1ZS7A

The structure of gene product ape0525 from aeropyrum pernix
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
187
structure length
187
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGKRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of gene product APE0525 from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
total genus 51
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1zs7A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1zs7A01
3VSEA 4Q1TA 3D79A 1IQ8A 1J2BA 2J5TA 3LDFA 1T5YA 4DMGA 1R3FA 1K8WA 3C0KA 1SGVA 1ZS7A 2Q07A 1SQWA 2B78A 2AS0A 2J5VA 1WXXA 1IT7A 1ZE2A 2CX1A 2AB4A 1WXWA 1R3EA 2CX0A 2P38A 3UAIA 1ZL3A 1ZE1A 1Q7HA 2CWWA 1IT8A
chains in the Genus database with same CATH superfamily
5IG4A 9RNTA 3SXXA 3D79A 4AEQA 2OTJ3 1X1UA 3DXOA 3F14A 1LRAA 2J5TA 4CI3B 4EW5A 1AY7A 1MWUA 2CG0A 3SVAA 1FUTA 1TJDA 3NV0A 1A67A 3DMCA 3JUQA 8CHOA 3NHXA 5BXQA 5AI1A 1FYSA 1R4CA 1STDA 4GHOA 3LZAA 2JDIH 3BU4A 1DYUA 1TRPA 3F40A 5D81A 2APOA 1OUNA 1G96A 1Q40A 1EKMA 2GEYA 3DGYA 3GRDA 1XNEA 3CNXA 3WDGB 1HYFA 5ELJA 6GSPA 3WOEB 1B3SA 4KZ1A 2HOHA 1SJWA 1DVDA 3H3HA 7RNTA 2R4IA 3V98A 3WA3A 2CWVA 2O9UX 4AKYA 1GD3A 4HKVB 1W6YA 4HYZA 4U13A 1RKYA 4R1KA 1SPUA 3SLUA 1DMMA 1RJOA 3LDFA 2E2TA 3IJEB 4J9AA 1UUVB 1OPYA 3FF0A 3VGNA 1AQZA 3G16A 1OACA 1G0TA 2W2CA 4R80A 3N54B 2Q07A 1DE3A 5D83A 3NUVA 3NBBA 1K28A 3PXMA 1QAFA 2XH9A 5CXOA 1U8CB 3EBTA 4KVHA 4LMIA 1YJ93 1MGWA 2OTL3 2IYJA 2PNCA 5LC7A 3LTDA 4R4KA 1X1YA 1IV7A 1NB3I 1FW7A 3HJWA 1D6YA 3KKGA 3SOAA 3HI7A 2CWWA 1B27A 3EB8A 3WODG 3B8LA 1UCKA 3CU3A 3I0YA 3NXJA 4OUQA 2F5MA 1ASKA 4HAAA 2RSXA 2BIRA 1GSPA 1MWTA 1Q824 1S04A 4XDWA 2XGLA 3KFQC 3UNLA 1S5AA 3MG2A 1OGZA 3FLJA 4BTYA 3OXAA 3S28A 3CMA3 1CYVA 5IENA 5M18A 3MWZA 1VQP3 4PEJA 1O7WB 1HU9A 1UOYA 2AS0A 3ALAA 2J5VA 4WYKB 5M19A 3B7CA 3FG1A 3EX9A 4H61A 3DUKA 2JQ5A 3CXC2 1N9EA 3NQYA 2HMNB 2AB4A 3E99A 1LOWA 2CC3A 3K9MC 1I70A 2ML6A 3BNEA 5HOHA 3SOYA 2AAEA 1ROVA 3RNTA 4CI1B 3M6XA 4TZ4C 3EHCA 3LOYA 3ZV0C 4EXRA 3GSPA 1FGQA 2BMQB 2HMKB 3PGBA 4H3UA 3WMDA 3O8YA 2INXA 1W2B2 2XSHB 1W4NA 2I9WA 2F99A 1R3FA 3B4PA 2HMJB 4J5GA 3KZTA 1SGVA 1US1A 2Z76A 4GB5A 4STDA 1UI8A 5M1AA 1B20A 1GS3A 1TU5A 4BL3A 1FUWA 4JRFA 1R4YA 1RHLA 1GY5A 3Q2PA 3FCSB 3CC23 1NJI4 5AYSC 3LT9A 4EBGA 2XFSA 1B2UA 1RN7A 1ZBOA 1M904 1V57A 3BB9A 2PZVA 3GZXB 2P38A 2BMOB 