1ZS7A

The structure of gene product ape0525 from aeropyrum pernix
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
187
structure length
187
Chain Sequence
b'HMLWARLVGLARLEARALSKKERRSLLERLKPYYTRIPFSEKADLRLVKARTDSGEYEIITVDGVPCLFEWSDGRIYPTLQCLKAFGVDWLKGVVLVDKGAAIALAKGAHLMIPGVVGVEGSFTRGDVVAALYHETRTPVMVGVAEVDSSALEKLYREKARGRAVRRVHRLGDALWELAQEVGKRLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein APE0525
molecule tags Structural genomics, unknown function
source organism Aeropyrum pernix
publication title The structure of gene product APE0525 from Aeropyrum pernix
rcsb
total genus 51
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF09183 DUF1947 Domain of unknown function (DUF1947)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1zs7A02
3.10.450.120 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Pre-PUA domain; domain 1 1zs7A01
1IT7A 2CX1A 4DMGA 1ZE2A 1ZE1A 1SGVA 2AB4A 2Q07A 1T5YA 3UAIA 1K8WA 1ZS7A 2J5TA 3D79A 1ZL3A 3VSEA 2B78A 1R3EA 2CWWA 2CX0A 1J2BA 1IT8A 1SQWA 4Q1TA 2P38A 2J5VA 1R3FA 1WXXA 3LDFA 1Q7HA 1WXWA 3C0KA 1IQ8A 2AS0A
chains in the Genus database with same CATH superfamily
3HK4A 2RBIA 3LWPA 1JKGA 1M1XB 2WOHA 3BB9A 3O8YA 5EVHA 2HMLB 1UDII 2K54A 2O3OA 1IVXA 1EEJA 3LWQA 3HOHA 3MPHA 3KN4A 1YVSA 1S5AA 5KP4A 1NU3A 3WA2X 3EB8A 4CPKA 1IYYA 1IVWA 3ZG0A 3LOYA 2W6JH 4FCJA 2XFSA 3BNDA 1R3EA 1C54A 3RNTA 1FW7A 1B21A 2P05A 1DMNA 5G2GA 1CEWI 4CJNA 1NNVA 2XH9A 3H3HA 1U8CB 4HVNA 1X1YA 1K734 3GZXB 1Q7HA 1A2KA 1W7CA 2AAEA 3WMDA 1LOWA 2GU3A 3L0RA 3LWRA 1GD4A 3NXJA 1LVNA 1Q40A 3GZYB 3G4S3 1BRIA 1W02A 3CCU3 1RCLA 3AMOB 3DGMA 1T5YA 3FG4A 2P09A 5LC6A 1BOXA 2J5TA 1Q9EA 1TIJA 3CCV3 2KF3A 1GSPA 3AMOA 3T8NA 1DVDA 3EHCA 1VQ73 3M6UA 4XBTA 1WQLB 1UUVB 2ML5A 1RN4A 1IVVA 1RMSA 2BNGA 1QAKA 3ECFA 3CCR3 3SVAA 3B4OA 1LNIA 4QWTA 5CXOA 2XRXB 5AI1A 1UW1A 3TDGA 1C7HA 1F8NA 3OV4A 2W56B 2FGTA 4HBRA 1NWWA 2CG0A 4AEQA 4LMIA 4N6TA 4LYLB 1O7GB 8CHOA 2AS0A 1FGTA 3S5CA 2HMKB 2IA7A 4HM5B 4ILFA 3T8UA 3X40A 2ML6A 2PZVA 1R4CA 3MSOA 4RNYA 1KWIA 4RBNA 4XDWA 2OOVA 3T0UA 4FR9A 3DZLA 3ZV0C 1OHPA 4R1KA 1STFI 1JB5A 3D4AA 2R4IA 1RGHA 3IMAB 3Q1CA 1RKYA 1R4YA 1YHQ3 3OX9A 2V1LA 3DGYA 2LQVA 5AEUB 3GSPA 2KKUA 2H0IA 5ELJA 4HKVB 3UL5A 3EN8A 5DRVA 1FYSA 1SARA 2IUKA 2CC3A 1JV2B 2XGLA 1UGHI 1VQ83 4BL3A 4WP5A 3LWVA 1IV7A 1ULIB 1LXEA 2E2TA 1YJW3 2RFKA 1WK2A 1VZZA 3Q3FA 4J5GA 1PU4A 2W9QA 4J5KA 