1ZS7A

The structure of gene product ape0525 from aeropyrum pernix
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
187
structure length
187
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGKRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of gene product APE0525 from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
total genus 51
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1zs7A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1zs7A01
2B78A 2CX0A 4DMGA 2AS0A 1WXXA 3C0KA 1ZE2A 2J5TA 2Q07A 1WXWA 2CX1A 2J5VA 1SQWA 3VSEA 3D79A 4Q1TA 1T5YA 1J2BA 1K8WA 2AB4A 1ZS7A 3UAIA 1SGVA 1Q7HA 3LDFA 1ZE1A 1R3FA 1R3EA 1IQ8A 1IT7A 2CWWA 1ZL3A 2P38A 1IT8A
chains in the Genus database with same CATH superfamily
2BMRB 3N9HA 5IG0A 3EE1A 3IPTA 3HIGA 3LH4A 3WDGB 2H0IA 2CC3A 3NHXA 3S28A 3C0KA 4AKYA 5IF6A 3ZG5A 1B2ZA 3GZBA 2L1SA 2GBXB 1SARA 1YHQ3 2XF3A 2WGOA 3NBBA 3NV0B 3NM7A 3WMDA 4BL2A 3HIIA 4HKVB 4RZMA 1UOYA 2D42A 2L4VA 4XM4A 4GB5A 3BNCA 2KF4A 1Z1SA 1MWRA 3BNBA 1UI7A 1FA3A 4EV2A 1FGOA 3F8XA 2RBIA 4N6MA 1DVDA 3CPW2 3OX9A 3DM8A 1U5OA 1BOXA 4LYLB 3HJWA 2WOFA 3K63A 2CH9A 2RFRA 2K0MA 2Y73A 1US1A 2CFLA 1RDSA 2GSPA 1F8NA 2LQVA 3EX9A 1U8CB 1AV4A 3OV4A 3SLUA 1T3BA 3X42A 4XBXA 1DMNA 1JN5A 2E5OA 4JF8A 4LGQA 4BTWA 2MC8A 3D9RA 5JBSA 2OQEC 1Q824 1PY3A 1I70A 3N8BA 1DMMA 1FGTA 1TRQA 3PS8A 1AQZA 2I9WA 1BRKA 1BSAA 3M6UA 1IVVA 3HX8A 2HMLB 3K5TA 4HJLB 4J9AA 4LZIA 1AR0A 4X2HA 1B27A 2W9QA 4MJDA 4FR9A 2CW9A 2ZA4A 8RNTA 1ULIB 1V57A 3NM2A 3F8HA 1ISKA 6RNTA 3CD63 1I2FA 4AKZA 1BSCA 1AVKA 3U1WA 3G6E3 3RGAA 2F4YA 3GZRA 1BNFA 2CHCA 3FH1A 2CWVA 1A2VA 3B4PA 2OWPA 1OGZA 3NQYA 3B4OA 1JKGB 3K9MC 1KD14 3T8NA 4HM1B 1LOWA 3WA3A 3KE7A 4LMIA 1O7MB 4FCJA 2WO0A 3LYGA 2OQEA 1MWSA 5IW9A 1LXEA 3G16A 3X40A 3CCR3 1BU4A 1GD3A 1GYBA 2GU1A 1K734 4J5GA 5M1AA 3JUQA 1SQWA 2Z76A 1FGMA 1B2SA 5IG3A 2RSXA 1N8QA 1IV9A 1WMNA 4N6UA 4MMYB 1OHSA 3LWRA 1YGWA 2OOVC 5D83A 3FF0A 4HZ9B 2BU4A 3FF2A 1BSBA 2WGQA 1RRLA 2QIYA 3GAXA 4CDLA 3WR2A 3G8ZA 4HOHA 1A67A 1AVLA 1UUVB 3A5EA 3SEDA 3H51A 1M904 1UGHI 2IYJA 3AMOA 3LTBA 1GY7A 1JBSA 3SOYA 1IVWA 4EXRA 4K1UA 1OF5A 2INXA 3GZXB 2RNTA 3PZWA 5G2GA 3CCM3 3SXXA 3DGOA 4FMAA 1VQP3 3ALAA 4QWTA 1NDOB 1J2BA 2K3DA 3E99A 1EEJA 2XGNA 1NWWA 1PFPA 4WHAA 1M1XB 2W0QA 3BNDA 1VQ63 3DGLA 2GEXA 2R41A 2HOHA 3HK4A 1WNHA 2KAAA 1QAKA 2ZHXB 