1ZS7A

The structure of gene product ape0525 from aeropyrum pernix
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
187
structure length
187
Chain Sequence
HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGKRLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein APE0525
publication title The structure of gene product APE0525 from Aeropyrum pernix
rcsb
source organism Aeropyrum pernix
total genus 51
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1zs7A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1zs7A01
3LDFA 2CX0A 2P38A 1Q7HA 1K8WA 2CWWA 4Q1TA 1ZS7A 1IQ8A 1IT7A 2J5VA 1ZE2A 1ZL3A 3D79A 1ZE1A 2AB4A 1J2BA 1T5YA 1WXWA 2B78A 1SQWA 1R3EA 2J5TA 1IT8A 2CX1A 1R3FA 1WXXA 2AS0A 1SGVA 2Q07A 3UAIA 3C0KA 4DMGA 3VSEA
chains in the Genus database with same CATH superfamily
3HIIA 1Y4KA 1Q7HA 3F7SA 5EVHA 1TFOA 1AV4A 4HVNA 3LT8A 2F99A 5JPUA 3NV0A 3NM7A 2P0XA 3WDGB 1WMNA 1M904 3F8HA 1A2VA 2F86B 1ZL3A 1VQ93 1TUHA 1X1UA 3CPW2 1BRHA 3PXMA 4NREA 1JN5B 1G02A 2E2TA 2CFLA 2GSPA 2K0MA 3BNDA 1FGOA 2IMJA 3CU3A 3IUWA 3FZWA 1GOUA 2BT3A 3LOYA 2HVYA 1M9GA 5KP3A 3WR2A 3F8XA 1BRKA 2QIYA 1EG9B 1RMSA 2STDA 1TIJA 1US1A 1WNHA 2H0HA 1IVVA 5BU4A 1IT8A 5M1AA 2Z0TA 1SIHA 4LMIA 2QEX3 3DY5A 2YX9A 1OHOA 3LTDA 1A2KA 2H0IA 1JKGA 2FXTA 2IUKA 4FMCA 4RNZA 1KC84 4AEQA 4HM4B 3NHXA 4KFFA 4EV2A 4RZMA 1MWRA 8RNTA 3KCHA 5IEPA 3JUOA 3FG1A 5BIRA 1Q864 3JUNA 4AKYA 1EKMA 3EN1B 3QK9A 3CCQ3 1K8A4 3S29A 3WOEB 1BRJA 1DMNA 1RRLA 1I3FA 3A5EA 1LNIA 4HM3B 2OWPA 1I0XA 2DP9A 1O7PB 1YGWA 2Z6BA 4FCZA 5AYRB 3CXC2 3DGMA 3SVAA 2XSHB 3LTAA 4HZBB 2OQEC 6GSPA 2XFSA 4DKIA 4XDVA 3LT9A 2Q07A 2KXGA 3GWRA 3UAIA 2XH9A 1GD4A 3MKIA 4FMAA 1UI7A 2OTL3 4WYKB 1RTUA 3AHWA 3F9SA 3V92A 3HOHA 4HAAA 1YHQ3 1VQN3 3HJYA 3NQYA 3RDEA 1JZOA 1GMPA 2XGNA 4HM0B 4RNTA 2GEXA 2HMLB 4CJNA 1KQS2 4LEHA 1IQ8A 1Q40B 3X3XA 5HOHA 3E99A 1FW7A 1O7HB 1B2XA 2GU1A 5AIGA 3LXUX 5AEUB 3CCS3 1AY7A 5JPPA 1LNHA 1GY5A 1O7GB 3SYUA 3CC73 2BMRB 5G1LA 4HZ9B 3HZPA 1QAKA 1VQL3 1O7MB 4KFEA 1JKGB 3WA2X 1E3VA 4FR9A 1C7HA 5AEWB 1BSAA 1U5OA 1SGVA 2BNGA 1DMMA 2YFIB 1SARA 3CD63 1Z1SA 1BU4A 4K1VA 4LSOA 3VSEA 1WMPA 1CEWI 1V58A 4HM1B 1HKXA 4WWUC 1CH0A 1ISKA 3MQKA 3G8ZA 5RNTA 2L1SA 5G2GA 1N9EA 3GSPA 1JZDA 3MYTA 3STDA 1ZE1A 3N8BA 4OVMA 2J8XB 1MNLA 2KRTA 1TFKA 3OX9A 2F5MA 1VQK3 1GD3A 1N9JA 3CPOA 3NQZA 4RNYA 4MMXB 3UNLA 3T8NA 