2E5OA 1GMQA 1OGZA 2F86B 1V74A 3WODG 1B3SA 2BMQB 3JUQA 3IUWA 3D5GA 1EQKA 4WYKA 1TE7A 1RN7A 3M8CA 1W5ZA 4CI2B 3K63A 3MHEA 1BNSA 1WTHA 1VQ63 4K61A 2CFKA 1BSBA 2XSHB 3AHWA 3EBYA 3UL6A 5JBSA 5CF2A 3PZWA 5KP3A 4OUQA 2J5VA 1G02A 1YJ93 4FCZA 5IENA 1BUQA 4JRFA 2IUJA 7STDA 1TUHA 1QJGA 1TU5A 3CPOA 1I70A 3SLUA 4DKIA 3BNEA 4K90B 3NBJA 2BHMA 3BNBA 3H51A 1I0XA 2WGOA 2D42A 2I9WA 4XBXA 4WYKB 3CC73 1GOYA 1ZO2A 2AB4A 3SOAA 1B2UA 3BU4A 4EV5A 3N54B 3LT8A 1GMPA 1GOVA 3A76A 1O7WB 1OACA 2FNQA 3X3XA 1LOVA 1QVF2 1ZX2A 1ZBOA 1BVIA 4FCMA 1S723 1FA3A 2H0HA 2B78A 2F4YA 3PCRA 1BRJA 1NO3A 1KD14 3CMA3 3WHOA 1J2BA 1AVLA 1UUGB 2BIRA 2QA43 1FUTA 1TFOA 3FLJA 3DUKA 2P38A 1QVG2 3KIIA 3OW22 2F5MA 1L5GB 2OQEC 1JKGB 4MMZB 3MG3A 3QK9A 3WDGB 5IG0A 2Z76A 4WFOA 2YFIB 3G8ZA 1GOUA 1EG9B 1SIHA 1YGWA 3JUMA 1KQS2 3DXOA 1SJWA 5RNTA 2YFLB 1ZS7A 2P0MA 2QIYA 3D79A 2C10A 1I2GA 3HIIA 2HMNB 2HMMB 3I563 1VQ93 3NV0B 4IIAA 1B27A 3JUNA 1LNHA 1TP6A 3BIRA 1MWRA 1MWTA 3HJYA 2CWWA 2IY2A 3LXUX 1BAOA 1FGRA 4MEIA 5BU4A 1JBTA 1OF5B 5HOHA 3KFQC 1M904 4Q1TA 1B2XA 1AY7A 3UB1A 1FZUA 1ISKA 1WXXA 2CG1A 4H3UA 5HGRA 1E3VA 2FRXA 1FGQA 2CFLA 2Z6BA 4LSOA 2CK3H 4U13A 4GSPA 1HYFA 1E97A 1QALA 2CH9A 3BLZA 2B24B 3LTCA 2CWVA 2RFRA 4STDA 3S29A 1BRKA 1X1UA 3FH1A 3WOFB 2CWTA 4HM3B 1V57A 3G713 3X41A 3F9SA 3Q90A 5G1LA 2Q07A 3B7CA 2B1XB 3EF8A 3SXXA 3ZFZA 1B2ZA 1O7HB 1VQ53 4BTXA 3MYTA 1LRAA 2C11A 2WO0A 1BRHA 1D6UA 2IMJA 2KAAA 3K7CA 4G1MB 1AV4A 3G0KA 1Q824 1EA2A 1ROVA 2F98A 2GBXB 4IPBA 1IU7A 3HI7A 2CW9A 3OXAA 1UCJA 3PCSA 3NHXA 3GZBA 3STDA 1NB3I 4AKYA 3WA3A 1KC84 4O02B 4HAAA 2Z0TA 2W2CA 1DMQA 3CCE3 1B2MA 3NUVA 2CHCA 4L7KA 5JPPA 1R3FA 1B2SA 3ER7A 1VQM3 1UUWB 4XB5A 1T3BA 3ALAA 3VGNA 4BU4A 2L4VA 3C0KA 1AR0A 1JN5B 1BRSA 3U28A 3FGYA 3KZTA 1UCIA 2D1WA 1OH0A 2HVYA 1WMPA 3NM7A 3QRDA 4H61A 5AIIA 5IERA 3M6WA 5I97A 1IK3A 5D82A 2AUSA 1PFPA 2QGUA 3FZWA 3BNCA 1JZDA 5ELUA 1YVBI 4RZMA 4AKZA 3DGOA 1VQO3 4KVHA 2OOVC 1TTOA 1UI7A 4FMAA 1M1K4 2C4BA 3RDEA 2EY4A 3F40A 3D3LA 4O3VA 2CX0A 3IPTA 1PYLA 2W9PA 3LZAA 5CLKA 1RTUA 1X1WA 9RNTA 1RGFA 1YGEA 4HM2B 1FUSA 4KZ1A 4TZ4C 3D5IA 1K41A 1CH0A 1MWSA 1K28A 5AIGA 4XDVA 3CU3A 1OF5A 3DMCA 2GEXA 3FG3A 2OCTA 4HOHA 3S28A 5A0OB 4N6LA 1W6GA 3S27A 2OWPA 3SOYA 1RDSA 4J8TA 1TFKA 3X3YA 1I2EA 3DM8A 3LH4A 1W2B2 3B4PA 4N3VA 4ZM8A 3GAXA 5FW5A 5IEPA 6RNTA 7RNTA 1CYVA 1DMMA 3M4XA 3DGNA 1WNHA 2J8XB 3PYJA 4N6NB 3N8BA 2RCDA 3GZRA 1RGCA 2GU1A 