5CF1A 3EN1B 1IT7A 3STDA 2C4BA 3I0YA 1VQQA 2IY2A 1DYUA 2B78A 1QMAA 1BUQA 4EW5A 1EUIC 1HKXA 3B8LA 5FGOA 4EBGA 3VGNA 2ZDJA 3F7XA 3DGNA 3DMCA 3F9SA 1VQ43 1ZGXA 1JV2B 2ML5A 2HMKB 5KP4A 3CCV3 1BNRA 2WOHA 3OWSA 4R9LA 1YI23 1YGEA 5DREA 1X1WA 1RGCA 1W6GA 1GMQA 2IA7A 3S5CA 3EQQB 1N9EA 4X2OA 3FG4A 1Q40B 1TJDA 8CHOA 1B21A 4XB5A 3UAIA 2E2VA 5AIIA 1W6CA 1T2IA 2PZVA 1FW7A 1OACA 1IQYA 4MEIA 1BRGA 1UDII 1W00A 1RNTA 1BRHA 5LC6A 4HM4B 2QEX3 1OHOA 3ECFA 3CCU3 2CWUA 4GHOA 4R4KA 3JUPA 4RNYA 5CLKA 3L0RA 3CCL3 4HVNA 4NPBA 1TFKA 4CI1B 3SVAA 1PU4A 1IVXA 3QRDA 3M6WA 1NJI4 1EQKA 1JB5A 1QJGA 2BHMA 5AIGA 3ZFZA 3MPHA 2XR8B 2Z0TA 4L8PA 4ILFA 2CG0A 1W01A 3MG3A 5TGNA 3EB8A 1FUWA 1JNQA 1T5YA 2CWTA 4PEJA 4KFEA 2K54A 1JRQA 2A15A 2STDA 1BAOA 2W9PA 3K7CA 4WP5A 2UUGC 1BVIA 1I8VA 1MOLA 1WMPA 2CFKA 1SGVA 4FCMA 2Z77A 3ER7A 5AIHA 5IERA 1NU3A 1B2XA 1VQ93 2HMJB 5LC7A 1ULJB 1VQL3 1YJW3 1BNIA 3LXUX 3CXC2 1A2KA 1GOVA 2XFTA 1N8R4 4WYKA 3PGBA 3OW22 2OCTA 2E2TA 1VQN3 3UJMA 4BL3A 1S04A 1BRNL 3B7CA 1O7GB 3G0KA 5AI1A 1EG9B 3WODG 2J5TA 1CYVA 3CMA3 2J5VA 3M6VA 4XDWA 1W02A 2HMNB 4Q1TA 4FMCA 2IUJA 3GSPA 4FCZA 1W5ZA 3HI7A 4BU4A 2J8XB 3Q90A 3FSDA 1DE3A 2F99A 3RNTA 3KCHA 2F86B 2P0MA 1GD4A 3FG1A 1X1UA 5EQLA 2UGIA 2XFSA 3NV0A 1NB5I 1GOUA 1O7PB 2F56A 1BNGA 1IQXA 3D4AA 2Z6BA 2JQ5A 1G96A 1RN1A 4WWUC 1LRAA 1LNHA 1YIT3 4JRFA 2E2UA 3CNMA 1JB4A 6STDA 4O8SA 1YVSA 3Q1CA 3V99A 5FW5A 3PXMA 1K28A 3MG2A 3X3ZA 3GRDA 3TDGA 1BRSA 1G02A 2Q07A 3M65A 3J7Yd 1JJ22 4NREA 2XEPA 2XH9A 2Z7AA 3D79A 5HOHA 4HM5B 1RN7A 2V1LA 2XSHB 3DZLA 3GZYB 1TU5A 2D1WA 3WOEB 3EBYA 3LT9A 1VQO3 4IPBA 5AYRB 6GSPA 1QAFA 2HMOB 1BNSA 3EN8A 4LEHA 2CKFB 2P0XA 1VZZA 5DRVA 1BNEA 3LZAA 5EEOA 2OTL3 1VQ53 3KKGA 4XBYA 4STDA 1UCLA 3X41A 1A2PA 1RMSA 4DMGA 2RCDA 5D81A 1W2B2 2KXGA 1K8A4 1HYFA 1OPYA 1Q9EA 5AYSC 4ZM8A 4I4KA 1CYUA 2FNQA 2LYXA 1MGRA 2W56B 3DGMA 1ASKA 3H3HA 1ZE2A 2O9UX 3DXOA 1LQMB 2CX1A 5CK6A 1FGRA 3DY5A 1RCKA 1FZUA 3FLJA 5KP1A 4EYCA 3Q2PA 4MMZB 3URPA 3PYJA 4J5KA 2OTJ3 3BIRA 1UCIA 3NXJA 4N6NB 1JB2A 3CCJ3 1C7HA 1IU7A 1WQLB 1BNJA 1Q40A 1RNBA 3UNLA 1TE7A 5BVBA 4HAAA 1IQ8A 1EA2A 1JN5B 3EBTA 1YJ93 1V74A 3M4XA 1OF5B 2F5MA 2CG1A 5M18A 1K41A 1IT8A 1NO3A 1RGFA 2PNCA 4IIAA 2CX0A 4Q53A 2CK3H 3SYUA 3CCE3 2UX0A 2QGUA 1E3RA 1DETA 1CEWI 1MNLA 3LTAA 3S29A 1STFI 1BIRA 1QALA 1ZX2A 4WFOA 3AHWA 3CC23 3KSED 1JZDA 1RHLA 3IJEB 3EC9A 3HJYA 