1T5YA

Crystal structure of northeast structural genomics consortium target hr2118: a human homolog of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
170
Chain Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SACCHAROMYCES CEREVISIAE Nip7p HOMOLOG
publication title Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 43
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1t5yA02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1t5yA01
1WXXA 1ZE1A 1R3EA 3UAIA 1ZS7A 2CWWA 2Q07A 1J2BA 2CX0A 1ZL3A 1IQ8A 1SQWA 3LDFA 1SGVA 2B78A 1IT8A 2P38A 2J5VA 1Q7HA 2J5TA 1K8WA 2CX1A 2AS0A 1IT7A 2AB4A 4Q1TA 1ZE2A 3C0KA 1T5YA 3D79A 4DMGA 1WXWA 3VSEA 1R3FA
chains in the Genus database with same CATH superfamily
4LGQA 4LYLB 1K41A 3K7CA 1ZGXA 3VGNA 2C11A 3HZPA 2WO0A 3WOEB 3NBBA 3N54B 4XBXA 2CKFB 3LMLA 8RNTA 3FG4A 1RLSA 3HIIA 2I9WA 3E99A 3K63A 1BNFA 5CK6A 2STDA 3GZYB 4STDA 3ZG5A 1IQXA 2GXFA 3J7Yd 2XGNA 4X2OA 3K9MC 2H0IA 1OHOA 1BNEA 3GSPA 4RBNA 1MGWA 1UDII 2F5WA 5G1KA 2AADA 3SOYA 1JB2A 3N9HA 5ELJA 1UI8A 1BU4A 1N8QA 1LOWA 8CHOA 3RGRA 3KCHA 4DMGA 3GRDA 4K1UA 4KT3B 1BIRA 4N3VA 4PEJA 1DVDA 3PS8A 4DKIA 5G2GA 1B2XA 1I2EA 1AQZA 1R4CA 1U5OA 1W6YA 1I2FA 2L4VA 2W6JH 3A5EA 4KFFA 4HYZA 1W4NA 3LTDA 3HJYA 4LMIA 7GSPA 1ZL3A 5JPUA 1RTUA 1I70A 1STDA 5IG3A 2XR8B 3UJMA 1IK3A 3NM2A 3FGYA 4NPBA 2OOVA 5IG5A 1BRNL 1HU9A 6GSPA 2APOA 1MGRA 3EN1B 3CCR3 1TU5A 2RGQA 4L8OA 4CI2B 1GOUA 1EQKA 3RGAA 5IEOA 2OWPA 1RGCA 1UCLA 3B7CA 1BNSA 1NJI4 4WWUC 1YGEA 3ER7A 3JUPA 2B1XB 3BNDA 1N5HA 4FCMA 3M6VA 3GWRA 1RGLA 3Q1CA 4OK0A 5DRVA 1SPUA 3GZXB 4R9LA 3M6XA 3D3LA 1V74A 3FG3A 3X41A 2EY4A 4Q53A 2ZDJA 1G02A 2KF3A 4AKZA 5IERA 2W2CA 1L5GB 4EBGA 1WXXA 2XH9A 2YFLB 4WFOA 3G713 1LRAA 1DYUA 3EQQB 2FRXA 2OTL3 4XDWA 4HAAA 1VQ73 1RGGA 3F14A 1X1UA 1W2ZA 2CC3A 2V1LA 3FH1A 1FGQA 1QAFA 2O3OA 3FG1A 3PYJA 1B2MA 1S723 1GOVA 2PNCA 1Q40A 1RSNA 1QVG2 4CPKA 1AV4A 1UGHI 5FW5A 1TJDA 3WHOA 4EC6A 4N6NB 5EEOA 4LZIA 1ZX2A 2RNTA 3WDGB 1NU3A 3LJCA 3HJWA 2HMNB 4OUQA 4U13A 1BVIA 1GY5A 1ZO2A 2CFGA 2E2TA 3MPHA 3OWUA 4O2HA 3RNTA 1ASKA 3SYUA 1K28A 4MMZB 1Q40B 3G0KA 1X1XA 3DXOA 1ROAA 3CU3A 3CC43 2P09A 3UB1A 1WMOA 2HVYA 4FMAA 1GOYA 1LOYA 4FMDA 5CF2A 1SQWA 2XF3A 4J8TA 2CG0A 2W9QA 1LQMB 3WOFB 1I0XA 5GSPA 1IV9A 2GBXB 3CCL3 3JUOA 3SEDA 1JZDA 5AIFA 1VZZA 