2JDIH 3X42A 1N5PA 1UUVB 2Z76A 3NUVA 5IENA 1K734 1A90A 4O8SA 1OGZA 4HM5B 5ELUA 3K9MC 2H0GA 2HMOB 1YJN3 1RCKA 1YI23 3GZRA 4N6NB 1K41A 4L8PA 3FF0A 3D4AA 3ER7A 3ZG0A 1BRNL 1QALA 1YJW3 3CMA3 3LDFA 1JB5A 2CIUA 3HAXA 1UOYA 1RRHA 3CNXA 3G713 3CME3 4Q1TA 3WHOA 2IUJA 1JBSA 1IYYA 1ULJB 1U8CB 1RKYA 2J5VA 4HOHA 1W4NA 3LZAA 4N3VA 1UI8A 3JUPA 3KSPA 4BL3A 4CPKA 3U28A 4K1UA 2KCDA 3LWQA 1RGCA 1Q824 4N6LA 1RJOA 1RGFA 1T5YA 5A0OB 1B21A 1IVWA 2XFTA 1A67A 1YJ93 1TRQA 2R41A 1CYVA 1FA3A 1X1WA 2CKFB 1Q814 1AVLA 3CC43 1I3IA 2CG1A 1UCJA 3DGOA 1ZO2A 2INXA 4J5KA 1BSEA 3JUMA 8CHOA 3CCJ3 1V57A 3G16A 4L7KA 4EYCA 5IG0A 1IV9A 1IQXA 1RDSA 1XNEA 4N6OB 3TDGA 1BNRA 1HZ1A 5G1KA 1RN4A 4WYKA 3V99A 3DGNA 4J8TA 3HK4A 1ZS7A 4KZ1A 3AHSA 1W00A 1W02A 1OACA 2F98A 2XR8B 1EEJA 1FGRA 1Q40A 3GRDA 2PZVA 4N6TA 3CC23 3LWRA 1I70A 1D6YA 4FMDA 1B2SA 3PS8A 2EY4A 2XRXB 1L5GB 3PZWA 1TTOA 2CFWA 2D1WA 2W2CA 3NM2A 4R9LA 4FCJA 1NB3I 3UB1A 5M18A 1SQWA 1Q7Y4 4KVHA 3IPTA 1IK3A 1YNVX 1YVSA 1V74A 2KF3A 3EC9A 3U97A 4MJDA 1T2HA 1VQ73 3CCE3 4LZIA 5AIFA 1NDOB 1Q9EA 2JQ5A 2W04A 2CH9A 4GL6A 3HI7A 3S28A 1JNQA 2W56B 2I9WA 2QGUA 4GB5A 3WODG 1UCKA 1K9M4 5DREA 3MG2A 5FW5A 1O7NB 3LWOA 3BIRA 1I0VA 7RNTA 2W9QA 1GSPA 1OH0A 1BVIA 2P0MA 9RNTA 1PU4A 2AB4A 3EJVA 3S5CA 1BAOA 3SX1A 4XBXA 3KZTA 3PYJA 1NO3A 4HYZA 4N6V0 4EV5A 1WXWA 3HX8A 1LRAA 3VF1A 3CCR3 3BU4A 1BNFA 1NWWA 1W01A 3KE7A 2J5TA 3GZYB 1RNBA 2RCDA 1BUJA 3LTCA 1VZZA 3EN8A 3K63A 2Y74A 1MWSA 4JRFA 4JF8A 2RBIA 2Z7AA 1JV2B 1ZX2A 2HMJB 1B2MA 1YGEA 1QVF2 1YVBI 3F14A 2WOFA 1BNGA 1BNEA 2CX0A 1QMAA 1T2IA 3KN4A 3UL6A 1EQKA 2P05A 1N8QA 3D9RA 5ELJA 1FGQA 1SPUA 2IYJA 1OUNA 5GSPA 1VQ43 4KT3B 1ZE2A 4ILFA 1S04A 1DVCA 2D42A 2FGTA 3AMOB 4ZM8A 5IG5A 1GY7A 1BOXA 2E2UA 1OF5B 4R80A 4CDLA 3KIIA 4HM8B 1QAFA 3FF2A 1UCIA 3VSYA 2FRXA 2ML6A 1F8NA 1RGAA 5IF6A 1VQP3 1YIT3 3CCM3 4R1KA 3GAXA 4H61A 4BL2A 2F4YA 5TGNA 4XM4A 1HU9A 4K90B 1LOVA 1RGHA 2ZHXB 1ASKA 3VGNA 2Z77A 2OCTA 3MWZA 4OUQA 4GSPA 3SEDA 3H51A 2OOVA 1LQGC 2CWUA 3EF8A 3IMAB 4L8OA 1IVUA 3DUKA 4RBNA 3CCU3 3K7CA 5IW9A 2YFJB 2CK3H 1LVNA 2HMNB 5D81A 2SBLA 3FLJA 2P09A 3F40A 4CI2B 4IPBA 1ZGXA 3PCRA 1NNVA 2F56A 1D6UA 3N9HA 3Q90A 3QRDA 4TZ4C 1ROAA 5M19A 5IERA 1BIRA 4BIRA 3T0UA 3ALAA 1MGRA 1GS3A 4J9AA 2AUSA 3FCSB 1R3FA 2HOHA 3EB8A 5IG4A 1STFI 1MWUA 2B24B 4CI3B 3AGOA 3N54B 1I8VA 1DVDA 3O8YA 3LWVA 4U13A 1FZUA 4STDA 1KWIA 1RHLA 