2ANEA 5D82A 4XBTA 2W04A 1KQS2 3LTCA 2YFLB 3FZWA 1UUGB 1WK2A 1IV7A 2CFWA 3EF8A 3OXAA 3HOHA 2AB4A 5AEWB 1QVG2 2FXTA 1DMQA 1B3SA 1SIIA 2BIRA 1GMRA 2IUKA 5ELJA 2CFGA 3WHOA 2M7OA 5JPPA 1VQ83 5M19A 3EJVA 4IT7A 1T2HA 2XSOB 3CME3 2HMMB 2IMJA 2GBWB 2CWWA 3CNXA 4HM6B 3X3XA 3WOFB 2R4IA 5IEPA 1TTOA 1W6YA 3MHEA 4BIRA 1Q814 2AS0A 3DH2A 5RNTA 1GSPA 1O7WB 2B24B 3MYTA 1BUJA 1X1YA 1WMOA 3BU4A 1HU9A 4U13A 1LNIA 1RJOA 1UW1A 4CCVA 1YNVX 1RGGA 1OGXA 1TRPA 3JUOA 2AAEA 4L8OA 2KF5A 3SX1A 2AUSA 3OWYA 2RFKA 2F5WA 3UL6A 7STDA 1UCJA 4H3UA 4GL6A 2C11A 4K61A 1CQSA 1GS3A 5G1KA 3F14A 1RGHA 3QK9A 3LT8A 4HM8B 1E97A 5CF2A 5I97A 2C10A 4CPKA 1D6YA 3K0ZA 4K1VA 5IEOA 3U97A 1SIHA 2P09A 4RNTA 1EKMA 3LWVA 4R9KA 2KCDA 4TX4A 3S67A 9RNTA 3I563 3PCRA 4OK0A 3FKAA 1IVUA 1JZOA 3AMOB 1BGSA 1BRJA 1OCVA 1XNEA 1OHPA 3D5GA 1I3FA 4KFFA 1W4NA 3OWUA 3CPOA 2XRXB 1JKGA 1STDA 1X1XA 2BO9B 3N54B 4HM3B 3ZV0C 2YFIB 4J8TA 1N5PA 4FMDA 3VSEA 4O02B 4DKIA 1RCLA 2P05A 3Q3FA 1RGLA 1ROVA 3F40A 4GSPA 4EC6A 4KVHA 2HVYA 3CCQ3 4N6OB 5A0OB 3VSYA 2BMQB 3LOYA 4CI2B 3DUKA 4I5QA 4RBNA 2W2CA 1R3EA 1RRHA 3S27A 1TP6A 3VF1A 1MGWA 4H61A 1B2MA 5AIFA 1CH0A 2QA43 3BB9A 3UL5A 1IK3A 3ROBA 1A90A 3BLZA 1V58A 3FGYA 3KFQC 1YIJ3 1O7NB 3CC73 2O3OA 3IUWA 3D3LA 3CU3A 3LTDA 1RGEA 2BMOB 1VQ73 3JUNA 5ELUA 5EVHA 4OVMA 2W03A 1I0XA 1K8WA 3NQZA 5AEUB 3SOAA 3LWPA 4EV5A 2Y74A 1ZS7A 2KRTA 5IG4A 1RGKA 2SARA 1HZ1A 1SJWA 3LWQA 1LOXA 1O7HB 3JUMA 2BT3A 3DGYA 1R3FA 2KKUA 1UCKA 1L5GB 2FGTA 7GSPA 1YVBI 1GMPA 1GY5A 1I2EA 1KSIA 1MWUA 1ZL3A 2B1XB 4CI3B 3FG3A 1NB3I 1M1K4 4N6LA 3T8UA 1RGAA 4LSOA 1WXXA 2GXFA 2YX9A 1IYYA 3PCSA 1LOYA 4O2HA 1MWTA 4N6TA 3CC43 5STDA 1ROAA 3HAXA 3WA2X 4BTYA 1RN4A 2CFDA 4L7KA 3MQKA 1JBRA 2KF3A 4ORLA 1LVNA 3UB1A 5IG5A 2RGQA 2JDIH 1D6ZA 1M9GA 5KP3A 1W2ZA 1Q7HA 1PYLA 3HZPA 3AHSA 5BIRA 4K90B 1YJN3 1UGIA 3AGOA 2KF6A 4HM0B 3BNEA 3KZTA 4FMBA 3V92A 4CJNA 2ML6A 5HGRA 1UI8A 1RTUA 2GU3A 3LWOA 2W56A 5CXOA 3G4S3 3I553 3MKIA 1KC84 4TZ4C 3M6XA 3FCSB 1Q42A 4NHFA 1K9M4 2F98A 1WTHA 1B20A 2YFJB 4KFDA 1ZO2A 3ZG0A 2APOA 2H0HA 3M8CA 5IENA 4MMXB 2SBLA 4WYKB 1FYSA 1SPUA 3AGNA 3T0UA 4G1MB 1OH0A 3G713 4XDVA 1QVF2 2BNGA 1R4CA 1JBTA 1LQGC 4HYZA 4AEQA 1NNVA 3MWZA 2EY4A 3KIIA 1R4YA 1VQM3 2AADA 1I3IA 1FUTA 3LJCA 1UUWB 1W7CA 1Q7Y4 3A76A 7RNTA 1N9JA 2XGLA 4R1KA 1S723 1RSNA 3NUVA 5G1LA 1E3VA 3NX0A 5BU4A 1BSEA 4BTXA 5GSPA 2P38A 