3DGLA 3PZWA 1FGMA 1VQL3 3X40A 1WQLB 1YIT3 3X42A 1AV4A 1YVSA 4ORLA 1RNBA 1JBSA 1VQ93 3H51A 1VQ83 1SARA 4N6UA 1OHSA 2GEXA 1BUJA 1K9M4 1UUGB 3UL5A 4HM2B 1VQ53 3NV0B 1LQGC 3F8HA 3X41A 2CFDA 3FG3A 3LT8A 3STDA 1KC84 4FMCA 3HZPA 4CCVA 3NX0A 1A2PA 3I553 3T8UA 2RFRA 1CYUA 1O7GB 2L4VA 1BNEA 1UCLA 4FMBA 3EC9A 4N6LA 3N9HA 1HZ1A 1W00A 3S29A 1LOVA 2R41A 3CCL3 2P0XA 2W9PA 1IV9A 4KFDA 2W9QA 1BVIA 3FGYA 1IU7A 4HBRA 4NHFA 4XBTA 1JV2B 1GMQA 3F8XA 3BNCA 5D82A 1OH0A 1JRQA 1W5ZA 2OWPA 3CNMA 1WMOA 1ZL3A 3KE7A 5G1LA 3BIRA 2MC8A 2YFLB 2K54A 1W7CA 1RCKA 2EY4A 1GOYA 2FNQA 3GZYB 3QRDA 3SEDA 4OVMA 1TE7A 1KSIA 2P0MA 1FGTA 4J8TA 1RGAA 3RGRA 3PCRA 3KCHA 4EV5A 1OHOA 1Z1SA 5JPPA 1RLSA 1RGHA 4R9LA 3C0KA 2E2UA 1SQWA 6STDA 3U28A 4BTXA 1S723 1N9JA 1YNVX 1T2HA 2CH9A 2ZHXB 4HJLB 3U97A 2B1XB 3NBJA 2RNTA 1BRIA 3FKAA 5BU4A 3ZG5A 1I2FA 2CHCA 5AYRB 3CC73 3BNDA 2HMLB 1WXWA 3MKIA 3OWYA 1BNGA 3RDEA 3SYUA 1VQQA 1LVNA 3M8CA 4RNYA 2K3DA 3D5IA 4HM0B 4HM6B 1WMNA 2C4BA 2XFTA 3VF1A 3I563 4EYCA 3MPHA 1DVCA 3LWOA 2YFIB 4ZM8A 4CDLA 1RCLA 2GXFA 4FMAA 2KKUA 1AR0A 1I2EA 4FCZA 1RGEA 1M9GA 1NB5I 1ROAA 2GU1A 2UGIA 3MG1A 3LH4A 2HVYA 1N8R4 5EQLA 1EEJA 5DRVA 2CW9A 3HOHA 1MOLA 1BRJA 1RGFA 1VQM3 3HJYA 5FGOA 3QK9A 1BRSA 3T0UA 3B4OA 5IF6A 1YJN3 3CCR3 1BANA 1BRGA 1GMRA 3FH1A 1RN4A 4HVNA 1STFI 1ULJB 3PS8A 1IK3A 4AKZA 1JB5A 1MWSA 1OCVA 1X1WA 3Q3FA 1LXEA 1OHPA 1MNLA 2XEPA 5G2GA 4KFEA 3M4XA 3OW22 3JUNA 2A15A 1RDSA 1J2BA 3DGOA 5DREA 1DMNA 3MG3A 3LTBA 1IVVA 2GSPA 1BNIA 3AMOA 1JNQA 1OF5B 3HAXA 2OCTA 1BSEA 1E3RA 3LXUX 3AMOB 1U5OA 2B78A 2CKFB 1JB4A 2W6JH 3OWSA 1GD4A 4K61A 1L5GB 5IEPA 3KSPA 3MHEA 1YIJ3 3DY5A 6RNTA 4TX4A 1VZZA 1T2IA 3EQQB 3HIIA 2ZL8A 2D1WA 3RGAA 1IYYA 2HMOB 1KWIA 4HM7B 1Q7Y4 2WO0A 4HM5B 1QVF2 3WOFB 5KP3A 1ZE1A 1Q7HA 5JPUA 2P05A 3UJMA 1NNVA 7STDA 3PYJA 4NPBA 1BRNL 2IMJA 1EG9B 2RBIA 2QEX3 1BSDA 2QGUA 2XSOB 3LYGA 1M1K4 3IUWA 2MF7A 2W56B 4MMYB 1X1XA 4WHAA 2GBWB 3CCM3 4KT3B 4N6V0 3ECFA 1T5YA 3A5EA 1TUHA 1MWRA 4RZMA 3J7Yd 3LMLA 3SX1A 1TRQA 3CCS3 3V99A 1IQYA 1A2KA 3M65A 2ANEA 1BRKA 4XM4A 1JJ22 1LQMB 1I2GA 4N6NB 4XBYA 2QIYA 1A2VA 2H0IA 2BHMA 1YHQ3 3GAXA 1JB2A 3UL6A 1EA2A 1E3VA 3MYTA 2KF4A 1E97A 4J5KA 1RNTA 1RRHA 3D3LA 1BIRA 1Q40B 2YX9A 4WFOA 1N8QA 2CG1A 1VQ73 3JUMA 5KP1A 5G1KA 3ER7A 1YVBI 3LJCA 4MMZB 2HMMB 1CQSA 3VSYA 3JUPA 2XR8B 4HM4B 2FXTA 4FCJA 2O3OA 4CJNA 3WHOA 1JZDA 1NWWA 