2XFSA 3NV0A 2Z6BA 1Q814 3EHCA 3I563 2CWVA 3HAXA 1OGXA 3C0KA 4HKVB 4NREA 3LT8A 3Q3FA 5AEWB 1GS3A 5STDA 1BSDA 3JUQA 1PYLA 1N9JA 1WNHA 4O3VA 4O8SA 1Y4KA 1BNGA 1LVNA 2ML5A 1BRJA 3UAIA 1BRSA 1W00A 5DREA 4CI1B 2GEYA 1E97A 2YFJB 4KFEA 3I553 3NV0B 1UUWB 1IVWA 1BGSA 4TZ4C 3CNXA 4K1VA 3FF0A 2B78A 1YNVX 2HMOB 1MWSA 4FMCA 1N8R4 6STDA 3OX9A 1M1K4 1IT8A 3KSED 2J5VA 5BU4A 1K8A4 5D81A 1US1A 2IA7A 3B4PA 1F8NA 1K8WA 1IDPA 1OGZA 3FLJA 3K0ZA 1JBRA 2GU1A 3IMAB 1FYSA 1E3VA 1BSEA 3F40A 3WR2A 1TP6A 2BO9B 3AMOA 7STDA 1BRIA 1RCKA 1ZBOA 1B20A 5AIHA 1V58A 4MMYB 2CK3H 1YHQ3 3KN4A 2GU3A 1OHPA 4N6OB 2W56A 2CWWA 2ZL8A 1Q9EA 4R4KA 2CFLA 3VSYA 1QAKA 4HOHA 3X40A 1A67A 1TTOA 3AHSA 3SX1A 1RN1A 1VQP3 4BU4A 3OWYA 5AYSC 4I4KA 5M19A 2CWTA 3AMOB 5ELUA 1BRKA 3LWOA 1RJOA 3B4OA 3HIGA 4HVNA 3SVAA 2C4BA 2W56B 1JJ22 1DMNA 4N6LA 2ANEA 2HMMB 2ML6A 2XRXB 2CG1A 4QWTA 3JUNA 3H3HA 5FGOA 1JZOA 1DE3A 3S67A 3M4XA 1ROVA 2RCDA 1GSPA 1Q824 4XBYA 4HM4B 4L7KA 3X42A 3LZAA 1TFKA 3STDA 2QEX3 2GSPA 3FCSB 1FZUA 4KZ1A 1M904 1B2SA 4RNTA 4HM0B 1VQ93 1UW1A 3FZWA 1D6UA 2K54A 3D5GA 4N6TA 3GZBA 3MQKA 1SGVA 3MHEA 3S29A 5D82A 1ULJB 2KAAA 2KF5A 5TGNA 5IW9A 2BMOB 1FGOA 2YFIB 3F8XA 4HZBB 4MMXB 1GMQA 3T8NA 2O9UX 2OTJ3 1OCVA 4LSOA 4Q1TA 2BMRB 3PXMA 5JPPA 1MOLA 2HMJB 1WXWA 1WK2A 3ALAA 1MWTA 4MEIA 3CMA3 1UI7A 3I0YA 1IQYA 3A76A 7RNTA 3VF1A 1G96A 4HM2B 2D42A 5EQLA 2F99A 1PU4A 3S5CA 1RGEA 5AYRB 1RN4A 3OV4A 1JKGA 1OACA 3LDFA 5CF1A 4NHFA 3G16A 3GZRA 1O7GB 2HOHA 4K61A 4FMBA 4MJDA 2RFRA 1LXEA 1TIJA 3CXC2 4HZ9B 3H51A 3DMCA 3HK4A 1GY7A 1TFOA 4IT7A 5AIIA 1AVKA 4N6UA 4J9AA 3M8CA 4N6MA 1ZE2A 3KIIA 3TDGA 1LNHA 4TX4A 3X3XA 1BAOA 2FGTA 1R4YA 2CIUA 2OCTA 2Z77A 3DY5A 5IENA 2INXA 1JKGB 1BANA 1JBSA 2BU4A 2CFWA 1RGFA 1WTHA 3NUVA 2W9PA 1UCIA 2D1WA 4HM5B 1UCJA 4BIRA 1JB4A 1UOYA 4ILFA 2FNQA 4CDLA 5JBSA 4HM3B 1RKYA 1YVSA 3EE1A 3V92A 3LH4A 1A90A 2B24B 3UL6A 1RHLA 4FCJA 1DMMA 3U28A 3KZTA 4OVMA 3WA3A 4CJNA 1Z1SA 1KQS2 1M1XB 1S5AA 1NO3A 2Y74A 1UUGB 1WQLB 2OQEC 4AEQA 5EVHA 3X3YA 1QMAA 1W5ZA 4BTWA 1BRGA 1DMQA 1RRHA 5M1AA 3VSEA 3BNEA 1B3SA 2YX9A 1VQ63 2W0QA 3WMDA 1W6CA 1JBTA 2Z76A 3JVCA 1BUQA 3LWPA 1ZE1A 1XNEA 2IYJA 1BNRA 1O7MB 4CI3B 3AGNA 4XM4A 3G4S3 1IU7A 1M9GA 2P05A 3M65A 1LOVA 3F7XA 4EV5A 1GD4A 1STFI 5G1LA 1VQO3 4RNYA 4EV2A 4HJLB 2XSHB 1GYBA 2XFTA 1B2UA 1IV7A 2MC8A 