1BSDA 3LMLA 3NBJA 2MF7A 1G0TA 1GOYA 2W6JH 1Q864 2H0GA 3D5IA 1BANA 1Y4KA 3KN4A 1TFOA 1B2UA 4O3VA 1DVCA 3IMAB 3JVCA 1FGQA 3U28A 4N6V0 2OOVA 1VQK3 1WXWA 1IDPA 1ZBOA 1OUNA 4KT3B 1D6UA 2DP9A 4HM7B 1KWIA 1S5AA 4RNZA 1TUHA 4HM2B 4HBRA 3X3YA 5JPUA 1LOVA 2ZL8A 3RDEA 1N5HA 3CCS3 1I2GA 3MSOA 3F7SA 1C54A 1GY6A 4R80A 3LDFA 3MG1A 3NBRA 5BXQA 2GEYA 4HZBB 2FRXA 1ZE1A 1I0VA 1AY7A 4N3VA 1RKYA 3O8YA 1TIJA 1RLSA 2CIUA 3EHCA 1BRIA 1FUSA 3GWRA 4KZ1A 4OUQA 3RGRA 3KSPA 3V98A
chains in the Genus database with same CATH topology
2B78A 2CX0A 4DMGA 2AS0A 1WXXA 3C0KA 1ZE2A 2J5TA 2Q07A 1WXWA 2CX1A 2J5VA 1SQWA 3VSEA 3D79A 4Q1TA 1T5YA 1J2BA 1K8WA 2AB4A 1ZS7A 3UAIA 1SGVA 1Q7HA 3LDFA 1ZE1A 1R3FA 1R3EA 1IQ8A 1IT7A 2CWWA 1ZL3A 2P38A 1IT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B78 A;  2CX0 A;  4DMG A;  2AS0 A;  1WXX A;  3C0K A;  1ZE2 A;  2J5T A;  2Q07 A;  1WXW A;  2CX1 A;  2J5V A;  1SQW A;  3VSE A;  3D79 A;  4Q1T A;  1T5Y A;  1J2B A;  1K8W A;  2AB4 A;  1ZS7 A;  3UAI A;  1SGV A;  1Q7H A;  3LDF A;  1ZE1 A;  1R3F A;  1R3E A;  1IQ8 A;  1IT7 A;  2CWW A;  1ZL3 A;  2P38 A;  1IT8 A; 
#chains in the Genus database with same CATH topology
 2BMR B;  3N9H A;  5IG0 A;  3EE1 A;  3IPT A;  3HIG A;  3LH4 A;  3WDG B;  2H0I A;  2CC3 A;  3NHX A;  3S28 A;  3C0K A;  4AKY A;  5IF6 A;  3ZG5 A;  1B2Z A;  3GZB A;  2L1S A;  2GBX B;  1SAR A;  1YHQ 3;  2XF3 A;  2WGO A;  3NBB A;  3NV0 B;  3NM7 A;  3WMD A;  4BL2 A;  3HII A;  4HKV B;  4RZM A;  1UOY A;  2D42 A;  2L4V A;  4XM4 A;  4GB5 A;  3BNC A;  2KF4 A;  1Z1S A;  1MWR A;  3BNB A;  1UI7 A;  1FA3 A;  4EV2 A;  1FGO A;  3F8X A;  2RBI A;  4N6M A;  1DVD A;  3CPW 2;  3OX9 A;  3DM8 A;  1U5O A;  1BOX A;  4LYL B;  3HJW A;  2WOF A;  3K63 A;  2CH9 A;  2RFR A;  2K0M A;  2Y73 A;  1US1 A;  2CFL A;  1RDS A;  2GSP A;  1F8N A;  2LQV A;  3EX9 A;  1U8C B;  1AV4 A;  3OV4 A;  3SLU A;  1T3B A;  3X42 A;  4XBX A;  1DMN A;  1JN5 A;  2E5O A;  4JF8 A;  4LGQ A;  4BTW A;  2MC8 A;  3D9R A;  5JBS A;  2OQE C;  1Q82 4;  1PY3 A;  1I70 A;  3N8B A;  1DMM A;  1FGT A;  1TRQ A;  3PS8 A;  1AQZ A;  2I9W A;  1BRK A;  1BSA A;  3M6U A;  1IVV A;  3HX8 A;  2HML B;  3K5T A;  4HJL B;  4J9A A;  4LZI A;  1AR0 A;  4X2H A;  1B27 A;  2W9Q A;  4MJD A;  4FR9 A;  2CW9 A;  2ZA4 A;  8RNT A;  1ULI B;  1V57 A;  3NM2 A;  3F8H A;  1ISK A;  6RNT A;  3CD6 3;  1I2F A;  