2CWUA 1KD14 3CPOA 3D9RA 1JBRA 3LWPA 2BU4A 2WOFA 4L8OA 5CLKA 2IUKA 4LGQA 2IA7A 1IT7A 3MSOA 3OV4A 5LC6A 1RGGA 1WK2A 4EC6A 3Q90A 5EVHA 2H0HA 4I4KA 1SIHA 1RTUA 1ULIB 1Q814 3AHWA 1W2ZA 2K0MA 2XF3A 1AVKA 3K7CA 4IPBA 2DP9A 2P09A 4LEHA 2OOVC 3N8BA 1FA3A 3L0RA 4N3VA 3OX9A 3KIIA 2F86B 1UDII 3GZRA 1QALA 2E2VA 1JBTA 3VSEA 1N5PA 2Y73A 1DMQA 1Y4KA 2F4YA 1F8NA 1TP6A 4IT7A 1YJW3 1IQ8A 2Z0TA 2CIUA 4XB5A 3CCU3 1HKXA 2STDA 1B21A 1IVUA 1VQ63 4DMGA 2XGNA 3FZWA 3WA2X 1O7HB 2V1LA 3G0KA 3X3YA 1UW1A 3U1WA 1W6CA 1V74A 4RNTA 3K63A 3LWRA 2F5WA 1TFKA 2RGQA 1BNSA 4O02B 5FW5A 5IG3A 2FRXA 1BAOA 8RNTA 2W0QA 1UUWB 4WYKA 3LTCA 5AEUB 3V92A 3CME3 2KXGA 3DGNA 1FZUA 4HM8B 1LOYA 1QJGA 3HK4A 3WR2A 5IG5A 2AADA 3K0ZA 4LZIA 3M6VA 1I0XA 2M7OA 4KFFA 5HGRA 1I3IA 3CCE3 1AVLA 4CI2B 1OF5A 4N6MA 1GY6A 3FSDA 2QA43 4BL2A 1KQS2 1C7HA 1M1XB 1CH0A 1UGIA 2BMRB 4DKIA 2C10A 1MGRA 2KCDA 2KRTA 1BU4A 1PYLA 3S27A 3ZG0A 1B2SA 2RFKA 2UX0A 4K1UA 3CCJ3 3G8ZA 1BOXA 3EE1A 4MMXB 4Q53A 4NREA 2L1SA 3EJVA 2CK3H 3IPTA 4XDVA 1O7PB 2Z6BA 5BVBA 4HM3B 1D6UA 4BTWA 2LYXA 1UCJA 1N5HA 3G6E3 1BSAA 1G02A 2F56A 3DZLA 2W56A 3EBYA 3K5TA 1RGKA 1TIJA 2OQEC 1GY7A 1JZOA 1Q9EA 1NDOB 4HM1B 3GZBA 4EV2A 3LWVA 3Q1CA 1UGHI 3EN8A 1V58A 1GOVA 2LQVA 2OOVA 2D42A 2WGQA 3D4AA 5IEOA 1LNHA 3TDGA 1VQ43 2B24B 2KF6A 1IDPA 3F7SA 3NM7A 3NQZA 3KN4A 4X2OA 1BUQA 1GOUA 3EF8A 2CWTA 4N6OB 3AGNA 2ML5A 2W03A 1R3EA 3AHSA 3M6UA 4GL6A 4K1VA 5IG0A 5AEWB 3CPW2 1ZX2A 2Y74A 1BNJA 1RMSA 1SIIA 1LNIA 2KF5A 3AGOA 1UI7A 4MEIA 5I97A 4R9KA 2BO9B 2C11A 3IMAB 3S5CA 5AIHA 1FUSA 4BIRA 3D5GA 2BT3A 3BNBA 5CK6A 3LWQA 5IW9A 3OWUA 3A76A 1QVG2 3M6WA 3EN1B 1TFOA 1W6GA 3F7XA 1PU4A 1YI23 1B2MA 3JVCA 2WOHA 2E5OA 3LTAA 5BIRA 4XBXA 1B2ZA 3S67A 4QWTA 1BGSA 2F98A 2W04A 2Z77A 3F9SA 3MQKA 2KF3A 3BLZA 4L7KA 2KAAA 4WP5A 4X2HA 1YGWA 2RCDA 1I0VA 3DH2A 4L8PA 3CCQ3 1IVWA 3UAIA 1K41A 1VQN3 1C54A 1IQXA 2BNGA 1A90A 3GWRA 2GU3A 2ZA4A 2ZDJA 3NM2A 1I8VA 4Q1TA 5CF2A 1OGXA 1PY3A 4GSPA 1EUIC 3T8NA 1YGEA 2UUGC 4JF8A 4O8SA 5TGNA 3UB1A 1FGRA 3X3XA 3ZFZA 3G713 3DM8A 1ZO2A 3CCV3 1BSBA 1IVXA 2WGOA 3CD63 4O2HA 4FCMA 1QAKA 2FGTA 1RSNA 1WTHA 4HZ9B 1Q864 1WXXA 4RBNA 1ISKA 1NU3A 1W01A 1BRHA 3FF2A 5IERA 4G1MB 1DETA 4MJDA 5AIFA 5CF1A 1ZE2A 3FG4A 4HOHA 1GMPA 1LOXA 3JUOA 4FMDA 4FR9A 1QMAA 2J8XB 2CX0A 2CFWA 5AIIA 3URPA 2AUSA 2IUJA 1BNFA 1PFPA 1GYBA 1EQKA 1UCIA 3NBRA 4RNZA 1Q42A 