2V1LA 1W7CA 3DGYA 5IEOA 3KFQC 3MG3A 4EXRA 1VQ53 5FGOA 5KP1A 3U1WA 3DZLA 3V98A 1W2ZA 1NB5I 2APOA 1TJDA 2W56A 4Q53A 1I2FA 3LYGA 1JB2A 3D3LA 1BNSA 3D79A 1D6ZA 1ROVA 3LH4A 7STDA 3Q2PA 3FKAA 5AIHA 1UDII 5STDA 4G1MB 4BU4A 4HBRA 2E5OA 1J2BA 1SJWA 2WO0A 3GZBA 4K61A 5CLKA 3FSDA 2WOHA 3FGYA 1BSCA 1MOLA 2KKUA 5AYSC 1OPYA 2GU3A 3SOAA 5I97A 4R4KA 5D83A 1AR0A 5D82A 1E3RA 1JBTA 1QJGA 4N6MA 2P38A 1K8WA 1UCLA 1VQQA 4IIAA 1WK2A 5CF1A 1RGLA 3M6UA 2AADA 2KF6A 3PGBA 4HJLB 2FNQA 3NBRA 3OWSA 2BIRA 5CF2A 1CQSA 1BSDA 2W03A 1W6CA 3J7Yd 3S67A 6STDA 3EQQB 1X1YA 3NXJA 1X1XA 1IU7A 1E97A 3AMOA 1LOWA 2GEYA 1YIJ3 1RLSA 3Q3FA 1OF5A 4GHOA 1W5ZA 2RFRA 5AIIA 3WA3A 3CCL3 3S27A 2CX1A 2C4BA 1W6YA 3HIGA 3RGAA 1GYBA 1FYSA 2RNTA 3X3YA 1I2EA 2ZL8A 1RN1A 3M6WA 3F7XA 4DMGA 1TE7A 1IVXA 1DE3A 4NHFA 4O02B 2M7OA 5HGRA 1VQ63 4O3VA 3X40A 2KF5A 3DH2A 1KSIA 1FUSA 2CWWA 1IV7A 1FGTA 1B2ZA 4I4KA 4OK0A 3X3ZA 2KF4A 3WOFB 3OW22 1JRQA 3M6XA 2GBXB 1B3SA 4KFDA 5CXOA 1WQLB 1FUTA 1N8R4 1EUIC 4X2HA 1BRIA 2O9UX 1G96A 1GMRA 2RSXA 3JVCA 1PY3A 3KSED 4BTXA 3B7CA 3BNEA 3AGNA 3WMDA 1FUWA 1R3EA 3KKGA 1UGHI 4J5GA 3M65A 3SOYA 1OGXA 4MEIA 3UL5A 2F5WA 1BNJA 1TU5A 2CG0A 3EBYA 1JBRA 1NU3A 3LTBA 3C0KA 4MMZB 4WP5A 2Y73A 3LJCA 4WHAA 3JUQA 1LQMB 1RGKA 6RNTA 3EX9A 3M6VA 4TX4A 4BTWA 2HMMB 3URPA 1W2B2 1MWTA 3SLUA 2LYXA 2HMKB 1RGEA 4LYLB 1RN7A 3I0YA 1CYUA 1R4YA 1RGGA 1BRSA 1WTHA 5IG3A 4AKZA 1UUGB 2A15A 3B4OA 3LWPA 3G6E3 3D5GA 3IJEB 2UGIA 3ROBA 1FGMA 4IT7A 2SARA 3MPHA 1SIIA 1JJ22 4I5QA 3UJMA 4FCMA 4PEJA 4CI1B 1NJI4 4HM7B 2AS0A 2B1XB 3OWYA 1OHSA 1DYUA 3EBTA 1OHPA 2RFKA 4LGQA 1ULIB 3B8LA 3NV0B 3PCSA 3I563 1BANA 3K0ZA 1VQ83 1BRGA 1MGWA 2LQVA 2C11A 3BLZA 3ECFA 3NBBA 3M4XA 4N6UA 1S5AA 1B20A 2BMOB 3SXXA 3A76A 2BU4A 2AAEA 2CW9A 2CWTA 1I2GA 2WGOA 3X41A 5EEOA 4XB5A 3HJWA 1B27A 2UUGC 1M1K4 2CWVA 4FMBA 2CFDA 1LXEA 4WFOA 2BO9B 3OWUA 4EW5A 1UW1A 2BMQB 2E2VA 3OXAA 3MG1A 5JBSA 3CNMA 5CK6A 3EHCA 3H3HA 4EBGA 3T8UA 1VQO3 1GOVA 1ZBOA 3B4PA 3RGRA 1IDPA 1UUWB 2IA7A 5BVBA 1STDA 1VQM3 1QVG2 3NX0A 1N5HA 2CFGA 2RGQA 3M8CA 1BUQA 3DMCA 3FG3A 4XBYA 2QA43 4X2OA 1KD14 5AI1A 2XGLA 2ML5A 2CHCA 1GY6A 3CCV3 3I553 1IT7A 1Q42A 1LOYA 2O3OA 3LMLA 1BGSA 3BNBA 4R9KA 1HYFA 3EE1A 5LC7A 3ZV0C 4EC6A 2C10A 3DM8A 1A2PA 4HM2B 1UGIA 2ZA4A 3DGLA 2GXFA 1RCLA 3K5TA 1JN5A 2K54A 2KAAA 2L4VA 2PNCA 2R4IA 1S723 4ORLA 1G0TA 2IY2A 2WGQA 2W6JH 3NBJA 