4AKZ A;  1BSC A;  1AVK A;  3U1W A;  3G6E 3;  3RGA A;  2F4Y A;  3GZR A;  1BNF A;  2CHC A;  3FH1 A;  2CWV A;  1A2V A;  3B4P A;  2OWP A;  1OGZ A;  3NQY A;  3B4O A;  1JKG B;  3K9M C;  1KD1 4;  3T8N A;  4HM1 B;  1LOW A;  3WA3 A;  3KE7 A;  4LMI A;  1O7M B;  4FCJ A;  2WO0 A;  3LYG A;  2OQE A;  1MWS A;  5IW9 A;  1LXE A;  3G16 A;  3X40 A;  3CCR 3;  1BU4 A;  1GD3 A;  1GYB A;  2GU1 A;  1K73 4;  4J5G A;  5M1A A;  3JUQ A;  1SQW A;  2Z76 A;  1FGM A;  1B2S A;  5IG3 A;  2RSX A;  1N8Q A;  1IV9 A;  1WMN A;  4N6U A;  4MMY B;  1OHS A;  3LWR A;  1YGW A;  2OOV C;  5D83 A;  3FF0 A;  4HZ9 B;  2BU4 A;  3FF2 A;  1BSB A;  2WGQ A;  1RRL A;  2QIY A;  3GAX A;  4CDL A;  3WR2 A;  3G8Z A;  4HOH A;  1A67 A;  1AVL A;  1UUV B;  3A5E A;  3SED A;  3H51 A;  1M90 4;  1UGH I;  2IYJ A;  3AMO A;  3LTB A;  1GY7 A;  1JBS A;  3SOY A;  1IVW A;  4EXR A;  4K1U A;  1OF5 A;  2INX A;  3GZX B;  2RNT A;  3PZW A;  5G2G A;  3CCM 3;  3SXX A;  3DGO A;  4FMA A;  1VQP 3;  3ALA A;  4QWT A;  1NDO B;  1J2B A;  2K3D A;  3E99 A;  1EEJ A;  2XGN A;  1NWW A;  1PFP A;  4WHA A;  1M1X B;  2W0Q A;  3BND A;  1VQ6 3;  3DGL A;  2GEX A;  2R41 A;  2HOH A;  3HK4 A;  1WNH A;  2KAA A;  1QAK A;  2ZHX B;  5CF1 A;  3EN1 B;  1IT7 A;  3STD A;  2C4B A;  3I0Y A;  1VQQ A;  2IY2 A;  1DYU A;  2B78 A;  1QMA A;  1BUQ A;  4EW5 A;  1EUI C;  1HKX A;  3B8L A;  5FGO A;  4EBG A;  3VGN A;  2ZDJ A;  3F7X A;  3DGN A;  3DMC A;  3F9S A;  1VQ4 3;  1ZGX A;  1JV2 B;  2ML5 A;  2HMK B;  5KP4 A;  3CCV 3;  1BNR A;  2WOH A;  3OWS A;  4R9L A;  1YI2 3;  1YGE A;  5DRE A;  1X1W A;  1RGC A;  1W6G A;  1GMQ A;  2IA7 A;  3S5C A;  3EQQ B;  1N9E A;  4X2O A;  3FG4 A;  1Q40 B;  1TJD A;  8CHO A;  1B21 A;  4XB5 A;  3UAI A;  2E2V A;  5AII A;  1W6C A;  1T2I A;  2PZV A;  1FW7 A;  1OAC A;  1IQY A;  4MEI A;  1BRG A;  1UDI I;  1W00 A;  1RNT A;  1BRH A;  5LC6 A;  4HM4 B;  2QEX 3;  1OHO A;  3ECF A;  3CCU 3;  2CWU A;  4GHO A;  4R4K A;  3JUP A;  4RNY A;  5CLK A;  3L0R A;  3CCL 3;  4HVN A;  4NPB A;  1TFK A;  4CI1 B;  3SVA A;  1PU4 A;  1IVX A;  3QRD A;  3M6W A;  1NJI 4;  1EQK A;  1JB5 A;  1QJG A;  2BHM A;  5AIG A;  3ZFZ A;  3MPH A;  2XR8 B;  2Z0T A;  4L8P A;  4ILF A;  2CG0 A;  1W01 A;  3MG3 A;  5TGN A;  3EB8 A;  1FUW A;  1JNQ A;  1T5Y A;  2CWT A;  4PEJ A;  4KFE A;  2K54 A;  1JRQ A;  2A15 A;  2STD A;  1BAO A;  2W9P A;  3K7C A;  4WP5 A;  