4EV2A 2A15A 1VQP3 2O9UX 1SQWA 3K0ZA 1RJOA 3EQQB 5D81A 5IW9A 3CME3 1JB4A 4CI1B 3D9RA 2PNCA 1STDA 2OQEA 3VF1A 2YFJB 1Q864 4R4KA 4N6MA 1AVKA 3OWSA 5JPUA 3KE7A 1RLSA 4HM1B 1MWUA 4MJDA 1T2HA 1Y4KA 1Z1SA 5IG3A 3DY5A 4EC6A 2F5WA 4I5QA 5IF6A 1VQK3 1JN5A 2ZL8A 2XEPA 1Q40B 3PS8A 5EQLA 3CNMA 3V98A 4L8PA 3CCJ3 3VSEA 1OPYA 4L8OA 5KP1A 1YIT3 1RHLA 1G96A 2F56A 3MWZA 1EUIC 1QAFA 3FF0A 1OHOA 4Q53A 3CCQ3 3EE1A 1WMNA 3G16A 3HJWA 4NREA 2GEYA 2CFDA 3AGNA 1Q814 4OVMA 1RGAA 3UJMA 4CCVA 1O7NB 1BRNL 1OUNA 1TRQA 4EW5A 3NBRA 3EJVA 3V92A 3B8LA 1RCKA 1JBRA 1CYUA 1RGLA 4KFFA 1I3FA 1A67A 3E99A 1OGXA 2HOHA 1W00A 1FGMA 4HM6B 2IYJA 1DETA 1ZGXA 2UGIA 3X42A 4MMXB 2DP9A 2W0QA 1Q7Y4 1I0VA 4GL6A 4LGQA 1ZL3A 3MG1A 2WOFA 1BSAA 1O7MB 1RGKA 2SARA 3N9HA 2L1SA 1IDPA 1JRQA 3KKGA 5STDA 3KSPA 2XSOB 3CC43 4EYCA 4FMDA 1EKMA 1LOXA 1FGOA 2BO9B 2W56A 5G1KA 1BNGA 1I8VA 1WMOA 3LDFA 2Z7AA 1PY3A 3RGRA 1E3RA 3DGLA 4LZIA 1BIRA 3GWRA 3FSDA 2STDA 5AEWB 1BSEA 2XF3A 1D6YA 2BMRB 2GBWB 3HX8A 2UX0A 5M18A 3EC9A 2CX1A 1BANA 1N5HA 1O7PB 3JVCA 1US1A 2ZDJA 3LYGA 4HZBB 4NHFA 3CD63 3DH2A 1K8WA 3UAIA 1YI23 3KSED 3HZPA 6STDA 5D83A 1RNTA 4CI3B 4N6V0 3FKAA 1BNJA 3PGBA 2XFTA 1BNIA 4RNTA 4J9AA 5AYSC 6GSPA 4LEHA 4R9KA 4X2HA 4HM8B 3AHSA 4R80A 2GSPA 2HMJB 5BXQA 3K9MC 1VQQA 2JDIH 1GD3A 1Q42A 3FCSB 2APOA 3LTBA 3MG2A 4WHAA 4HM4B 1KSIA 1BNFA 1ASKA 4N6UA 3ROBA 1U5OA 1BNRA 3NBBA 2LYXA 3CCL3 1HU9A 3CC23 1UCLA 3CCS3 1JBSA 2HMOB 3F7SA 3IJEB 1M9GA 1N9EA 2CWUA 1RN1A 3K5TA 1ZE2A 4FMBA 3LJCA 3LWOA 2OTL3 2YX9A 5M19A 1SIIA 1X1XA 2Y74A 1JNQA 3LTAA 3OWYA 2H0GA 3WR2A 1OCVA 3FF2A 3KCHA 2FXTA 4N6OB 2GXFA 3X3ZA 3CPW2 1HKXA 2K0MA 5LC7A 2CFWA 2KF5A 5CK6A 2XR8B 1DVCA 3EX9A 3URPA 4HJLB 4IT7A 3EN1B 3G6E3 4WWUC 2K3DA 2RSXA 3F8XA 1GMRA 1SPUA 1G0TA 2Y73A 1W6YA 2P0XA 1MOLA 1VQ43 4KT3B 1OHSA 1WXWA 1AQZA 1D6ZA 2AADA 2SBLA 3MQKA 2ZA4A 1BSDA 4HYZA 4MMYB 4EBGA 3OWUA 1JJ22 3I0YA 4NPBA 1A2PA 2F99A 3F8HA 5BIRA 1YIJ3 3LMLA 3M65A 1A2VA 1CQSA 1QMAA 4GHOA 4HZ9B 4BTYA 1A90A 3JUOA 1NJI4 2INXA 1YJN3 5FGOA 1RGGA 3HAXA 1BGSA 2RNTA 3U1WA 3Q2PA 3J7Yd 1T2IA 1UI8A 2CFGA 1W2ZA 1YNVX 2BU4A 2XGNA 4TX4A 5IG5A 1FUWA 2MF7A 5TGNA 1N8QA 1GY6A 3NX0A 4OK0A 1GY7A 5AIFA 3ZG5A 3GRDA 1RNBA 1JZOA 2ANEA 3S67A 1BRGA 3NV0A 4BTWA 5AYRB 2Z77A 3UNLA 1IQYA 1HZ1A 1W4NA 2E2UA 1UCKA 4KFDA 2R41A 3PXMA 1MGRA 2RGQA 4EXRA 3F14A 3LTDA 1N8R4 1IT7A 4DMGA 2M7OA 1ZE1A 3AGOA 1K8A4 1VQN3 4K1UA 1LQGC 1MNLA 1W01A 