5JBSA 1RGLA 1TTOA 3G4S3 5RNTA 1CEWI 1B2XA 1FGOA 1BNRA 1O7NB 1O7MB 2GBXB 3X3ZA 2Z7AA 4WWUC 1WNHA 2SBLA 1RGCA 1VQO3 1WMPA 3HIGA 4IIAA 4O3VA 4OK0A 1K8WA 5STDA 3CC43 5EEOA 1ZGXA 2SARA 1T3BA 1RRLA 1ZS7A 1RN1A 4BU4A 1W02A 1VQK3 1D6ZA 2XRXB 3HX8A 4LYLB 1I3FA 1JKGB 1JN5B 3KSED 1NO3A 5AIGA 3PCSA 7GSPA 5GSPA 1BSCA 2CFLA 3ROBA 1K8A4 2CFGA 2YFJB 2CX1A 1JN5A 1JKGA 2CFKA 5A0OB 4HZBB 4ILFA 4I5QA 5ELUA 2H0GA 3DGMA 2OQEA 4LSOA 4K90B 1K734 5KP4A 4CPKA 2IY2A 4N6TA 1IT8A
chains in the Genus database with same CATH topology
3VSEA 4Q1TA 3D79A 1IQ8A 1J2BA 2J5TA 3LDFA 1T5YA 4DMGA 1R3FA 1K8WA 3C0KA 1SGVA 1ZS7A 2Q07A 1SQWA 2B78A 2AS0A 2J5VA 1WXXA 1IT7A 1ZE2A 2CX1A 2AB4A 1WXWA 1R3EA 2CX0A 2P38A 3UAIA 1ZL3A 1ZE1A 1Q7HA 2CWWA 1IT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSE A;  4Q1T A;  3D79 A;  1IQ8 A;  1J2B A;  2J5T A;  3LDF A;  1T5Y A;  4DMG A;  1R3F A;  1K8W A;  3C0K A;  1SGV A;  1ZS7 A;  2Q07 A;  1SQW A;  2B78 A;  2AS0 A;  2J5V A;  1WXX A;  1IT7 A;  1ZE2 A;  2CX1 A;  2AB4 A;  1WXW A;  1R3E A;  2CX0 A;  2P38 A;  3UAI A;  1ZL3 A;  1ZE1 A;  1Q7H A;  2CWW A;  1IT8 A; 
#chains in the Genus database with same CATH topology
 5IG4 A;  9RNT A;  3SXX A;  3D79 A;  4AEQ A;  2OTJ 3;  1X1U A;  3DXO A;  3F14 A;  1LRA A;  2J5T A;  4CI3 B;  4EW5 A;  1AY7 A;  1MWU A;  2CG0 A;  3SVA A;  1FUT A;  1TJD A;  3NV0 A;  1A67 A;  3DMC A;  3JUQ A;  8CHO A;  3NHX A;  5BXQ A;  5AI1 A;  1FYS A;  1R4C A;  1STD A;  4GHO A;  3LZA A;  2JDI H;  3BU4 A;  1DYU A;  1TRP A;  3F40 A;  5D81 A;  2APO A;  1OUN A;  1G96 A;  1Q40 A;  1EKM A;  2GEY A;  3DGY A;  3GRD A;  1XNE A;  3CNX A;  3WDG B;  1HYF A;  5ELJ A;  6GSP A;  3WOE B;  1B3S A;  4KZ1 A;  2HOH A;  1SJW A;  1DVD A;  3H3H A;  7RNT A;  2R4I A;  3V98 A;  3WA3 A;  2CWV A;  2O9U X;  4AKY A;  1GD3 A;  4HKV B;  1W6Y A;  4HYZ A;  4U13 A;  1RKY A;  4R1K A;  1SPU A;  3SLU A;  1DMM A;  1RJO A;  3LDF A;  2E2T A;  3IJE B;  4J9A A;  1UUV B;  1OPY A;  3FF0 A;  3VGN A;  1AQZ A;  3G16 A;  1OAC A;  1G0T A;  2W2C A;  4R80 A;  3N54 B;  2Q07 A;  1DE3 A;  5D83 A;  3NUV A;  3NBB A;  1K28 A;  3PXM A;  1QAF A;  2XH9 A;  5CXO A;  1U8C B;  3EBT A;  4KVH A;  4LMI A;  1YJ9 3;  1MGW A;  2OTL 3;  2IYJ A;  2PNC A;  5LC7 A;  3LTD A;  4R4K A;  1X1Y A;  1IV7 A;  1NB3 I;  1FW7 A;  3HJW A;  1D6Y A;  3KKG A;  3SOA A;  3HI7 A;  2CWW A;  