2UUG C;  1BVI A;  1I8V A;  1MOL A;  1WMP A;  2CFK A;  1SGV A;  4FCM A;  2Z77 A;  3ER7 A;  5AIH A;  5IER A;  1NU3 A;  1B2X A;  1VQ9 3;  2HMJ B;  5LC7 A;  1ULJ B;  1VQL 3;  1YJW 3;  1BNI A;  3LXU X;  3CXC 2;  1A2K A;  1GOV A;  2XFT A;  1N8R 4;  4WYK A;  3PGB A;  3OW2 2;  2OCT A;  2E2T A;  1VQN 3;  3UJM A;  4BL3 A;  1S04 A;  1BRN L;  3B7C A;  1O7G B;  3G0K A;  5AI1 A;  1EG9 B;  3WOD G;  2J5T A;  1CYV A;  3CMA 3;  2J5V A;  3M6V A;  4XDW A;  1W02 A;  2HMN B;  4Q1T A;  4FMC A;  2IUJ A;  3GSP A;  4FCZ A;  1W5Z A;  3HI7 A;  4BU4 A;  2J8X B;  3Q90 A;  3FSD A;  1DE3 A;  2F99 A;  3RNT A;  3KCH A;  2F86 B;  2P0M A;  1GD4 A;  3FG1 A;  1X1U A;  5EQL A;  2UGI A;  2XFS A;  3NV0 A;  1NB5 I;  1GOU A;  1O7P B;  2F56 A;  1BNG A;  1IQX A;  3D4A A;  2Z6B A;  2JQ5 A;  1G96 A;  1RN1 A;  4WWU C;  1LRA A;  1LNH A;  1YIT 3;  4JRF A;  2E2U A;  3CNM A;  1JB4 A;  6STD A;  4O8S A;  1YVS A;  3Q1C A;  3V99 A;  5FW5 A;  3PXM A;  1K28 A;  3MG2 A;  3X3Z A;  3GRD A;  3TDG A;  1BRS A;  1G02 A;  2Q07 A;  3M65 A;  3J7Y d;  1JJ2 2;  4NRE A;  2XEP A;  2XH9 A;  2Z7A A;  3D79 A;  5HOH A;  4HM5 B;  1RN7 A;  2V1L A;  2XSH B;  3DZL A;  3GZY B;  1TU5 A;  2D1W A;  3WOE B;  3EBY A;  3LT9 A;  1VQO 3;  4IPB A;  5AYR B;  6GSP A;  1QAF A;  2HMO B;  1BNS A;  3EN8 A;  4LEH A;  2CKF B;  2P0X A;  1VZZ A;  5DRV A;  1BNE A;  3LZA A;  5EEO A;  2OTL 3;  1VQ5 3;  3KKG A;  4XBY A;  4STD A;  1UCL A;  3X41 A;  1A2P A;  1RMS A;  4DMG A;  2RCD A;  5D81 A;  1W2B 2;  2KXG A;  1K8A 4;  1HYF A;  1OPY A;  1Q9E A;  5AYS C;  4ZM8 A;  4I4K A;  1CYU A;  2FNQ A;  2LYX A;  1MGR A;  2W56 B;  3DGM A;  1ASK A;  3H3H A;  1ZE2 A;  2O9U X;  3DXO A;  1LQM B;  2CX1 A;  5CK6 A;  1FGR A;  3DY5 A;  1RCK A;  1FZU A;  3FLJ A;  5KP1 A;  4EYC A;  3Q2P A;  4MMZ B;  3URP A;  3PYJ A;  4J5K A;  2OTJ 3;  3BIR A;  1UCI A;  3NXJ A;  4N6N B;  1JB2 A;  3CCJ 3;  1C7H A;  1IU7 A;  1WQL B;  1BNJ A;  1Q40 A;  1RNB A;  3UNL A;  1TE7 A;  5BVB A;  4HAA A;  1IQ8 A;  1EA2 A;  1JN5 B;  3EBT A;  1YJ9 3;  1V74 A;  3M4X A;  1OF5 B;  2F5M A;  2CG1 A;  5M18 A;  1K41 A;  1IT8 A;  1NO3 A;  1RGF A;  2PNC A;  4IIA A;  2CX0 A;  4Q53 A;  2CK3 H;  3SYU A;  3CCE 3;  2UX0 A;  2QGU A;  1E3R A;  1DET A;  1CEW I;  1MNL A;  3LTA A;  3S29 A;  1STF I;  1BIR A;  1QAL A;  1ZX2 A;  4WFO A;  3AHW A;  3CC2 3;  3KSE D;  1JZD A;  1RHL A;  