;  1VQ9 3;  1RKY A;  1QVF 2;  3LWO A;  4O02 B;  4XDW A;  2W56 A;  1O7H B;  2GBW B;  2YFJ B;  2JDI H;  4WWU C;  1RRH A;  2XFT A;  3PCR A;  2V1L A;  3BB9 A;  3F9S A;  5HGR A;  1E3V A;  1OUN A;  2CH9 A;  2CFG A;  2CWU A;  2ML6 A;  5FGO A;  1Q7H A;  1T5Y A;  1TIJ A;  2OOV C;  1CH0 A;  2C4B A;  4WP5 A;  2F4Y A;  3B8L A;  1L5G B;  1DVC A;  1AV4 A;  1KWI A;  4Q1T A;  3LZA A;  2HMJ B;  4J5G A;  1YI2 3;  2F99 A;  1RCL A;  3CU3 A;  1WNH A;  3FG1 A;  3CXC 2;  1JZO A;  1ULJ B;  1AVL A;  4G1M B;  1IK3 A;  4IPB A;  3EN1 B;  3WDG B;  4RNZ A;  3FZW A;  1VQM 3;  3EF8 A;  1Q9E A;  5IEN A;  1R3F A;  3LTD A;  3FLJ A;  1S72 3;  4WYK A;  4BIR A;  1RMS A;  3WMD A;  3CC7 3;  2B78 A;  1BNR A;  3STD A;  3DGN A;  2K0M A;  5KP3 A;  2Q07 A;  2RFK A;  3CCS 3;  1IQX A;  3K5T A;  3G4S 3;  4FMC A;  2K3D A;  3O8Y A;  1FA3 A;  2OCT A;  2Y74 A;  4FCZ A;  4LEH A;  2LQV A;  2BMO B;  5G2G A;  2CIU A;  3N54 B;  2E5O A;  2IUJ A;  4AEQ A;  1BRN L;  1G0T A;  1MWR A;  5AEU B;  3G6E 3;  3V98 A;  3Q90 A;  4HBR A;  2W6J H;  1DET A;  1B2U A;  1RCK A;  4K61 A;  5EVH A;  1WXW A;  1SGV A;  1ZE2 A;  1X1W A;  1GD4 A;  1SII A;  1BSA A;  3UL6 A;  1AY7 A;  1WMN A;  1U8C B;  2BMQ B;  3FG4 A;  1AVK A;  1UI8 A;  1WQL B;  1UCI A;  4IIA A;  3FH1 A;  1BAO A;  5FW5 A;  3MWZ A;  4CJN A;  4LYL B;  3Q1C A;  3N9H A;  1R3E A;  4BTW A;  4FR9 A;  1B20 A;  2O9U X;  1STF I;  1YIJ 3;  1FGM A;  3IPT A;  2BT3 A;  1QAK A;  1S04 A;  4HM5 B;  2W9P A;  3FF2 A;  7GSP A;  3NX0 A;  5CF1 A;  3T8U A;  4JRF A;  1T2I A;  1LVN A;  2L1S A;  4K90 B;  1BNE A;  3EHC A;  5IG5 A;  2R4I A;  3OWU A;  4EV2 A;  3ZFZ A;  1WMP A;  6GSP A;  1UUV B;  3VSY A;  1EUI C;  3NQZ A;  1W02 A;  3NUV A;  3EN8 A;  4H3U A;  1FUS A;  1ZX2 A;  2YFL B;  3FSD A;  5EEO A;  4AKY A;  1O7P B;  3SVA A;  2BIR A;  2GU1 A;  4EYC A;  1MNL A;  2D42 A;  1MOL A;  3TDG A;  4N6N B;  3G8Z A;  5G1L A;  4MMY B;  4BL3 A;  4DMG A;  2L4V A;  2SBL A;  3HI7 A;  4L7K A;  4Q53 A;  3NXJ A;  2XH9 A;  3HJW A;  4TZ4 C;  3BU4 A;  4L8P A;  1GMR A;  5ELU A;  3V92 A;  3DZL A;  2ZDJ A;  1UDI I;  3ZV0 C;  1FZU A;  1R4Y A;  5CLK A;  4N6V 0;  1FGQ A;  2J5V A;  1W5Z A;  3B7C A;  3KSE D;  3JUM A;  5AIG A;  3X42 A;  1MWU A;  3H3H A;  2WO0 A;  2BNG A;  4R9L A;  3E99 A;  2J5T A;  3X3Y A;  3HK4 A;  1LOW A;  3JUN A;  3BNB A;  3K0Z A;  2W9Q A;  3PS8 A;  3FG3 A;  3D5I A;  5M18 A;  3AGN A;  2AAE A;  1YIT 3;  3BND A;  1GMP A;  1RGL A;  4XBY A;  2CK3 H;  