4JRFA 1NNVA 5I97A 3CME3 3IUWA 3IJEB 1W01A 3Q90A 2QIYA 4WP5A 1OH0A 1CYVA 3EX9A 2CFDA 3T8UA 1FW7A 3EF8A 4ZM8A 2Z7AA 1JN5A 4H3UA 1G0TA 2J5TA 4K90B 3CCU3 1X1WA 3DZLA 3EN8A 2RSXA 4HM7B 3ZG0A 3BIRA 2SBLA 1JV2B 2KXGA 4WYKA 3CNMA 2UX0A 1FGTA 2IMJA 3FKAA 2LQVA 5RNTA 1T5YA 3D79A 1YVBI 1PFPA 2XSOB 2IY2A 1W2B2 1ISKA 1FUWA 3U97A 2HMLB 1EG9B 3F7SA 1FGRA 2E2VA 4WHAA 1VQ83 1C54A 3CPOA 3NXJA 3CCM3 1QJGA 1R3EA 3D5IA 1ZS7A 2Q07A 5BXQA 4CCVA 1S04A 1VQ43 5KP3A 3MG3A 4R80A 1JN5B 1GY6A 3BB9A 1RGKA 3EBTA 1IVXA 1TRQA 4RNZA 1BOXA 1VQL3 1T2IA 4WYKB 3MKIA 3PCSA 1YI23 5AEUB 3MSOA 4GHOA 4HM8B 3V98A 3PZWA 2GBWB 2M7OA 4IIAA 1W6GA 1SARA 1C7HA 3BNBA 2OQEA 3S27A 3OW22 3HOHA 2MF7A 4BTXA 4R9KA 5IG0A 1BNIA 1QALA 1RDSA 3MYTA 1NB5I 1EUIC 3LYGA 1QVF2 1R3FA 1Q864 1SIIA 3F9SA 1O7HB 2R41A 1I8VA 1MWRA 3KSPA 1K9M4 2H0HA 3S28A 3LTAA 1DVCA 2Y73A 3AHWA 1TRPA 2KKUA 1T2HA 2KCDA 3KKGA 3T0UA 3CCQ3 3DGYA 3URPA 2K0MA 1BSBA 4N6V0 1RNTA 2WOHA 2HMKB 3ROBA 1BRHA 1D6YA 3D9RA 2F86B 1KC84 1GD3A 3B8LA 3IPTA 1E3RA 2QGUA 4R1KA 5LC7A 1KD14 3BNCA 2R4IA 1RMSA 3NQZA 1N9EA 3UL5A 3V99A 4BL2A 3ZFZA 1OPYA 4RZMA 1I3FA 5IEPA 3QK9A 2AB4A 2ZA4A 2RBIA 2F5MA 3LT9A 2CFKA 4EW5A 4FR9A 3DH2A 1OUNA 2J8XB 3Q2PA 1YJ93 1LOXA 3NHXA 3OWSA 3BU4A 2UUGC 1DETA 2QA43 4AKYA 1UGIA 1NWWA 5LC6A 1T3BA 3QRDA 1AVLA 1MWUA 1VQK3 3PGBA 2AUSA 2CWUA 2DP9A 4G1MB 1SIHA 3ECFA 4HBRA 3PCRA 3LWQA 1I0VA 4J5KA 4XB5A 4ORLA 1CH0A 3WODG 1HYFA 2WGOA 3LTBA 3AGOA 3NM7A 1Q7HA 1UUVB 2WGQA 5D83A 4EYCA 2PZVA 2AS0A 1RN7A 1OF5A 3KFQC 1FUTA 4FCZA 3CC23 1YIJ3 1IVVA 1NB3I 2RFKA 3X3ZA 2P0MA 3FSDA 3CCE3 3FF2A 1FA3A 4HM6B 3DM8A 1BSAA 1O7WB 2BT3A 3N8BA 3ZV0C 2KF6A 4HM1B 1TE7A 3OXAA 4X2HA 3CCS3 1BUJA 3MG2A 1IYYA 3LTCA 1J2BA 2K3DA 2W03A 3EJVA 4KFDA 3JUMA 2C10A 1YJN3 1X1YA 4KVHA 1KSIA 1CYUA 2KF4A 2Z0TA 2E2UA 1OF5B 1RGAA 5CLKA 1EA2A 2WOFA 2XEPA 1YGWA 3G8ZA 2IUJA 2BMQB 1NDOB 3WA2X 5BIRA 5HGRA 3LXUX 1WMPA 1JNQA 2A15A 5IG4A 3M6UA 3NX0A 5AIGA 1HZ1A 3NQYA 3BLZA 4GB5A 2CX1A 1VQQA 3NBJA 1A2VA 1ULIB 2W04A 1BNJA 4BL3A 3LWVA 2BIRA 2XGLA 3SOAA 4BTYA 1U8CB 5BVBA 3LOYA 3M6WA 5KP4A 3G6E3 1GMRA 1LQGC 2H0GA 3D4AA 1LNIA 1WMNA 4O02B 5A0OB 4IPBA 3CC73 3LWRA 1I3IA 2BNGA 1W7CA 1D6ZA 1Q42A 3DGNA 3HI7A 1HKXA 1O7NB 1BSCA 1MNLA 3HX8A 1CEWI 3NBRA 5KP1A 1VQ53 4J5GA 9RNTA 3DGMA 3MWZA 3EC9A 1A2KA 2P38A 4XDVA 3RDEA 1SJWA 