3IJE B;  3EC9 A;  3HJY A;  2ANE A;  5D82 A;  4XBT A;  2W04 A;  1KQS 2;  3LTC A;  2YFL B;  3FZW A;  1UUG B;  1WK2 A;  1IV7 A;  2CFW A;  3EF8 A;  3OXA A;  3HOH A;  2AB4 A;  5AEW B;  1QVG 2;  2FXT A;  1DMQ A;  1B3S A;  1SII A;  2BIR A;  1GMR A;  2IUK A;  5ELJ A;  2CFG A;  3WHO A;  2M7O A;  5JPP A;  1VQ8 3;  5M19 A;  3EJV A;  4IT7 A;  1T2H A;  2XSO B;  3CME 3;  2HMM B;  2IMJ A;  2GBW B;  2CWW A;  3CNX A;  4HM6 B;  3X3X A;  3WOF B;  2R4I A;  5IEP A;  1TTO A;  1W6Y A;  3MHE A;  4BIR A;  1Q81 4;  2AS0 A;  3DH2 A;  5RNT A;  1GSP A;  1O7W B;  2B24 B;  3MYT A;  1BUJ A;  1X1Y A;  1WMO A;  3BU4 A;  1HU9 A;  4U13 A;  1LNI A;  1RJO A;  1UW1 A;  4CCV A;  1YNV X;  1RGG A;  1OGX A;  1TRP A;  3JUO A;  2AAE A;  4L8O A;  2KF5 A;  3SX1 A;  2AUS A;  3OWY A;  2RFK A;  2F5W A;  3UL6 A;  7STD A;  1UCJ A;  4H3U A;  4GL6 A;  2C11 A;  4K61 A;  1CQS A;  1GS3 A;  5G1K A;  3F14 A;  1RGH A;  3QK9 A;  3LT8 A;  4HM8 B;  1E97 A;  5CF2 A;  5I97 A;  2C10 A;  4CPK A;  1D6Y A;  3K0Z A;  4K1V A;  5IEO A;  3U97 A;  1SIH A;  2P09 A;  4RNT A;  1EKM A;  3LWV A;  4R9K A;  2KCD A;  4TX4 A;  3S67 A;  9RNT A;  3I56 3;  3PCR A;  4OK0 A;  3FKA A;  1IVU A;  1JZO A;  3AMO B;  1BGS A;  1BRJ A;  1OCV A;  1XNE A;  1OHP A;  3D5G A;  1I3F A;  4KFF A;  1W4N A;  3OWU A;  3CPO A;  2XRX B;  1JKG A;  1STD A;  1X1X A;  2BO9 B;  3N54 B;  4HM3 B;  3ZV0 C;  2YFI B;  4J8T A;  1N5P A;  4FMD A;  3VSE A;  4O02 B;  4DKI A;  1RCL A;  2P05 A;  3Q3F A;  1RGL A;  1ROV A;  3F40 A;  4GSP A;  4EC6 A;  4KVH A;  2HVY A;  3CCQ 3;  4N6O B;  5A0O B;  3VSY A;  2BMQ B;  3LOY A;  4CI2 B;  3DUK A;  4I5Q A;  4RBN A;  2W2C A;  1R3E A;  1RRH A;  3S27 A;  1TP6 A;  3VF1 A;  1MGW A;  4H61 A;  1B2M A;  5AIF A;  1CH0 A;  2QA4 3;  3BB9 A;  3UL5 A;  1IK3 A;  3ROB A;  1A90 A;  3BLZ A;  1V58 A;  3FGY A;  3KFQ C;  1YIJ 3;  1O7N B;  3CC7 3;  2O3O A;  3IUW A;  3D3L A;  3CU3 A;  3LTD A;  1RGE A;  2BMO B;  1VQ7 3;  3JUN A;  5ELU A;  5EVH A;  4OVM A;  2W03 A;  1I0X A;  1K8W A;  3NQZ A;  5AEU B;  3SOA A;  3LWP A;  4EV5 A;  2Y74 A;  1ZS7 A;  2KRT A;  5IG4 A;  1RGK A;  2SAR A;  1HZ1 A;  1SJW A;  3LWQ A;  1LOX A;  1O7H B;  3JUM A;  2BT3 A;  3DGY A;  1R3F A;  2KKU A;  1UCK A;  1L5G B;  2FGT A;  7GSP A;  1YVB I;  1GMP A;  1GY5 A;  1I2E A;  1KSI A;  1MWU A;  1ZL3 A;  2B1X B;  4CI3 B;  3FG3 A;  1NB3 I;  1M1K 4;  