3NQY A;  4QWT A;  2OWP A;  1BVI A;  2RNT A;  1RGA A;  2K54 A;  1QMA A;  2CG0 A;  3MKI A;  2RCD A;  3CNM A;  2E2V A;  4EBG A;  3X3Z A;  1DE3 A;  2F5M A;  3IJE B;  3D9R A;  1US1 A;  2BU4 A;  3WA3 A;  1CYU A;  1PYL A;  3LDF A;  3HX8 A;  1K8W A;  4XDV A;  1JB2 A;  1YGE A;  3UL5 A;  1JBT A;  1CQS A;  5AII A;  3CC4 3;  2QIY A;  1X1Y A;  2AB4 A;  3MHE A;  2GBX B;  5DRV A;  2IY2 A;  4J8T A;  2E2U A;  1MWS A;  1E3R A;  1UCK A;  2BO9 B;  1RJO A;  2H0H A;  3MSO A;  4MEI A;  1VQL 3;  3VF1 A;  1EQK A;  5JPU A;  3U28 A;  4O3V A;  4OVM A;  1TUH A;  4I4K A;  3LXU X;  5IG0 A;  4BL2 A;  4GB5 A;  1K73 4;  1FGR A;  3GSP A;  5IER A;  2FRX A;  2IYJ A;  3NM2 A;  1UI7 A;  2E2T A;  3BLZ A;  3U97 A;  3RGA A;  2ZL8 A;  4LGQ A;  1YJN 3;  3MG2 A;  1B21 A;  1JZD A;  1T3B A;  1W01 A;  3BNC A;  2OOV A;  2CC3 A;  1BNI A;  3RNT A;  1Q82 4;  1LOY A;  3URP A;  2AUS A;  3ER7 A;  1VQ4 3;  1EEJ A;  2GU3 A;  1RSN A;  1BRG A;  1BIR A;  1W4N A;  1TTO A;  1DMM A;  3D4A A;  1I70 A;  2D1W A;  2XFS A;  4IT7 A;  3SX1 A;  3M4X A;  1NDO B;  2H0I A;  1V58 A;  3NBR A;  2F86 B;  1Q86 4;  1OGZ A;  2RSX A;  1RGF A;  2FXT A;  2KRT A;  3H51 A;  1Q40 B;  3GZX B;  1QJG A;  4N6L A;  4NHF A;  1JB4 A;  1RGC A;  1DMQ A;  1IU7 A;  1G96 A;  2Y73 A;  3F14 A;  3LTC A;  1OPY A;  1ROA A;  1BRS A;  2HML B;  3DGL A;  3UNL A;  3OWS A;  2INX A;  1IVU A;  3OWY A;  1Q81 4;  1EKM A;  3EC9 A;  2EY4 A;  5KP4 A;  1A67 A;  2CWT A;  4CDL A;  1A90 A;  2UUG C;  2XF3 A;  4KT3 B;  2WGO A;  5JBS A;  3ECF A;  3IMA B;  1VQK 3;  1Q40 A;  2XSH B;  3CNX A;  2KXG A;  4J9A A;  1D6U A;  1I8V A;  3NV0 B;  3QK9 A;  5I97 A;  3PCS A;  1JJ2 2;  1I2E A;  2P0X A;  2W2C A;  1WK2 A;  4JF8 A;  3UAI A;  1B2X A;  1YVB I;  1BRJ A;  2XGN A;  3OX9 A;  3WHO A;  2UGI A;  3S67 A;  1BRI A;  4X2O A;  3LYG A;  1M90 4;  1IVW A;  1TFO A;  2Z76 A;  4N6T A;  5G1K A;  3CC2 3;  4HM6 B;  1RRL A;  4U13 A;  1EA2 A;  3HIG A;  3LT9 A;  1JB5 A;  2ANE A;  4RZM A;  3HOH A;  1JBS A;  1A2K A;  5LC6 A;  3PZW A;  1ROV A; 
#chains in the Genus database with same CATH homology
 2B78 A;  1IT8 A;  4DMG A;  1R3E A;  2P38 A;  3D79 A;  2Q07 A;  1ZE1 A;  1WXX A;  1IT7 A;  3C0K A;  3LDF A;  1ZL3 A;  1K8W A;  2J5V A;  1ZS7 A;  3UAI A;  1Q7H A;  1T5Y A;  2CX0 A;  2AB4 A;  2AS0 A;  2CX1 A;  1IQ8 A;  4Q1T A;  2J5T A;  1R3F A;  3VSE A;  1WXW A;  1SGV A;  1ZE2 A;  1J2B A;  1SQW A;  2CWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...