1B27 A;  3EB8 A;  3WOD G;  3B8L A;  1UCK A;  3CU3 A;  3I0Y A;  3NXJ A;  4OUQ A;  2F5M A;  1ASK A;  4HAA A;  2RSX A;  2BIR A;  1GSP A;  1MWT A;  1Q82 4;  1S04 A;  4XDW A;  2XGL A;  3KFQ C;  3UNL A;  1S5A A;  3MG2 A;  1OGZ A;  3FLJ A;  4BTY A;  3OXA A;  3S28 A;  3CMA 3;  1CYV A;  5IEN A;  5M18 A;  3MWZ A;  1VQP 3;  4PEJ A;  1O7W B;  1HU9 A;  1UOY A;  2AS0 A;  3ALA A;  2J5V A;  4WYK B;  5M19 A;  3B7C A;  3FG1 A;  3EX9 A;  4H61 A;  3DUK A;  2JQ5 A;  3CXC 2;  1N9E A;  3NQY A;  2HMN B;  2AB4 A;  3E99 A;  1LOW A;  2CC3 A;  3K9M C;  1I70 A;  2ML6 A;  3BNE A;  5HOH A;  3SOY A;  2AAE A;  1ROV A;  3RNT A;  4CI1 B;  3M6X A;  4TZ4 C;  3EHC A;  3LOY A;  3ZV0 C;  4EXR A;  3GSP A;  1FGQ A;  2BMQ B;  2HMK B;  3PGB A;  4H3U A;  3WMD A;  3O8Y A;  2INX A;  1W2B 2;  2XSH B;  1W4N A;  2I9W A;  2F99 A;  1R3F A;  3B4P A;  2HMJ B;  4J5G A;  3KZT A;  1SGV A;  1US1 A;  2Z76 A;  4GB5 A;  4STD A;  1UI8 A;  5M1A A;  1B20 A;  1GS3 A;  1TU5 A;  4BL3 A;  1FUW A;  4JRF A;  1R4Y A;  1RHL A;  1GY5 A;  3Q2P A;  3FCS B;  3CC2 3;  1NJI 4;  5AYS C;  3LT9 A;  4EBG A;  2XFS A;  1B2U A;  1RN7 A;  1ZBO A;  1M90 4;  1V57 A;  3BB9 A;  2PZV A;  3GZX B;  2P38 A;  2BMO B;  3DGL A;  3PZW A;  1FGM A;  1VQL 3;  3X40 A;  1WQL B;  1YIT 3;  3X42 A;  1AV4 A;  1YVS A;  4ORL A;  1RNB A;  1JBS A;  1VQ9 3;  3H51 A;  1VQ8 3;  1SAR A;  4N6U A;  1OHS A;  2GEX A;  1BUJ A;  1K9M 4;  1UUG B;  3UL5 A;  4HM2 B;  1VQ5 3;  3NV0 B;  1LQG C;  3F8H A;  3X41 A;  2CFD A;  3FG3 A;  3LT8 A;  3STD A;  1KC8 4;  4FMC A;  3HZP A;  4CCV A;  3NX0 A;  1A2P A;  3I55 3;  3T8U A;  2RFR A;  1CYU A;  1O7G B;  2L4V A;  1BNE A;  1UCL A;  4FMB A;  3EC9 A;  4N6L A;  3N9H A;  1HZ1 A;  1W00 A;  3S29 A;  1LOV A;  2R41 A;  3CCL 3;  2P0X A;  2W9P A;  1IV9 A;  4KFD A;  2W9Q A;  1BVI A;  3FGY A;  1IU7 A;  4HBR A;  4NHF A;  4XBT A;  1JV2 B;  1GMQ A;  3F8X A;  3BNC A;  5D82 A;  1OH0 A;  1JRQ A;  1W5Z A;  2OWP A;  3CNM A;  1WMO A;  1ZL3 A;  3KE7 A;  5G1L A;  3BIR A;  2MC8 A;  2YFL B;  2K54 A;  1W7C A;  1RCK A;  2EY4 A;  1GOY A;  2FNQ A;  3GZY B;  3QRD A;  3SED A;  4OVM A;  1TE7 A;  1KSI A;  2P0M A;  1FGT A;  4J8T A;  1RGA A;  3RGR A;  3PCR A;  3KCH A;  4EV5 A;  1OHO A;  1Z1S A;  5JPP A;  1RLS A;  1RGH A;  4R9L A;  3C0K A;  2E2U A;  1SQW A;  6STD A;  3U28 A;  4BTX A;  1S72 3;  1N9J A;  1YNV X;  1T2H A;  