1AR0A 1B21A 3L0RA 1I2GA 2F4YA 2P0XA 3SXXA 1IT7A 4GSPA 2F98A 3UNLA 2GEXA 3EBYA 3CPW2 1RCLA 3O8YA 3DGOA 6RNTA 3CCJ3 1FUSA 1JRQA 2LYXA 3GAXA 2CH9A 5IF6A 3CCV3 2CHCA 1B27A 3KE7A 1GMPA 2F56A 2JQ5A 3EB8A 1V57A 4EXRA 1IVUA 2L1SA 2CX0A 1PY3A 3U1WA 5M18A 1RRLA 4JF8A 2AAEA 5AI1A 1JB5A 1N5PA 3DUKA 1OHSA 1IQ8A 2CW9A 4LEHA 3CD63 1UCKA 3K5TA 5CXOA 1YIT3 2KRTA 1O7PB 1Q7Y4 3DGLA 2OOVC 1A2PA 2JDIH 2UGIA 4GL6A 1AY7A 1EKMA 1FGMA 4I5QA 3F8HA 1EEJA 1W02A 1TUHA 3MG1A 2IUKA 1VQM3 4L8PA 1RNBA 1K734 4XBTA 5HOHA 2E5OA 1YJW3 2SARA 3SLUA 2FXTA 1B2ZA 2ZHXB 2BHMA 1CQSA 1VQN3 1KWIA 1RGHA 4H61A
chains in the Genus database with same CATH topology
4LGQA 1K41A 3K7CA 3VGNA 2C11A 3HZPA 2WO0A 3WOEB 3NBBA 3N54B 4XBXA 2CKFB 3LMLA 3FG4A 3HIIA 2I9WA 3E99A 3K63A 5CK6A 2STDA 3GZYB 4STDA 1IQXA 2GXFA 3J7Yd 2XGNA 4X2OA 3K9MC 1OHOA 4RBNA 3SOYA 1JB2A 3N9HA 5ELJA 1UI8A 1N8QA 3RGRA 4K1UA 4DMGA 3GRDA 4N3VA 4PEJA 1DVDA 3PS8A 5G2GA 1R4CA 4KZ1A 1U5OA 1W6YA 2W6JH 4KFFA 2L4VA 4HYZA 1W4NA 3LTDA 4LMIA 5JPUA 1ZL3A 1STDA 5IG3A 2XR8B 3UJMA 1IK3A 3NM2A 3FGYA 2OOVA 5IG5A 1HU9A 3EN1B 3CCR3 1TU5A 2RGQA 4L8OA 1EQKA 3RGAA 5IEOA 2OWPA 3B7CA 1NJI4 4WWUC 1YGEA 3ER7A 3JUPA 2B1XB 3BNDA 1N5HA 4FCMA 3GWRA 3Q1CA 4OK0A 5DRVA 1SPUA 3GZXB 4R9LA 3D3LA 1V74A 3FG3A 3X41A 4Q53A 2ZDJA 4AKZA 5IERA 2W2CA 1L5GB 4EBGA 1WXXA 2XH9A 2YFLB 4WFOA 3G713 1DYUA 3EQQB 2OTL3 4XDWA 1VQ73 3F14A 3PYJA 1W2ZA 2CC3A 2V1LA 3FH1A 1FGQA 1QAFA 2O3OA 3FG1A 1S723 2PNCA 1Q40A 1QVG2 1AV4A 5FW5A 4EC6A 4N6NB 5EEOA 4LZIA 1ZX2A 3WDGB 1NU3A 2HMNB 4OUQA 4U13A 1GY5A 1ZO2A 2CFGA 2E2TA 3MPHA 3OWUA 4O2HA 1ASKA 1K28A 4MMZB 1Q40B 3G0KA 3DXOA 1ROAA 3CU3A 3CC43 2P09A 3UB1A 1WMOA 4FMAA 5CF2A 4FMDA 1SQWA 2XF3A 4J8TA 2CG0A 2W9QA 3WOFB 1IV9A 2GBXB 3CCL3 3JUOA 3SEDA 5AIFA 1VZZA 2XFSA 3NV0A 2Z6BA 1Q814 3EHCA 3I563 2CWVA 1OGXA 3C0KA 4HKVB 4NREA 3LT8A 5AEWB 1GS3A 5STDA 3JUQA 1N9JA 1WNHA 4O3VA 4O8SA 1Y4KA 1LVNA 2ML5A 3UAIA 1W00A 5DREA 2GEYA 1E97A 2YFJB 4KFEA 3I553 3NV0B 1UUWB 1IVWA 3CNXA 4K1VA 3FF0A 2B78A 4FMCA 2HMOB 1N8R4 6STDA 3OX9A 1M1K4 1IT8A 3KSED 2J5VA 1K8A4 5D81A 1US1A 2IA7A 3B4PA 1F8NA 1K8WA 1IDPA 1OGZA 3FLJA 3K0ZA 2GU1A 3IMAB 3CCV3 1E3VA 7STDA 3F40A 1TP6A 2BO9B 3AMOA 1YHQ3 5AIHA 4MMYB 2CK3H 3KN4A 2GU3A 1OHPA 4N6OB 2W56A 2CWWA 2ZL8A 4R4KA 2CFLA 3VSYA 1QAKA 1A67A 3X40A 3SX1A 1VQP3 