3HIGA 3F7XA 5DREA 2KF4A 3CXC2 1BUJA 5BVBA 4RNZA 1V58A 1NDOB 5CF1A 1XNEA 3EBTA 3CNXA 1JB2A 1MGWA 1I3IA 3SEDA 1BNEA 1VQL3 3FG1A 3U97A 1RSNA 1ULJB 1BU4A 4JF8A 2MC8A 3MKIA 3NQYA 4XM4A 1UOYA 1TJDA 3NM2A 1RGEA 2E2VA 5AIHA 2W03A 3VSYA 5EEOA 4CDLA 1I2FA 4ORLA 1GY5A 2W04A 3SX1A 2BT3A 1B20A 1N5PA 3V99A 8RNTA 1IV9A 2CKFB 2KF6A 3A5EA 1RRHA 4O8SA 2ZHXB 1RRLA 5IEOA 3CCM3 2UUGC 4X2OA 4HM7B 5IG4A 1TRPA 2QEX3 4GB5A 2KRTA 1UGIA 1LOYA 1SGVA 4R9LA 2KXGA 1ROAA 5GSPA 2KCDA 3M6VA 2CIUA 3I553 2OTJ3 4O2HA 7GSPA 1BSCA 1LQMB 3RGAA 1W6CA 3LT9A 5M1AA 2WGQA 1N9JA 1IQXA 1IT8A 4I4KA 4PEJA 4K1VA 3WOEB 2BMOB 3JUPA 3NQZA 4XBYA 1IVUA 2JQ5A 3SYUA 1NB5I 1DE3A 4FMCA 4BIRA 1K9M4 3M6XA 1DYUA 4KFEA 1IQ8A 4BL2A 1GS3A 1S04A 4HM0B 1GYBA
chains in the Genus database with same CATH topology
1IT7A 2CX1A 4DMGA 1ZE2A 1ZE1A 1SGVA 2AB4A 2Q07A 1T5YA 3UAIA 1K8WA 1ZS7A 2J5TA 3D79A 1ZL3A 3VSEA 2B78A 1R3EA 2CWWA 2CX0A 1J2BA 1IT8A 1SQWA 4Q1TA 2P38A 2J5VA 1R3FA 1WXXA 3LDFA 1Q7HA 1WXWA 3C0KA 1IQ8A 2AS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IT7 A;  2CX1 A;  4DMG A;  1ZE2 A;  1ZE1 A;  1SGV A;  2AB4 A;  2Q07 A;  1T5Y A;  3UAI A;  1K8W A;  1ZS7 A;  2J5T A;  3D79 A;  1ZL3 A;  3VSE A;  2B78 A;  1R3E A;  2CWW A;  2CX0 A;  1J2B A;  1IT8 A;  1SQW A;  4Q1T A;  2P38 A;  2J5V A;  1R3F A;  1WXX A;  3LDF A;  1Q7H A;  1WXW A;  3C0K A;  1IQ8 A;  2AS0 A; 
#chains in the Genus database with same CATH topology
 3HK4 A;  2RBI A;  3LWP A;  1JKG A;  1M1X B;  2WOH A;  3BB9 A;  3O8Y A;  5EVH A;  2HML B;  1UDI I;  2K54 A;  2O3O A;  1IVX A;  1EEJ A;  3LWQ A;  3HOH A;  3MPH A;  3KN4 A;  1YVS A;  1S5A A;  5KP4 A;  1NU3 A;  3WA2 X;  3EB8 A;  4CPK A;  1IYY A;  1IVW A;  3ZG0 A;  3LOY A;  2W6J H;  4FCJ A;  2XFS A;  3BND A;  1R3E A;  1C54 A;  3RNT A;  1FW7 A;  1B21 A;  2P05 A;  1DMN A;  5G2G A;  1CEW I;  4CJN A;  1NNV A;  2XH9 A;  3H3H A;  1U8C B;  4HVN A;  1X1Y A;  1K73 4;  3GZX B;  1Q7H A;  1A2K A;  1W7C A;  2AAE A;  3WMD A;  1LOW A;  2GU3 A;  3L0R A;  3LWR A;  1GD4 A;  3NXJ A;  1LVN A;  1Q40 A;  3GZY B;  3G4S 3;  1BRI A;  1W02 A;  3CCU 3;  1RCL A;  3AMO B;  3DGM A;  1T5Y A;  3FG4 A;  2P09 A;  5LC6 A;  1BOX A;  2J5T A;  1Q9E A;  1TIJ A;  3CCV 3;  2KF3 A;  1GSP A;  3AMO A;  3T8N A;  1DVD A;  3EHC A;  1VQ7 3;  3M6U A;  4XBT A;  1WQL B;  1UUV B;  2ML5 A;  1RN4 A;  1IVV A;  1RMS A;  2BNG A;  1QAK A;  3ECF A;  3CCR 3;  3SVA A;  3B4O