2CH9 A;  2ZHX B;  4HJL B;  3U97 A;  2B1X B;  3NBJ A;  2RNT A;  1BRI A;  3FKA A;  5BU4 A;  3ZG5 A;  1I2F A;  2CHC A;  5AYR B;  3CC7 3;  3BND A;  2HML B;  1WXW A;  3MKI A;  3OWY A;  1BNG A;  3RDE A;  3SYU A;  1VQQ A;  1LVN A;  3M8C A;  4RNY A;  2K3D A;  3D5I A;  4HM0 B;  4HM6 B;  1WMN A;  2C4B A;  2XFT A;  3VF1 A;  3I56 3;  4EYC A;  3MPH A;  1DVC A;  3LWO A;  2YFI B;  4ZM8 A;  4CDL A;  1RCL A;  2GXF A;  4FMA A;  2KKU A;  1AR0 A;  1I2E A;  4FCZ A;  1RGE A;  1M9G A;  1NB5 I;  1ROA A;  2GU1 A;  2UGI A;  3MG1 A;  3LH4 A;  2HVY A;  1N8R 4;  5EQL A;  1EEJ A;  5DRV A;  2CW9 A;  3HOH A;  1MOL A;  1BRJ A;  1RGF A;  1VQM 3;  3HJY A;  5FGO A;  3QK9 A;  1BRS A;  3T0U A;  3B4O A;  5IF6 A;  1YJN 3;  3CCR 3;  1BAN A;  1BRG A;  1GMR A;  3FH1 A;  1RN4 A;  4HVN A;  1STF I;  1ULJ B;  3PS8 A;  1IK3 A;  4AKZ A;  1JB5 A;  1MWS A;  1OCV A;  1X1W A;  3Q3F A;  1LXE A;  1OHP A;  1MNL A;  2XEP A;  5G2G A;  4KFE A;  3M4X A;  3OW2 2;  3JUN A;  2A15 A;  1RDS A;  1J2B A;  3DGO A;  5DRE A;  1DMN A;  3MG3 A;  3LTB A;  1IVV A;  2GSP A;  1BNI A;  3AMO A;  1JNQ A;  1OF5 B;  3HAX A;  2OCT A;  1BSE A;  1E3R A;  3LXU X;  3AMO B;  1U5O A;  2B78 A;  2CKF B;  1JB4 A;  2W6J H;  3OWS A;  1GD4 A;  4K61 A;  1L5G B;  5IEP A;  3KSP A;  3MHE A;  1YIJ 3;  3DY5 A;  6RNT A;  4TX4 A;  1VZZ A;  1T2I A;  3EQQ B;  3HII A;  2ZL8 A;  2D1W A;  3RGA A;  1IYY A;  2HMO B;  1KWI A;  4HM7 B;  1Q7Y 4;  2WO0 A;  4HM5 B;  1QVF 2;  3WOF B;  5KP3 A;  1ZE1 A;  1Q7H A;  5JPU A;  2P05 A;  3UJM A;  1NNV A;  7STD A;  3PYJ A;  4NPB A;  1BRN L;  2IMJ A;  1EG9 B;  2RBI A;  2QEX 3;  1BSD A;  2QGU A;  2XSO B;  3LYG A;  1M1K 4;  3IUW A;  2MF7 A;  2W56 B;  4MMY B;  1X1X A;  4WHA A;  2GBW B;  3CCM 3;  4KT3 B;  4N6V 0;  3ECF A;  1T5Y A;  3A5E A;  1TUH A;  1MWR A;  4RZM A;  3J7Y d;  3LML A;  3SX1 A;  1TRQ A;  3CCS 3;  3V99 A;  1IQY A;  1A2K A;  3M65 A;  2ANE A;  1BRK A;  4XM4 A;  1JJ2 2;  1LQM B;  1I2G A;  4N6N B;  4XBY A;  2QIY A;  1A2V A;  2H0I A;  2BHM A;  1YHQ 3;  3GAX A;  1JB2 A;  3UL6 A;  1EA2 A;  1E3V A;  3MYT A;  2KF4 A;  1E97 A;  4J5K A;  1RNT A;  1RRH A;  3D3L A;  1BIR A;  1Q40 B;  2YX9 A;  4WFO A;  1N8Q A;  2CG1 A;  1VQ7 3;  3JUM A;  5KP1 A;  5G1K A;  3ER7 A;  1YVB I;  3LJC A;  4MMZ B;  2HMM B;  1CQS A;  3VSY A;  3JUP A;  2XR8 B;  4HM4 B;  2FXT A;  4FCJ A;  2O3O A;  4CJN A;  