3OWYA 5AYSC 4I4KA 2CWTA 3AMOB 5ELUA 1RJOA 3B4OA 3HIGA 4HVNA 3SVAA 2W56B 1JJ22 1DMNA 4N6LA 2ML6A 2HMMB 2CG1A 2XRXB 4QWTA 3JUNA 3H3HA 5FGOA 3S67A 1ROVA 2RCDA 1Q824 4XBYA 4HM4B 4L7KA 3X42A 3LZAA 1TFKA 3STDA 2QEX3 3FCSB 1M904 4HM0B 1VQ93 1UW1A 3FZWA 1D6UA 2K54A 4N6TA 3GZBA 1SGVA 3MHEA 3S29A 5D82A 1ULJB 5TGNA 5IW9A 2BMOB 1FGOA 2YFIB 3F8XA 4HZBB 4MMXB 3T8NA 2O9UX 2OTJ3 1OCVA 4LSOA 4Q1TA 2BMRB 3PXMA 5JPPA 1MOLA 2HMJB 1WXWA 3ALAA 4MEIA 3CMA3 1UI7A 3I0YA 1IQYA 3A76A 3VF1A 1G96A 4HM2B 2D42A 5EQLA 2F99A 1PU4A 3S5CA 5AYRB 3OV4A 1JKGA 1OACA 3LDFA 5CF1A 4NHFA 3G16A 3GZRA 1O7GB 4K61A 4FMBA 4MJDA 2RFRA 1LXEA 1TIJA 3CXC2 4HZ9B 3H51A 3DMCA 3HK4A 1GY7A 1TFOA 4IT7A 5AIIA 1AVKA 4N6UA 4J9AA 3M8CA 4N6MA 1ZE2A 3KIIA 3TDGA 1LNHA 4TX4A 3X3XA 2FGTA 2CIUA 2OCTA 2Z77A 3DY5A 2INXA 1JKGB 2CFWA 1WTHA 3NUVA 2W9PA 2D1WA 4HM5B 1JB4A 2FNQA 4CDLA 5JBSA 4HM3B 1RKYA 3EE1A 3V92A 3LH4A 1A90A 2B24B 3UL6A 4FCJA 1DMMA 3KZTA 3WA3A 4OVMA 1KQS2 1Z1SA 1M1XB 1S5AA 1NO3A 2Y74A 2OQEC 1WQLB 4AEQA 5EVHA 3X3YA 1QMAA 1W5ZA 4BTWA 1DMQA 1RRHA 3VSEA 3BNEA 1VQ63 2YX9A 2W0QA 3WMDA 1W6CA 2Z76A 3JVCA 1BUQA 1ZE1A 1O7MB 3G4S3 4XM4A 1IU7A 1M9GA 2P05A 3F7XA 4EV5A 1GD4A 1STFI 1VQO3 4RNYA 4EV2A 4HJLB 2XSHB 1GYBA 2XFTA 1IV7A 2MC8A 4JRFA 5I97A 3CME3 3IJEB 1W01A 3Q90A 2QIYA 4WP5A 1OH0A 1CYVA 3EX9A 2CFDA 3T8UA 3EF8A 4ZM8A 2Z7AA 1JN5A 4H3UA 4K90B 2J5TA 3CCU3 3DZLA 3EN8A 2RSXA 4HM7B 2SBLA 1JV2B 2KXGA 4WYKA 3CNMA 2UX0A 1FGTA 2IMJA 3FKAA 2LQVA 1T5YA 3D79A 1YVBI 1PFPA 2XSOB 1W2B2 1ISKA 1FUWA 3U97A 2HMLB 1EG9B 3F7SA 1FGRA 2E2VA 4WHAA 1VQ83 3CPOA 3NXJA 3CCM3 1QJGA 1R3EA 1ZS7A 2Q07A 5BXQA 4CCVA 1VQ43 5KP3A 3MG3A 4R80A 1JN5B 1GY6A 3BB9A 3EBTA 1IVXA 4RNZA 1VQL3 4WYKB 3MKIA 3PCSA 1YI23 5AEUB 3MSOA 4HM8B 3V98A 3PZWA 2GBWB 2M7OA 4IIAA 1W6GA 3S27A 1C7HA 3BNBA 2OQEA 3OW22 2MF7A 4BTXA 4R9KA 5IG0A 1QALA 3MYTA 1NB5I 1QVF2 3LYGA 1R3FA 1Q864 1SIIA 3F9SA 1O7HB 3KSPA 1K9M4 3S28A 3LTAA 1DVCA 2Y73A 3KKGA 2KCDA 3T0UA 3CCQ3 2K0MA 4N6V0 2WOHA 2HMKB 3ROBA 1D6YA 3D9RA 2F86B 1KC84 1GD3A 3B8LA 3IPTA 1E3RA 2QGUA 4R1KA 5LC7A 1KD14 3BNCA 2R4IA 3NQZA 1N9EA 3UL5A 3V99A 1OPYA 4RZMA 5IEPA 3QK9A 2AB4A 3LT9A 2CFKA 4FR9A 1OUNA 3Q2PA 1YJ93 1LOXA 3NHXA 3OWSA 2QA43 4AKYA 1NWWA 5LC6A 3QRDA 1AVLA 1VQK3 3PGBA 2CWUA 4G1MB 4XB5A 1SIHA 3ECFA 3PCRA 4ORLA 3WODG 2WGOA 3LTBA 3NM7A 