A;  1LNI A;  4QWT A;  5CXO A;  2XRX B;  5AI1 A;  1UW1 A;  3TDG A;  1C7H A;  1F8N A;  3OV4 A;  2W56 B;  2FGT A;  4HBR A;  1NWW A;  2CG0 A;  4AEQ A;  4LMI A;  4N6T A;  4LYL B;  1O7G B;  8CHO A;  2AS0 A;  1FGT A;  3S5C A;  2HMK B;  2IA7 A;  4HM5 B;  4ILF A;  3T8U A;  3X40 A;  2ML6 A;  2PZV A;  1R4C A;  3MSO A;  4RNY A;  1KWI A;  4RBN A;  4XDW A;  2OOV A;  3T0U A;  4FR9 A;  3DZL A;  3ZV0 C;  1OHP A;  4R1K A;  1STF I;  1JB5 A;  3D4A A;  2R4I A;  1RGH A;  3IMA B;  3Q1C A;  1RKY A;  1R4Y A;  1YHQ 3;  3OX9 A;  2V1L A;  3DGY A;  2LQV A;  5AEU B;  3GSP A;  2KKU A;  2H0I A;  5ELJ A;  4HKV B;  3UL5 A;  3EN8 A;  5DRV A;  1FYS A;  1SAR A;  2IUK A;  2CC3 A;  1JV2 B;  2XGL A;  1UGH I;  1VQ8 3;  4BL3 A;  4WP5 A;  3LWV A;  1IV7 A;  1ULI B;  1LXE A;  2E2T A;  1YJW 3;  2RFK A;  1WK2 A;  1VZZ A;  3Q3F A;  4J5G A;  1PU4 A;  2W9Q A;  4J5K A;  2E5O A;  1GMQ A;  1OGZ A;  2F86 B;  1V74 A;  3WOD G;  1B3S A;  2BMQ B;  3JUQ A;  3IUW A;  3D5G A;  1EQK A;  4WYK A;  1TE7 A;  1RN7 A;  3M8C A;  1W5Z A;  4CI2 B;  3K63 A;  3MHE A;  1BNS A;  1WTH A;  1VQ6 3;  4K61 A;  2CFK A;  1BSB A;  2XSH B;  3AHW A;  3EBY A;  3UL6 A;  5JBS A;  5CF2 A;  3PZW A;  5KP3 A;  4OUQ A;  2J5V A;  1G02 A;  1YJ9 3;  4FCZ A;  5IEN A;  1BUQ A;  4JRF A;  2IUJ A;  7STD A;  1TUH A;  1QJG A;  1TU5 A;  3CPO A;  1I70 A;  3SLU A;  4DKI A;  3BNE A;  4K90 B;  3NBJ A;  2BHM A;  3BNB A;  3H51 A;  1I0X A;  2WGO A;  2D42 A;  2I9W A;  4XBX A;  4WYK B;  3CC7 3;  1GOY A;  1ZO2 A;  2AB4 A;  3SOA A;  1B2U A;  3BU4 A;  4EV5 A;  3N54 B;  3LT8 A;  1GMP A;  1GOV A;  3A76 A;  1O7W B;  1OAC A;  2FNQ A;  3X3X A;  1LOV A;  1QVF 2;  1ZX2 A;  1ZBO A;  1BVI A;  4FCM A;  1S72 3;  1FA3 A;  2H0H A;  2B78 A;  2F4Y A;  3PCR A;  1BRJ A;  1NO3 A;  1KD1 4;  3CMA 3;  3WHO A;  1J2B A;  1AVL A;  1UUG B;  2BIR A;  2QA4 3;  1FUT A;  1TFO A;  3FLJ A;  3DUK A;  2P38 A;  1QVG 2;  3KII A;  3OW2 2;  2F5M A;  1L5G B;  2OQE C;  1JKG B;  4MMZ B;  3MG3 A;  3QK9 A;  3WDG B;  5IG0 A;  2Z76 A;  4WFO A;  2YFI B;  3G8Z A;  1GOU A;  1EG9 B;  1SIH A;  1YGW A;  3JUM A;  1KQS 2;  3DXO A;  1SJW A;  5RNT A;  2YFL B;  1ZS7 A;  2P0M A;  2QIY A;  3D79 A;  2C10 A;  1I2G A;  3HII A;  2HMN B;  2HMM B;  3I56 3;  1VQ9 3;  3NV0 B;  4IIA A;  1B27 A;  3JUN A;  1LNH A;  1TP6 A;  3BIR A;  1MWR A;  1MWT A;  3HJY A;  2CWW A;  2IY2 A;  3LXU X;  1BAO A;  1FGR A;  4MEI A;  5BU4 A;  1JBT A;  