3WHO A;  1JZD A;  1NWW A;  2CWU A;  1KD1 4;  3CPO A;  3D9R A;  1JBR A;  3LWP A;  2BU4 A;  2WOF A;  4L8O A;  5CLK A;  2IUK A;  4LGQ A;  2IA7 A;  1IT7 A;  3MSO A;  3OV4 A;  5LC6 A;  1RGG A;  1WK2 A;  4EC6 A;  3Q90 A;  5EVH A;  2H0H A;  4I4K A;  1SIH A;  1RTU A;  1ULI B;  1Q81 4;  3AHW A;  1W2Z A;  2K0M A;  2XF3 A;  1AVK A;  3K7C A;  4IPB A;  2DP9 A;  2P09 A;  4LEH A;  2OOV C;  3N8B A;  1FA3 A;  3L0R A;  4N3V A;  3OX9 A;  3KII A;  2F86 B;  1UDI I;  3GZR A;  1QAL A;  2E2V A;  1JBT A;  3VSE A;  1N5P A;  2Y73 A;  1DMQ A;  1Y4K A;  2F4Y A;  1F8N A;  1TP6 A;  4IT7 A;  1YJW 3;  1IQ8 A;  2Z0T A;  2CIU A;  4XB5 A;  3CCU 3;  1HKX A;  2STD A;  1B21 A;  1IVU A;  1VQ6 3;  4DMG A;  2XGN A;  3FZW A;  3WA2 X;  1O7H B;  2V1L A;  3G0K A;  3X3Y A;  1UW1 A;  3U1W A;  1W6C A;  1V74 A;  4RNT A;  3K63 A;  3LWR A;  2F5W A;  1TFK A;  2RGQ A;  1BNS A;  4O02 B;  5FW5 A;  5IG3 A;  2FRX A;  1BAO A;  8RNT A;  2W0Q A;  1UUW B;  4WYK A;  3LTC A;  5AEU B;  3V92 A;  3CME 3;  2KXG A;  3DGN A;  1FZU A;  4HM8 B;  1LOY A;  1QJG A;  3HK4 A;  3WR2 A;  5IG5 A;  2AAD A;  3K0Z A;  4LZI A;  3M6V A;  1I0X A;  2M7O A;  4KFF A;  5HGR A;  1I3I A;  3CCE 3;  1AVL A;  4CI2 B;  1OF5 A;  4N6M A;  1GY6 A;  3FSD A;  2QA4 3;  4BL2 A;  1KQS 2;  1C7H A;  1M1X B;  1CH0 A;  1UGI A;  2BMR B;  4DKI A;  2C10 A;  1MGR A;  2KCD A;  2KRT A;  1BU4 A;  1PYL A;  3S27 A;  3ZG0 A;  1B2S A;  2RFK A;  2UX0 A;  4K1U A;  3CCJ 3;  3G8Z A;  1BOX A;  3EE1 A;  4MMX B;  4Q53 A;  4NRE A;  2L1S A;  3EJV A;  2CK3 H;  3IPT A;  4XDV A;  1O7P B;  2Z6B A;  5BVB A;  4HM3 B;  1D6U A;  4BTW A;  2LYX A;  1UCJ A;  1N5H A;  3G6E 3;  1BSA A;  1G02 A;  2F56 A;  3DZL A;  2W56 A;  3EBY A;  3K5T A;  1RGK A;  1TIJ A;  2OQE C;  1GY7 A;  1JZO A;  1Q9E A;  1NDO B;  4HM1 B;  3GZB A;  4EV2 A;  3LWV A;  3Q1C A;  1UGH I;  3EN8 A;  1V58 A;  1GOV A;  2LQV A;  2OOV A;  2D42 A;  2WGQ A;  3D4A A;  5IEO A;  1LNH A;  3TDG A;  1VQ4 3;  2B24 B;  2KF6 A;  1IDP A;  3F7S A;  3NM7 A;  3NQZ A;  3KN4 A;  4X2O A;  1BUQ A;  1GOU A;  3EF8 A;  2CWT A;  4N6O B;  3AGN A;  2ML5 A;  2W03 A;  1R3E A;  3AHS A;  3M6U A;  4GL6 A;  4K1V A;  5IG0 A;  5AEW B;  3CPW 2;  1ZX2 A;  2Y74 A;  1BNJ A;  1RMS A;  1SII A;  1LNI A;  2KF5 A;  3AGO A;  1UI7 A;  4MEI A;  5I97 A;  4R9K A;  2BO9 B;  2C11 A;  3IMA B;  3S5C A;  5AIH A;  1FUS A;  4BIR A;  