4NPBA 2MC8A 1WXXA 2K3DA 1GOYA 1JB4A 2ANEA 1DMQA 1BNIA 1M1XB 2XF3A 3BNCA 1TP6A 3D5IA 1T3BA 1GMQA 1LOXA 1WMOA 2ZDJA 1IQYA 5KP4A 2CC3A 2CFKA 4XBTA 3G4S3 1PFPA 2W9PA 1K28A 5BXQA 1TRPA 1RSNA 4HM6B 2BHMA 5LC6A 3RNTA 2YFLB 2OOVC 2OTJ3 5EQLA 5DRVA 2W0QA 3Q1CA 1PYLA 2GBWB 3MHEA 7GSPA 1OCVA 2XSOB 3BB9A 3DXOA 4O2HA 3G0KA 4HKVB 2UX0A 3OV4A 1AVKA 2MF7A 3MSOA 2XEPA 3ZFZA 2OQEA 3L0RA 2B78A 3GZXB 1C54A 1AQZA 1B2UA 3FH1A 1BSBA 4H3UA 1O7WB 4MMYB 4BTYA 1EA2A 1R4CA 4CCVA 1W6GA 4QWTA 3ZG5A 1RNTA 4XDWA 3FG4A 1DETA
chains in the Genus database with same CATH topology
3LDFA 2CX0A 2P38A 1Q7HA 1K8WA 2CWWA 4Q1TA 1ZS7A 1IQ8A 1IT7A 2J5VA 1ZE2A 1ZL3A 3D79A 1ZE1A 2AB4A 1J2BA 1T5YA 1WXWA 2B78A 1SQWA 1R3EA 2J5TA 1IT8A 2CX1A 1R3FA 1WXXA 2AS0A 1SGVA 2Q07A 3UAIA 3C0KA 4DMGA 3VSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDF A;  2CX0 A;  2P38 A;  1Q7H A;  1K8W A;  2CWW A;  4Q1T A;  1ZS7 A;  1IQ8 A;  1IT7 A;  2J5V A;  1ZE2 A;  1ZL3 A;  3D79 A;  1ZE1 A;  2AB4 A;  1J2B A;  1T5Y A;  1WXW A;  2B78 A;  1SQW A;  1R3E A;  2J5T A;  1IT8 A;  2CX1 A;  1R3F A;  1WXX A;  2AS0 A;  1SGV A;  2Q07 A;  3UAI A;  3C0K A;  4DMG A;  3VSE A; 
#chains in the Genus database with same CATH topology
 3HII A;  1Y4K A;  1Q7H A;  3F7S A;  5EVH A;  1TFO A;  1AV4 A;  4HVN A;  3LT8 A;  2F99 A;  5JPU A;  3NV0 A;  3NM7 A;  2P0X A;  3WDG B;  1WMN A;  1M90 4;  3F8H A;  1A2V A;  2F86 B;  1ZL3 A;  1VQ9 3;  1TUH A;  1X1U A;  3CPW 2;  1BRH A;  3PXM A;  4NRE A;  1JN5 B;  1G02 A;  2E2T A;  2CFL A;  2GSP A;  2K0M A;  3BND A;  1FGO A;  2IMJ A;  3CU3 A;  3IUW A;  3FZW A;  1GOU A;  2BT3 A;  3LOY A;  2HVY A;  1M9G A;  5KP3 A;  3WR2 A;  3F8X A;  1BRK A;  2QIY A;  1EG9 B;  1RMS A;  2STD A;  1TIJ A;  1US1 A;  1WNH A;  2H0H A;  1IVV A;  5BU4 A;  1IT8 A;  5M1A A;  2Z0T A;  1SIH A;  4LMI A;  2QEX 3;  3DY5 A;  2YX9 A;  1OHO A;  3LTD A;  1A2K A;  2H0I A;  1JKG A;  2FXT A;  2IUK A;  4FMC A;  4RNZ A;  1KC8 4;  4AEQ A;  4HM4 B;  3NHX A;  4KFF A;  4EV2 A;  4RZM A;  1MWR A;  8RNT A;  3KCH A;  5IEP A;  3JUO A;  3FG1 A;  5BIR A;  1Q86 4;  3JUN A;  4AKY A;  1EKM A;  3EN1 B;  3QK9 A;  3CCQ 3;  1K8A 4;  3S29 A;  3WOE B;  1BRJ A;  1DMN A;  1RRL A;  1I3F A;  3A5E A;  1LNI A;  4HM3 B;  2OWP A;  1I0X A;  2DP9 A;  1O7P B;  1YGW A;  2Z6B A;  4FCZ A;  5AYR B;  3CXC 2;  3DGM A;  3SVA A;  2XSH B;  3LTA A;  4HZB