4N6L A;  3T8U A;  1RGA A;  4LSO A;  1WXX A;  2GXF A;  2YX9 A;  1IYY A;  3PCS A;  1LOY A;  4O2H A;  1MWT A;  4N6T A;  3CC4 3;  5STD A;  1ROA A;  3HAX A;  3WA2 X;  4BTY A;  1RN4 A;  2CFD A;  4L7K A;  3MQK A;  1JBR A;  2KF3 A;  4ORL A;  1LVN A;  3UB1 A;  5IG5 A;  2RGQ A;  2JDI H;  1D6Z A;  1M9G A;  5KP3 A;  1W2Z A;  1Q7H A;  1PYL A;  3HZP A;  3AHS A;  5BIR A;  4K90 B;  1YJN 3;  1UGI A;  3AGO A;  2KF6 A;  4HM0 B;  3BNE A;  3KZT A;  4FMB A;  3V92 A;  4CJN A;  2ML6 A;  5HGR A;  1UI8 A;  1RTU A;  2GU3 A;  3LWO A;  2W56 A;  5CXO A;  3G4S 3;  3I55 3;  3MKI A;  1KC8 4;  4TZ4 C;  3M6X A;  3FCS B;  1Q42 A;  4NHF A;  1K9M 4;  2F98 A;  1WTH A;  1B20 A;  2YFJ B;  4KFD A;  1ZO2 A;  3ZG0 A;  2APO A;  2H0H A;  3M8C A;  5IEN A;  4MMX B;  2SBL A;  4WYK B;  1FYS A;  1SPU A;  3AGN A;  3T0U A;  4G1M B;  1OH0 A;  3G71 3;  4XDV A;  1QVF 2;  2BNG A;  1R4C A;  1JBT A;  1LQG C;  4HYZ A;  4AEQ A;  1NNV A;  3MWZ A;  2EY4 A;  3KII A;  1R4Y A;  1VQM 3;  2AAD A;  1I3I A;  1FUT A;  3LJC A;  1UUW B;  1W7C A;  1Q7Y 4;  3A76 A;  7RNT A;  1N9J A;  2XGL A;  4R1K A;  1S72 3;  1RSN A;  3NUV A;  5G1L A;  1E3V A;  3NX0 A;  5BU4 A;  1BSE A;  4BTX A;  5GSP A;  2P38 A;  1BSD A;  3LML A;  3NBJ A;  2MF7 A;  1G0T A;  1GOY A;  2W6J H;  1Q86 4;  2H0G A;  3D5I A;  1BAN A;  1Y4K A;  3KN4 A;  1TFO A;  1B2U A;  4O3V A;  1DVC A;  3IMA B;  3JVC A;  1FGQ A;  3U28 A;  4N6V 0;  2OOV A;  1VQK 3;  1WXW A;  1IDP A;  1ZBO A;  1OUN A;  4KT3 B;  1D6U A;  2DP9 A;  4HM7 B;  1KWI A;  1S5A A;  4RNZ A;  1TUH A;  4HM2 B;  4HBR A;  3X3Y A;  5JPU A;  1LOV A;  2ZL8 A;  3RDE A;  1N5H A;  3CCS 3;  1I2G A;  3MSO A;  3F7S A;  1C54 A;  1GY6 A;  4R80 A;  3LDF A;  3MG1 A;  3NBR A;  5BXQ A;  2GEY A;  4HZB B;  2FRX A;  1ZE1 A;  1I0V A;  1AY7 A;  4N3V A;  1RKY A;  3O8Y A;  1TIJ A;  1RLS A;  2CIU A;  3EHC A;  1BRI A;  1FUS A;  3GWR A;  4KZ1 A;  4OUQ A;  3RGR A;  3KSP A;  3V98 A; 
#chains in the Genus database with same CATH homology
 2B78 A;  2CX0 A;  4DMG A;  2AS0 A;  1WXX A;  3C0K A;  1ZE2 A;  2J5T A;  2Q07 A;  1WXW A;  2CX1 A;  2J5V A;  1SQW A;  3VSE A;  3D79 A;  4Q1T A;  1T5Y A;  1J2B A;  1K8W A;  2AB4 A;  1ZS7 A;  3UAI A;  1SGV A;  1Q7H A;  3LDF A;  1ZE1 A;  1R3F A;  1R3E A;  1IQ8 A;  1IT7 A;  2CWW A;  1ZL3 A;  2P38 A;  1IT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...