3D5G A;  2BT3 A;  3BNB A;  5CK6 A;  3LWQ A;  5IW9 A;  3OWU A;  3A76 A;  1QVG 2;  3M6W A;  3EN1 B;  1TFO A;  1W6G A;  3F7X A;  1PU4 A;  1YI2 3;  1B2M A;  3JVC A;  2WOH A;  2E5O A;  3LTA A;  5BIR A;  4XBX A;  1B2Z A;  3S67 A;  4QWT A;  1BGS A;  2F98 A;  2W04 A;  2Z77 A;  3F9S A;  3MQK A;  2KF3 A;  3BLZ A;  4L7K A;  2KAA A;  4WP5 A;  4X2H A;  1YGW A;  2RCD A;  1I0V A;  3DH2 A;  4L8P A;  3CCQ 3;  1IVW A;  3UAI A;  1K41 A;  1VQN 3;  1C54 A;  1IQX A;  2BNG A;  1A90 A;  3GWR A;  2GU3 A;  2ZA4 A;  2ZDJ A;  3NM2 A;  1I8V A;  4Q1T A;  5CF2 A;  1OGX A;  1PY3 A;  4GSP A;  1EUI C;  3T8N A;  1YGE A;  2UUG C;  4JF8 A;  4O8S A;  5TGN A;  3UB1 A;  1FGR A;  3X3X A;  3ZFZ A;  3G71 3;  3DM8 A;  1ZO2 A;  3CCV 3;  1BSB A;  1IVX A;  2WGO A;  3CD6 3;  4O2H A;  4FCM A;  1QAK A;  2FGT A;  1RSN A;  1WTH A;  4HZ9 B;  1Q86 4;  1WXX A;  4RBN A;  1ISK A;  1NU3 A;  1W01 A;  1BRH A;  3FF2 A;  5IER A;  4G1M B;  1DET A;  4MJD A;  5AIF A;  5CF1 A;  1ZE2 A;  3FG4 A;  4HOH A;  1GMP A;  1LOX A;  3JUO A;  4FMD A;  4FR9 A;  1QMA A;  2J8X B;  2CX0 A;  2CFW A;  5AII A;  3URP A;  2AUS A;  2IUJ A;  1BNF A;  1PFP A;  1GYB A;  1EQK A;  1UCI A;  3NBR A;  4RNZ A;  1Q42 A;  5JBS A;  1RGL A;  1TTO A;  3G4S 3;  5RNT A;  1CEW I;  1B2X A;  1FGO A;  1BNR A;  1O7N B;  1O7M B;  2GBX B;  3X3Z A;  2Z7A A;  4WWU C;  1WNH A;  2SBL A;  1RGC A;  1VQO 3;  1WMP A;  3HIG A;  4IIA A;  4O3V A;  4OK0 A;  1K8W A;  5STD A;  3CC4 3;  5EEO A;  1ZGX A;  2SAR A;  1T3B A;  1RRL A;  1ZS7 A;  1RN1 A;  4BU4 A;  1W02 A;  1VQK 3;  1D6Z A;  2XRX B;  3HX8 A;  4LYL B;  1I3F A;  1JKG B;  1JN5 B;  3KSE D;  1NO3 A;  5AIG A;  3PCS A;  7GSP A;  5GSP A;  1BSC A;  2CFL A;  3ROB A;  1K8A 4;  2CFG A;  2YFJ B;  2CX1 A;  1JN5 A;  1JKG A;  2CFK A;  5A0O B;  4HZB B;  4ILF A;  4I5Q A;  5ELU A;  2H0G A;  3DGM A;  2OQE A;  4LSO A;  4K90 B;  1K73 4;  5KP4 A;  4CPK A;  2IY2 A;  4N6T A;  1IT8 A; 
#chains in the Genus database with same CATH homology
 3VSE A;  4Q1T A;  3D79 A;  1IQ8 A;  1J2B A;  2J5T A;  3LDF A;  1T5Y A;  4DMG A;  1R3F A;  1K8W A;  3C0K A;  1SGV A;  1ZS7 A;  2Q07 A;  1SQW A;  2B78 A;  2AS0 A;  2J5V A;  1WXX A;  1IT7 A;  1ZE2 A;  2CX1 A;  2AB4 A;  1WXW A;  1R3E A;  2CX0 A;  2P38 A;  3UAI A;  1ZL3 A;  1ZE1 A;  1Q7H A;  2CWW A;  1IT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...