B;  2OQE C;  6GSP A;  2XFS A;  4DKI A;  4XDV A;  3LT9 A;  2Q07 A;  2KXG A;  3GWR A;  3UAI A;  2XH9 A;  1GD4 A;  3MKI A;  4FMA A;  1UI7 A;  2OTL 3;  4WYK B;  1RTU A;  3AHW A;  3F9S A;  3V92 A;  3HOH A;  4HAA A;  1YHQ 3;  1VQN 3;  3HJY A;  3NQY A;  3RDE A;  1JZO A;  1GMP A;  2XGN A;  4HM0 B;  4RNT A;  2GEX A;  2HML B;  4CJN A;  1KQS 2;  4LEH A;  1IQ8 A;  1Q40 B;  3X3X A;  5HOH A;  3E99 A;  1FW7 A;  1O7H B;  1B2X A;  2GU1 A;  5AIG A;  3LXU X;  5AEU B;  3CCS 3;  1AY7 A;  5JPP A;  1LNH A;  1GY5 A;  1O7G B;  3SYU A;  3CC7 3;  2BMR B;  5G1L A;  4HZ9 B;  3HZP A;  1QAK A;  1VQL 3;  1O7M B;  4KFE A;  1JKG B;  3WA2 X;  1E3V A;  4FR9 A;  1C7H A;  5AEW B;  1BSA A;  1U5O A;  1SGV A;  2BNG A;  1DMM A;  2YFI B;  1SAR A;  3CD6 3;  1Z1S A;  1BU4 A;  4K1V A;  4LSO A;  3VSE A;  1WMP A;  1CEW I;  1V58 A;  4HM1 B;  1HKX A;  4WWU C;  1CH0 A;  1ISK A;  3MQK A;  3G8Z A;  5RNT A;  2L1S A;  5G2G A;  1N9E A;  3GSP A;  1JZD A;  3MYT A;  3STD A;  1ZE1 A;  3N8B A;  4OVM A;  2J8X B;  1MNL A;  2KRT A;  1TFK A;  3OX9 A;  2F5M A;  1VQK 3;  1GD3 A;  1N9J A;  3CPO A;  3NQZ A;  4RNY A;  4MMX B;  3UNL A;  3T8N A;  2JDI H;  3X42 A;  1N5P A;  1UUV B;  2Z76 A;  3NUV A;  5IEN A;  1K73 4;  1A90 A;  4O8S A;  1OGZ A;  4HM5 B;  5ELU A;  3K9M C;  2H0G A;  2HMO B;  1YJN 3;  1RCK A;  1YI2 3;  3GZR A;  4N6N B;  1K41 A;  4L8P A;  3FF0 A;  3D4A A;  3ER7 A;  3ZG0 A;  1BRN L;  1QAL A;  1YJW 3;  3CMA 3;  3LDF A;  1JB5 A;  2CIU A;  3HAX A;  1UOY A;  1RRH A;  3CNX A;  3G71 3;  3CME 3;  4Q1T A;  3WHO A;  2IUJ A;  1JBS A;  1IYY A;  1ULJ B;  1U8C B;  1RKY A;  2J5V A;  4HOH A;  1W4N A;  3LZA A;  4N3V A;  1UI8 A;  3JUP A;  3KSP A;  4BL3 A;  4CPK A;  3U28 A;  4K1U A;  2KCD A;  3LWQ A;  1RGC A;  1Q82 4;  4N6L A;  1RJO A;  1RGF A;  1T5Y A;  5A0O B;  1B21 A;  1IVW A;  2XFT A;  1A67 A;  1YJ9 3;  1TRQ A;  2R41 A;  1CYV A;  1FA3 A;  1X1W A;  2CKF B;  1Q81 4;  1AVL A;  3CC4 3;  1I3I A;  2CG1 A;  1UCJ A;  3DGO A;  1ZO2 A;  2INX A;  4J5K A;  1BSE A;  3JUM A;  8CHO A;  3CCJ 3;  1V57 A;  3G16 A;  4L7K A;  4EYC A;  5IG0 A;  1IV9 A;  1IQX A;  1RDS A;  1XNE A;  4N6O B;  3TDG A;  1BNR A;  1HZ1 A;  5G1K A;  1RN4 A;  4WYK A;  3V99 A;  3DGN A;  4J8T A;  3HK4 A;  1ZS7 A;  4KZ1 A;  3AHS A;  1W00 A;  1W02 A;  1OAC A;  2F98 A;  2XR8 B;  1EEJ A;  1FGR A;  1Q40 A;  3GRD A;  2PZV A;  4N6T A;  3CC2 