1OF5 B;  5HOH A;  3KFQ C;  1M90 4;  4Q1T A;  1B2X A;  1AY7 A;  3UB1 A;  1FZU A;  1ISK A;  1WXX A;  2CG1 A;  4H3U A;  5HGR A;  1E3V A;  2FRX A;  1FGQ A;  2CFL A;  2Z6B A;  4LSO A;  2CK3 H;  4U13 A;  4GSP A;  1HYF A;  1E97 A;  1QAL A;  2CH9 A;  3BLZ A;  2B24 B;  3LTC A;  2CWV A;  2RFR A;  4STD A;  3S29 A;  1BRK A;  1X1U A;  3FH1 A;  3WOF B;  2CWT A;  4HM3 B;  1V57 A;  3G71 3;  3X41 A;  3F9S A;  3Q90 A;  5G1L A;  2Q07 A;  3B7C A;  2B1X B;  3EF8 A;  3SXX A;  3ZFZ A;  1B2Z A;  1O7H B;  1VQ5 3;  4BTX A;  3MYT A;  1LRA A;  2C11 A;  2WO0 A;  1BRH A;  1D6U A;  2IMJ A;  2KAA A;  3K7C A;  4G1M B;  1AV4 A;  3G0K A;  1Q82 4;  1EA2 A;  1ROV A;  2F98 A;  2GBX B;  4IPB A;  1IU7 A;  3HI7 A;  2CW9 A;  3OXA A;  1UCJ A;  3PCS A;  3NHX A;  3GZB A;  3STD A;  1NB3 I;  4AKY A;  3WA3 A;  1KC8 4;  4O02 B;  4HAA A;  2Z0T A;  2W2C A;  1DMQ A;  3CCE 3;  1B2M A;  3NUV A;  2CHC A;  4L7K A;  5JPP A;  1R3F A;  1B2S A;  3ER7 A;  1VQM 3;  1UUW B;  4XB5 A;  1T3B A;  3ALA A;  3VGN A;  4BU4 A;  2L4V A;  3C0K A;  1AR0 A;  1JN5 B;  1BRS A;  3U28 A;  3FGY A;  3KZT A;  1UCI A;  2D1W A;  1OH0 A;  2HVY A;  1WMP A;  3NM7 A;  3QRD A;  4H61 A;  5AII A;  5IER A;  3M6W A;  5I97 A;  1IK3 A;  5D82 A;  2AUS A;  1PFP A;  2QGU A;  3FZW A;  3BNC A;  1JZD A;  5ELU A;  1YVB I;  4RZM A;  4AKZ A;  3DGO A;  1VQO 3;  4KVH A;  2OOV C;  1TTO A;  1UI7 A;  4FMA A;  1M1K 4;  2C4B A;  3RDE A;  2EY4 A;  3F40 A;  3D3L A;  4O3V A;  2CX0 A;  3IPT A;  1PYL A;  2W9P A;  3LZA A;  5CLK A;  1RTU A;  1X1W A;  9RNT A;  1RGF A;  1YGE A;  4HM2 B;  1FUS A;  4KZ1 A;  4TZ4 C;  3D5I A;  1K41 A;  1CH0 A;  1MWS A;  1K28 A;  5AIG A;  4XDV A;  3CU3 A;  1OF5 A;  3DMC A;  2GEX A;  3FG3 A;  2OCT A;  4HOH A;  3S28 A;  5A0O B;  4N6L A;  1W6G A;  3S27 A;  2OWP A;  3SOY A;  1RDS A;  4J8T A;  1TFK A;  3X3Y A;  1I2E A;  3DM8 A;  3LH4 A;  1W2B 2;  3B4P A;  4N3V A;  4ZM8 A;  3GAX A;  5FW5 A;  5IEP A;  6RNT A;  7RNT A;  1CYV A;  1DMM A;  3M4X A;  3DGN A;  1WNH A;  2J8X B;  3PYJ A;  4N6N B;  3N8B A;  2RCD A;  3GZR A;  1RGC A;  2GU1 A;  4EV2 A;  2A15 A;  1VQP 3;  2O9U X;  1SQW A;  3K0Z A;  1RJO A;  3EQQ B;  5D81 A;  5IW9 A;  3CME 3;  1JB4 A;  4CI1 B;  3D9R A;  2PNC A;  1STD A;  2OQE A;  3VF1 A;  2YFJ B;  1Q86 4;  4R4K A;  4N6M A;  1AVK A;  3OWS A;  5JPU A;  3KE7 A;  1RLS A;  4HM1 B;  1MWU A;  4MJD A;  1T2H A;  1Y4K A;  1Z1S A;  5IG3 A;  3DY5 A;  