1Q7HA 1UUVB 2WGQA 5D83A 4EYCA 2PZVA 2AS0A 1RN7A 1OF5A 3KFQC 4FCZA 3CC23 1YIJ3 1IVVA 1NB3I 3X3ZA 2P0MA 3FSDA 3CCE3 3FF2A 1FA3A 4HM6B 3DM8A 1O7WB 2BT3A 3N8BA 4HM1B 3OXAA 4X2HA 3CCS3 3MG2A 3LTCA 1J2BA 2W03A 3EJVA 4KFDA 3JUMA 2C10A 1YJN3 4KVHA 1KSIA 1CYUA 2E2UA 5CLKA 1OF5B 5IENA 1EA2A 2WOFA 2XEPA 3G8ZA 2IUJA 2BMQB 1NDOB 3WA2X 5HGRA 3LXUX 1WMPA 1JNQA 2A15A 5IG4A 5AIGA 3NX0A 3NQYA 3BLZA 4GB5A 2CX1A 3NBJA 1A2VA 1ULIB 2W04A 2XGLA 3SOAA 4BTYA 1U8CB 5BVBA 3LOYA 5KP4A 3G6E3 1WMNA 4O02B 5A0OB 4IPBA 3CC73 2BNGA 1W7CA 1D6ZA 1Q42A 3DGNA 3HI7A 1HKXA 1O7NB 1MNLA 3HX8A 1CEWI 3NBRA 5KP1A 1VQ53 3DGMA 3MWZA 3EC9A 1A2KA 2P38A 4XDVA 3RDEA 1SJWA 1AR0A 3L0RA 3UNLA 2P0XA 3SXXA 8CHOA 1IT7A 2F98A 3CPW2 2GEXA 3EBYA 3O8YA 3DGOA 3CCJ3 1JRQA 2LYXA 3GAXA 2CH9A 5IF6A 2CHCA 3KE7A 2JQ5A 3EB8A 4EXRA 1IVUA 3U1WA 2CX0A 1RRLA 4JF8A 5AI1A 1JB5A 1N5PA 3DUKA 1OHSA 1IQ8A 2CW9A 4LEHA 3CD63 3K5TA 5CXOA 1YIT3 2KRTA 1O7PB 1Q7Y4 3DGLA 2OOVC 2JDIH 4GL6A 1EKMA 1FGMA 3F8HA 1W02A 1TUHA 3MG1A 2IUKA 1VQM3 4L8PA 1K734 4XBTA 1YJW3 3SLUA 2FXTA 2BHMA 1CQSA 1VQN3 1KWIA 4HBRA 4H61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXX A;  1ZE1 A;  1R3E A;  3UAI A;  1ZS7 A;  2CWW A;  2Q07 A;  1J2B A;  2CX0 A;  1ZL3 A;  1IQ8 A;  1SQW A;  3LDF A;  1SGV A;  2B78 A;  1IT8 A;  2P38 A;  2J5V A;  1Q7H A;  2J5T A;  1K8W A;  2CX1 A;  2AS0 A;  1IT7 A;  2AB4 A;  4Q1T A;  1ZE2 A;  3C0K A;  1T5Y A;  3D79 A;  4DMG A;  1WXW A;  3VSE A;  1R3F A; 
#chains in the Genus database with same CATH topology
 4LGQ A;  4LYL B;  1K41 A;  3K7C A;  1ZGX A;  3VGN A;  2C11 A;  3HZP A;  2WO0 A;  3WOE B;  3NBB A;  3N54 B;  4XBX A;  2CKF B;  3LML A;  8RNT A;  3FG4 A;  1RLS A;  3HII A;  2I9W A;  3E99 A;  3K63 A;  1BNF A;  5CK6 A;  2STD A;  3GZY B;  4STD A;  3ZG5 A;  1IQX A;  2GXF A;  3J7Y d;  2XGN A;  4X2O A;  3K9M C;  2H0I A;  1OHO A;  1BNE A;  3GSP A;  4RBN A;  1MGW A;  1UDI I;  2F5W A;  5G1K A;  2AAD A;  3SOY A;  1JB2 A;  3N9H A;  5ELJ A;  1UI8 A;  1BU4 A;  1N8Q A;  1LOW A;  8CHO A;  3RGR A;  3KCH A;  4DMG A;  3GRD A;  4K1U A;  4KT3 B;  1BIR A;  4N3V A;  4PEJ A;  1DVD A;  3PS8 A;  4DKI A;  5G2G A;  1B2X A;  1I2E A;  1AQZ A;  1R4C A;  1U5O A;  1W6Y A;  1I2F A;  2L4V A;  2W6J H;  3A5E A;  4KFF A;  4HYZ A;  1W4N A;  3LTD A;  3HJY A;  4LMI A;  7GSP A;  