3;  3LWR A;  1I70 A;  1D6Y A;  4FMD A;  1B2S A;  3PS8 A;  2EY4 A;  2XRX B;  1L5G B;  3PZW A;  1TTO A;  2CFW A;  2D1W A;  2W2C A;  3NM2 A;  4R9L A;  4FCJ A;  1NB3 I;  3UB1 A;  5M18 A;  1SQW A;  1Q7Y 4;  4KVH A;  3IPT A;  1IK3 A;  1YNV X;  1YVS A;  1V74 A;  2KF3 A;  3EC9 A;  3U97 A;  4MJD A;  1T2H A;  1VQ7 3;  3CCE 3;  4LZI A;  5AIF A;  1NDO B;  1Q9E A;  2JQ5 A;  2W04 A;  2CH9 A;  4GL6 A;  3HI7 A;  3S28 A;  1JNQ A;  2W56 B;  2I9W A;  2QGU A;  4GB5 A;  3WOD G;  1UCK A;  1K9M 4;  5DRE A;  3MG2 A;  5FW5 A;  1O7N B;  3LWO A;  3BIR A;  1I0V A;  7RNT A;  2W9Q A;  1GSP A;  1OH0 A;  1BVI A;  2P0M A;  9RNT A;  1PU4 A;  2AB4 A;  3EJV A;  3S5C A;  1BAO A;  3SX1 A;  4XBX A;  3KZT A;  3PYJ A;  1NO3 A;  4HYZ A;  4N6V 0;  4EV5 A;  1WXW A;  3HX8 A;  1LRA A;  3VF1 A;  3CCR 3;  3BU4 A;  1BNF A;  1NWW A;  1W01 A;  3KE7 A;  2J5T A;  3GZY B;  1RNB A;  2RCD A;  1BUJ A;  3LTC A;  1VZZ A;  3EN8 A;  3K63 A;  2Y74 A;  1MWS A;  4JRF A;  4JF8 A;  2RBI A;  2Z7A A;  1JV2 B;  1ZX2 A;  2HMJ B;  1B2M A;  1YGE A;  1QVF 2;  1YVB I;  3F14 A;  2WOF A;  1BNG A;  1BNE A;  2CX0 A;  1QMA A;  1T2I A;  3KN4 A;  3UL6 A;  1EQK A;  2P05 A;  1N8Q A;  3D9R A;  5ELJ A;  1FGQ A;  1SPU A;  2IYJ A;  1OUN A;  5GSP A;  1VQ4 3;  4KT3 B;  1ZE2 A;  4ILF A;  1S04 A;  1DVC A;  2D42 A;  2FGT A;  3AMO B;  4ZM8 A;  5IG5 A;  1GY7 A;  1BOX A;  2E2U A;  1OF5 B;  4R80 A;  4CDL A;  3KII A;  4HM8 B;  1QAF A;  3FF2 A;  1UCI A;  3VSY A;  2FRX A;  2ML6 A;  1F8N A;  1RGA A;  5IF6 A;  1VQP 3;  1YIT 3;  3CCM 3;  4R1K A;  3GAX A;  4H61 A;  4BL2 A;  2F4Y A;  5TGN A;  4XM4 A;  1HU9 A;  4K90 B;  1LOV A;  1RGH A;  2ZHX B;  1ASK A;  3VGN A;  2Z77 A;  2OCT A;  3MWZ A;  4OUQ A;  4GSP A;  3SED A;  3H51 A;  2OOV A;  1LQG C;  2CWU A;  3EF8 A;  3IMA B;  4L8O A;  1IVU A;  3DUK A;  4RBN A;  3CCU 3;  3K7C A;  5IW9 A;  2YFJ B;  2CK3 H;  1LVN A;  2HMN B;  5D81 A;  2SBL A;  3FLJ A;  2P09 A;  3F40 A;  4CI2 B;  4IPB A;  1ZGX A;  3PCR A;  1NNV A;  2F56 A;  1D6U A;  3N9H A;  3Q90 A;  3QRD A;  4TZ4 C;  1ROA A;  5M19 A;  5IER A;  1BIR A;  4BIR A;  3T0U A;  3ALA A;  1MGR A;  1GS3 A;  4J9A A;  2AUS A;  3FCS B;  1R3F A;  2HOH A;  3EB8 A;  5IG4 A;  1STF I;  1MWU A;  2B24 B;  4CI3 B;  3AGO A;  3N54 B;  1I8V A;  1DVD A;  3O8Y A;  3LWV A;  4U13 A;  1FZU A;  4STD A;  1KWI A;  1RHL A;  2V1L A;  1W7C A;  3DGY A;  