4EC6 A;  2F5W A;  4I5Q A;  5IF6 A;  1VQK 3;  1JN5 A;  2ZL8 A;  2XEP A;  1Q40 B;  3PS8 A;  5EQL A;  3CNM A;  3V98 A;  4L8P A;  3CCJ 3;  3VSE A;  1OPY A;  4L8O A;  5KP1 A;  1YIT 3;  1RHL A;  1G96 A;  2F56 A;  3MWZ A;  1EUI C;  1QAF A;  3FF0 A;  1OHO A;  4Q53 A;  3CCQ 3;  3EE1 A;  1WMN A;  3G16 A;  3HJW A;  4NRE A;  2GEY A;  2CFD A;  3AGN A;  1Q81 4;  4OVM A;  1RGA A;  3UJM A;  4CCV A;  1O7N B;  1BRN L;  1OUN A;  1TRQ A;  4EW5 A;  3NBR A;  3EJV A;  3V92 A;  3B8L A;  1RCK A;  1JBR A;  1CYU A;  1RGL A;  4KFF A;  1I3F A;  1A67 A;  3E99 A;  1OGX A;  2HOH A;  1W00 A;  1FGM A;  4HM6 B;  2IYJ A;  1DET A;  1ZGX A;  2UGI A;  3X42 A;  4MMX B;  2DP9 A;  2W0Q A;  1Q7Y 4;  1I0V A;  4GL6 A;  4LGQ A;  1ZL3 A;  3MG1 A;  2WOF A;  1BSA A;  1O7M B;  1RGK A;  2SAR A;  3N9H A;  2L1S A;  1IDP A;  1JRQ A;  3KKG A;  5STD A;  3KSP A;  2XSO B;  3CC4 3;  4EYC A;  4FMD A;  1EKM A;  1LOX A;  1FGO A;  2BO9 B;  2W56 A;  5G1K A;  1BNG A;  1I8V A;  1WMO A;  3LDF A;  2Z7A A;  1PY3 A;  3RGR A;  1E3R A;  3DGL A;  4LZI A;  1BIR A;  3GWR A;  3FSD A;  2STD A;  5AEW B;  1BSE A;  2XF3 A;  1D6Y A;  2BMR B;  2GBW B;  3HX8 A;  2UX0 A;  5M18 A;  3EC9 A;  2CX1 A;  1BAN A;  1N5H A;  1O7P B;  3JVC A;  1US1 A;  2ZDJ A;  3LYG A;  4HZB B;  4NHF A;  3CD6 3;  3DH2 A;  1K8W A;  3UAI A;  1YI2 3;  3KSE D;  3HZP A;  6STD A;  5D83 A;  1RNT A;  4CI3 B;  4N6V 0;  3FKA A;  1BNJ A;  3PGB A;  2XFT A;  1BNI A;  4RNT A;  4J9A A;  5AYS C;  6GSP A;  4LEH A;  4R9K A;  4X2H A;  4HM8 B;  3AHS A;  4R80 A;  2GSP A;  2HMJ B;  5BXQ A;  3K9M C;  1VQQ A;  2JDI H;  1GD3 A;  1Q42 A;  3FCS B;  2APO A;  3LTB A;  3MG2 A;  4WHA A;  4HM4 B;  1KSI A;  1BNF A;  1ASK A;  4N6U A;  3ROB A;  1U5O A;  1BNR A;  3NBB A;  2LYX A;  3CCL 3;  1HU9 A;  3CC2 3;  1UCL A;  3CCS 3;  1JBS A;  2HMO B;  3F7S A;  3IJE B;  1M9G A;  1N9E A;  2CWU A;  1RN1 A;  3K5T A;  1ZE2 A;  4FMB A;  3LJC A;  3LWO A;  2OTL 3;  2YX9 A;  5M19 A;  1SII A;  1X1X A;  2Y74 A;  1JNQ A;  3LTA A;  3OWY A;  2H0G A;  3WR2 A;  1OCV A;  3FF2 A;  3KCH A;  2FXT A;  4N6O B;  2GXF A;  3X3Z A;  3CPW 2;  1HKX A;  2K0M A;  5LC7 A;  2CFW A;  2KF5 A;  5CK6 A;  2XR8 B;  1DVC A;  3EX9 A;  3URP A;  4HJL B;  4IT7 A;  3EN1 B;  3G6E 3;  4WWU C;  2K3D A;  2RSX A;  3F8X A;  1GMR A;  1SPU A;  1G0T A;  2Y73 A;  1W6Y A;  2P0X A;  1MOL A;  1VQ4 3;  4KT3 B;  1OHS A;  1WXW A;  1AQZ A;  1D6Z A;  2AAD A;  2SBL