1ZL3 A;  5JPU A;  1RTU A;  1I70 A;  1STD A;  5IG3 A;  2XR8 B;  3UJM A;  1IK3 A;  3NM2 A;  3FGY A;  4NPB A;  2OOV A;  5IG5 A;  1BRN L;  1HU9 A;  6GSP A;  2APO A;  1MGR A;  3EN1 B;  3CCR 3;  1TU5 A;  2RGQ A;  4L8O A;  4CI2 B;  1GOU A;  1EQK A;  3RGA A;  5IEO A;  2OWP A;  1RGC A;  1UCL A;  3B7C A;  1BNS A;  1NJI 4;  4WWU C;  1YGE A;  3ER7 A;  3JUP A;  2B1X B;  3BND A;  1N5H A;  4FCM A;  3M6V A;  3GWR A;  1RGL A;  3Q1C A;  4OK0 A;  5DRV A;  1SPU A;  3GZX B;  4R9L A;  3M6X A;  3D3L A;  1V74 A;  3FG3 A;  3X41 A;  2EY4 A;  4Q53 A;  2ZDJ A;  1G02 A;  2KF3 A;  4AKZ A;  5IER A;  2W2C A;  1L5G B;  4EBG A;  1WXX A;  2XH9 A;  2YFL B;  4WFO A;  3G71 3;  1LRA A;  1DYU A;  3EQQ B;  2FRX A;  2OTL 3;  4XDW A;  4HAA A;  1VQ7 3;  1RGG A;  3F14 A;  1X1U A;  1W2Z A;  2CC3 A;  2V1L A;  3FH1 A;  1FGQ A;  1QAF A;  2O3O A;  3FG1 A;  3PYJ A;  1B2M A;  1S72 3;  1GOV A;  2PNC A;  1Q40 A;  1RSN A;  1QVG 2;  4CPK A;  1AV4 A;  1UGH I;  5FW5 A;  1TJD A;  3WHO A;  4EC6 A;  4N6N B;  5EEO A;  4LZI A;  1ZX2 A;  2RNT A;  3WDG B;  1NU3 A;  3LJC A;  3HJW A;  2HMN B;  4OUQ A;  4U13 A;  1BVI A;  1GY5 A;  1ZO2 A;  2CFG A;  2E2T A;  3MPH A;  3OWU A;  4O2H A;  3RNT A;  1ASK A;  3SYU A;  1K28 A;  4MMZ B;  1Q40 B;  3G0K A;  1X1X A;  3DXO A;  1ROA A;  3CU3 A;  3CC4 3;  2P09 A;  3UB1 A;  1WMO A;  2HVY A;  4FMA A;  1GOY A;  1LOY A;  4FMD A;  5CF2 A;  1SQW A;  2XF3 A;  4J8T A;  2CG0 A;  2W9Q A;  1LQM B;  3WOF B;  1I0X A;  5GSP A;  1IV9 A;  2GBX B;  3CCL 3;  3JUO A;  3SED A;  1JZD A;  5AIF A;  1VZZ A;  2XFS A;  3NV0 A;  2Z6B A;  1Q81 4;  3EHC A;  3I56 3;  2CWV A;  3HAX A;  1OGX A;  3C0K A;  4HKV B;  4NRE A;  3LT8 A;  3Q3F A;  5AEW B;  1GS3 A;  5STD A;  1BSD A;  3JUQ A;  1PYL A;  1N9J A;  1WNH A;  4O3V A;  4O8S A;  1Y4K A;  1BNG A;  1LVN A;  2ML5 A;  1BRJ A;  3UAI A;  1BRS A;  1W00 A;  5DRE A;  4CI1 B;  2GEY A;  1E97 A;  2YFJ B;  4KFE A;  3I55 3;  3NV0 B;  1UUW B;  1IVW A;  1BGS A;  4TZ4 C;  3CNX A;  4K1V A;  3FF0 A;  2B78 A;  1YNV X;  2HMO B;  1MWS A;  4FMC A;  1N8R 4;  6STD A;  3OX9 A;  1M1K 4;  1IT8 A;  3KSE D;  2J5V A;  5BU4 A;  1K8A 4;  5D81 A;  1US1 A;  2IA7 A;  3B4P A;  1F8N A;  1K8W A;  1IDP A;  1OGZ A;  3FLJ A;  3K0Z A;  1JBR A;  2GU1 A;  3IMA B;  1FYS A;  1E3V A;  1BSE A;  3F40 A;  3WR2 A;  1TP6 A;  