5IEO A;  3KFQ C;  3MG3 A;  4EXR A;  1VQ5 3;  5FGO A;  5KP1 A;  3U1W A;  3DZL A;  3V98 A;  1W2Z A;  1NB5 I;  2APO A;  1TJD A;  2W56 A;  4Q53 A;  1I2F A;  3LYG A;  1JB2 A;  3D3L A;  1BNS A;  3D79 A;  1D6Z A;  1ROV A;  3LH4 A;  7STD A;  3Q2P A;  3FKA A;  5AIH A;  1UDI I;  5STD A;  4G1M B;  4BU4 A;  4HBR A;  2E5O A;  1J2B A;  1SJW A;  2WO0 A;  3GZB A;  4K61 A;  5CLK A;  3FSD A;  2WOH A;  3FGY A;  1BSC A;  1MOL A;  2KKU A;  5AYS C;  1OPY A;  2GU3 A;  3SOA A;  5I97 A;  4R4K A;  5D83 A;  1AR0 A;  5D82 A;  1E3R A;  1JBT A;  1QJG A;  4N6M A;  2P38 A;  1K8W A;  1UCL A;  1VQQ A;  4IIA A;  1WK2 A;  5CF1 A;  1RGL A;  3M6U A;  2AAD A;  2KF6 A;  3PGB A;  4HJL B;  2FNQ A;  3NBR A;  3OWS A;  2BIR A;  5CF2 A;  1CQS A;  1BSD A;  2W03 A;  1W6C A;  3J7Y d;  3S67 A;  6STD A;  3EQQ B;  1X1Y A;  3NXJ A;  1X1X A;  1IU7 A;  1E97 A;  3AMO A;  1LOW A;  2GEY A;  1YIJ 3;  1RLS A;  3Q3F A;  1OF5 A;  4GHO A;  1W5Z A;  2RFR A;  5AII A;  3WA3 A;  3CCL 3;  3S27 A;  2CX1 A;  2C4B A;  1W6Y A;  3HIG A;  3RGA A;  1GYB A;  1FYS A;  2RNT A;  3X3Y A;  1I2E A;  2ZL8 A;  1RN1 A;  3M6W A;  3F7X A;  4DMG A;  1TE7 A;  1IVX A;  1DE3 A;  4NHF A;  4O02 B;  2M7O A;  5HGR A;  1VQ6 3;  4O3V A;  3X40 A;  2KF5 A;  3DH2 A;  1KSI A;  1FUS A;  2CWW A;  1IV7 A;  1FGT A;  1B2Z A;  4I4K A;  4OK0 A;  3X3Z A;  2KF4 A;  3WOF B;  3OW2 2;  1JRQ A;  3M6X A;  2GBX B;  1B3S A;  4KFD A;  5CXO A;  1WQL B;  1FUT A;  1N8R 4;  1EUI C;  4X2H A;  1BRI A;  2O9U X;  1G96 A;  1GMR A;  2RSX A;  3JVC A;  1PY3 A;  3KSE D;  4BTX A;  3B7C A;  3BNE A;  3AGN A;  3WMD A;  1FUW A;  1R3E A;  3KKG A;  1UGH I;  4J5G A;  3M65 A;  3SOY A;  1OGX A;  4MEI A;  3UL5 A;  2F5W A;  1BNJ A;  1TU5 A;  2CG0 A;  3EBY A;  1JBR A;  1NU3 A;  3LTB A;  3C0K A;  4MMZ B;  4WP5 A;  2Y73 A;  3LJC A;  4WHA A;  3JUQ A;  1LQM B;  1RGK A;  6RNT A;  3EX9 A;  3M6V A;  4TX4 A;  4BTW A;  2HMM B;  3URP A;  1W2B 2;  1MWT A;  3SLU A;  2LYX A;  2HMK B;  1RGE A;  4LYL B;  1RN7 A;  3I0Y A;  1CYU A;  1R4Y A;  1RGG A;  1BRS A;  1WTH A;  5IG3 A;  4AKZ A;  1UUG B;  2A15 A;  3B4O A;  3LWP A;  3G6E 3;  3D5G A;  3IJE B;  2UGI A;  3ROB A;  1FGM A;  4IT7 A;  2SAR A;  3MPH A;  1SII A;  1JJ2 2;  4I5Q A;  3UJM A;  4FCM A;  4PEJ A;  4CI1 B;  1NJI 4;  4HM7 B;  2AS0 A;  2B1X B;  3OWY A;  1OHS A;  1DYU A;  3EBT A;  1OHP A;  2RFK A;  4LGQ A;  1ULI B;  