A;  3MQK A;  2ZA4 A;  1BSD A;  4HYZ A;  4MMY B;  4EBG A;  3OWU A;  1JJ2 2;  3I0Y A;  4NPB A;  1A2P A;  2F99 A;  3F8H A;  5BIR A;  1YIJ 3;  3LML A;  3M65 A;  1A2V A;  1CQS A;  1QMA A;  4GHO A;  4HZ9 B;  4BTY A;  1A90 A;  3JUO A;  1NJI 4;  2INX A;  1YJN 3;  5FGO A;  1RGG A;  3HAX A;  1BGS A;  2RNT A;  3U1W A;  3Q2P A;  3J7Y d;  1T2I A;  1UI8 A;  2CFG A;  1W2Z A;  1YNV X;  2BU4 A;  2XGN A;  4TX4 A;  5IG5 A;  1FUW A;  2MF7 A;  5TGN A;  1N8Q A;  1GY6 A;  3NX0 A;  4OK0 A;  1GY7 A;  5AIF A;  3ZG5 A;  3GRD A;  1RNB A;  1JZO A;  2ANE A;  3S67 A;  1BRG A;  3NV0 A;  4BTW A;  5AYR B;  2Z77 A;  3UNL A;  1IQY A;  1HZ1 A;  1W4N A;  2E2U A;  1UCK A;  4KFD A;  2R41 A;  3PXM A;  1MGR A;  2RGQ A;  4EXR A;  3F14 A;  3LTD A;  1N8R 4;  1IT7 A;  4DMG A;  2M7O A;  1ZE1 A;  3AGO A;  1K8A 4;  1VQN 3;  4K1U A;  1LQG C;  1MNL A;  1W01 A;  3HIG A;  3F7X A;  5DRE A;  2KF4 A;  3CXC 2;  1BUJ A;  5BVB A;  4RNZ A;  1V58 A;  1NDO B;  5CF1 A;  1XNE A;  3EBT A;  3CNX A;  1JB2 A;  1MGW A;  1I3I A;  3SED A;  1BNE A;  1VQL 3;  3FG1 A;  3U97 A;  1RSN A;  1ULJ B;  1BU4 A;  4JF8 A;  2MC8 A;  3MKI A;  3NQY A;  4XM4 A;  1UOY A;  1TJD A;  3NM2 A;  1RGE A;  2E2V A;  5AIH A;  2W03 A;  3VSY A;  5EEO A;  4CDL A;  1I2F A;  4ORL A;  1GY5 A;  2W04 A;  3SX1 A;  2BT3 A;  1B20 A;  1N5P A;  3V99 A;  8RNT A;  1IV9 A;  2CKF B;  2KF6 A;  3A5E A;  1RRH A;  4O8S A;  2ZHX B;  1RRL A;  5IEO A;  3CCM 3;  2UUG C;  4X2O A;  4HM7 B;  5IG4 A;  1TRP A;  2QEX 3;  4GB5 A;  2KRT A;  1UGI A;  1LOY A;  1SGV A;  4R9L A;  2KXG A;  1ROA A;  5GSP A;  2KCD A;  3M6V A;  2CIU A;  3I55 3;  2OTJ 3;  4O2H A;  7GSP A;  1BSC A;  1LQM B;  3RGA A;  1W6C A;  3LT9 A;  5M1A A;  2WGQ A;  1N9J A;  1IQX A;  1IT8 A;  4I4K A;  4PEJ A;  4K1V A;  3WOE B;  2BMO B;  3JUP A;  3NQZ A;  4XBY A;  1IVU A;  2JQ5 A;  3SYU A;  1NB5 I;  1DE3 A;  4FMC A;  4BIR A;  1K9M 4;  3M6X A;  1DYU A;  4KFE A;  1IQ8 A;  4BL2 A;  1GS3 A;  1S04 A;  4HM0 B;  1GYB A; 
#chains in the Genus database with same CATH homology
 1IT7 A;  2CX1 A;  4DMG A;  1ZE2 A;  1ZE1 A;  1SGV A;  2AB4 A;  2Q07 A;  1T5Y A;  3UAI A;  1K8W A;  1ZS7 A;  2J5T A;  3D79 A;  1ZL3 A;  3VSE A;  2B78 A;  1R3E A;  2CWW A;  2CX0 A;  1J2B A;  1IT8 A;  1SQW A;  4Q1T A;  2P38 A;  2J5V A;  1R3F A;  1WXX A;  3LDF A;  1Q7H A;  1WXW A;  3C0K A;  1IQ8 A;  2AS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...