3B8L A;  3NV0 B;  3PCS A;  3I56 3;  1BAN A;  3K0Z A;  1VQ8 3;  1BRG A;  1MGW A;  2LQV A;  2C11 A;  3BLZ A;  3ECF A;  3NBB A;  3M4X A;  4N6U A;  1S5A A;  1B20 A;  2BMO B;  3SXX A;  3A76 A;  2BU4 A;  2AAE A;  2CW9 A;  2CWT A;  1I2G A;  2WGO A;  3X41 A;  5EEO A;  4XB5 A;  3HJW A;  1B27 A;  2UUG C;  1M1K 4;  2CWV A;  4FMB A;  2CFD A;  1LXE A;  4WFO A;  2BO9 B;  3OWU A;  4EW5 A;  1UW1 A;  2BMQ B;  2E2V A;  3OXA A;  3MG1 A;  5JBS A;  3CNM A;  5CK6 A;  3EHC A;  3H3H A;  4EBG A;  3T8U A;  1VQO 3;  1GOV A;  1ZBO A;  3B4P A;  3RGR A;  1IDP A;  1UUW B;  2IA7 A;  5BVB A;  1STD A;  1VQM 3;  1QVG 2;  3NX0 A;  1N5H A;  2CFG A;  2RGQ A;  3M8C A;  1BUQ A;  3DMC A;  3FG3 A;  4XBY A;  2QA4 3;  4X2O A;  1KD1 4;  5AI1 A;  2XGL A;  2ML5 A;  2CHC A;  1GY6 A;  3CCV 3;  3I55 3;  1IT7 A;  1Q42 A;  1LOY A;  2O3O A;  3LML A;  1BGS A;  3BNB A;  4R9K A;  1HYF A;  3EE1 A;  5LC7 A;  3ZV0 C;  4EC6 A;  2C10 A;  3DM8 A;  1A2P A;  4HM2 B;  1UGI A;  2ZA4 A;  3DGL A;  2GXF A;  1RCL A;  3K5T A;  1JN5 A;  2K54 A;  2KAA A;  2L4V A;  2PNC A;  2R4I A;  1S72 3;  4ORL A;  1G0T A;  2IY2 A;  2WGQ A;  2W6J H;  3NBJ A;  4NPB A;  2MC8 A;  1WXX A;  2K3D A;  1GOY A;  1JB4 A;  2ANE A;  1DMQ A;  1BNI A;  1M1X B;  2XF3 A;  3BNC A;  1TP6 A;  3D5I A;  1T3B A;  1GMQ A;  1LOX A;  1WMO A;  2ZDJ A;  1IQY A;  5KP4 A;  2CC3 A;  2CFK A;  4XBT A;  3G4S 3;  1PFP A;  2W9P A;  1K28 A;  5BXQ A;  1TRP A;  1RSN A;  4HM6 B;  2BHM A;  5LC6 A;  3RNT A;  2YFL B;  2OOV C;  2OTJ 3;  5EQL A;  5DRV A;  2W0Q A;  3Q1C A;  1PYL A;  2GBW B;  3MHE A;  7GSP A;  1OCV A;  2XSO B;  3BB9 A;  3DXO A;  4O2H A;  3G0K A;  4HKV B;  2UX0 A;  3OV4 A;  1AVK A;  2MF7 A;  3MSO A;  2XEP A;  3ZFZ A;  2OQE A;  3L0R A;  2B78 A;  3GZX B;  1C54 A;  1AQZ A;  1B2U A;  3FH1 A;  1BSB A;  4H3U A;  1O7W B;  4MMY B;  4BTY A;  1EA2 A;  1R4C A;  4CCV A;  1W6G A;  4QWT A;  3ZG5 A;  1RNT A;  4XDW A;  3FG4 A;  1DET A; 
#chains in the Genus database with same CATH homology
 3LDF A;  2CX0 A;  2P38 A;  1Q7H A;  1K8W A;  2CWW A;  4Q1T A;  1ZS7 A;  1IQ8 A;  1IT7 A;  2J5V A;  1ZE2 A;  1ZL3 A;  3D79 A;  1ZE1 A;  2AB4 A;  1J2B A;  1T5Y A;  1WXW A;  2B78 A;  1SQW A;  1R3E A;  2J5T A;  1IT8 A;  2CX1 A;  1R3F A;  1WXX A;  2AS0 A;  1SGV A;  2Q07 A;  3UAI A;  3C0K A;  4DMG A;  3VSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...