2BO9 B;  3AMO A;  7STD A;  1BRI A;  1RCK A;  1ZBO A;  1B20 A;  5AIH A;  1V58 A;  4MMY B;  2CK3 H;  1YHQ 3;  3KN4 A;  2GU3 A;  1OHP A;  4N6O B;  2W56 A;  2CWW A;  2ZL8 A;  1Q9E A;  4R4K A;  2CFL A;  3VSY A;  1QAK A;  4HOH A;  3X40 A;  1A67 A;  1TTO A;  3AHS A;  3SX1 A;  1RN1 A;  1VQP 3;  4BU4 A;  3OWY A;  5AYS C;  4I4K A;  5M19 A;  2CWT A;  3AMO B;  5ELU A;  1BRK A;  3LWO A;  1RJO A;  3B4O A;  3HIG A;  4HVN A;  3SVA A;  2C4B A;  2W56 B;  1JJ2 2;  1DMN A;  4N6L A;  2ANE A;  2HMM B;  2ML6 A;  2XRX B;  2CG1 A;  4QWT A;  3JUN A;  3H3H A;  5FGO A;  1JZO A;  1DE3 A;  3S67 A;  3M4X A;  1ROV A;  2RCD A;  1GSP A;  1Q82 4;  4XBY A;  4HM4 B;  4L7K A;  3X42 A;  3LZA A;  1TFK A;  3STD A;  2QEX 3;  2GSP A;  3FCS B;  1FZU A;  4KZ1 A;  1M90 4;  1B2S A;  4RNT A;  4HM0 B;  1VQ9 3;  1UW1 A;  3FZW A;  1D6U A;  2K54 A;  3D5G A;  4N6T A;  3GZB A;  3MQK A;  1SGV A;  3MHE A;  3S29 A;  5D82 A;  1ULJ B;  2KAA A;  2KF5 A;  5TGN A;  5IW9 A;  2BMO B;  1FGO A;  2YFI B;  3F8X A;  4HZB B;  4MMX B;  1GMQ A;  3T8N A;  2O9U X;  2OTJ 3;  1OCV A;  4LSO A;  4Q1T A;  2BMR B;  3PXM A;  5JPP A;  1MOL A;  2HMJ B;  1WXW A;  1WK2 A;  3ALA A;  1MWT A;  4MEI A;  3CMA 3;  1UI7 A;  3I0Y A;  1IQY A;  3A76 A;  7RNT A;  3VF1 A;  1G96 A;  4HM2 B;  2D42 A;  5EQL A;  2F99 A;  1PU4 A;  3S5C A;  1RGE A;  5AYR B;  1RN4 A;  3OV4 A;  1JKG A;  1OAC A;  3LDF A;  5CF1 A;  4NHF A;  3G16 A;  3GZR A;  1O7G B;  2HOH A;  4K61 A;  4FMB A;  4MJD A;  2RFR A;  1LXE A;  1TIJ A;  3CXC 2;  4HZ9 B;  3H51 A;  3DMC A;  3HK4 A;  1GY7 A;  1TFO A;  4IT7 A;  5AII A;  1AVK A;  4N6U A;  4J9A A;  3M8C A;  4N6M A;  1ZE2 A;  3KII A;  3TDG A;  1LNH A;  4TX4 A;  3X3X A;  1BAO A;  2FGT A;  1R4Y A;  2CIU A;  2OCT A;  2Z77 A;  3DY5 A;  5IEN A;  2INX A;  1JKG B;  1BAN A;  1JBS A;  2BU4 A;  2CFW A;  1RGF A;  1WTH A;  3NUV A;  2W9P A;  1UCI A;  2D1W A;  4HM5 B;  1UCJ A;  4BIR A;  1JB4 A;  1UOY A;  4ILF A;  2FNQ A;  4CDL A;  5JBS A;  4HM3 B;  1RKY A;  1YVS A;  3EE1 A;  3V92 A;  3LH4 A;  1A90 A;  2B24 B;  3UL6 A;  1RHL A;  4FCJ A;  1DMM A;  3U28 A;  3KZT A;  4OVM A;  3WA3 A;  4CJN A;  1Z1S A;  1KQS 2;  1M1X B;  1S5A A;  1NO3 A;  2Y74 A;  1UUG B;  1WQL B;  2OQE C;  4AEQ A;  5EVH A;  3X3Y A;  1QMA A;  1W5Z A;  4BTW A;  1BRG A;  1DMQ A;  1RRH A;  5M1A A;  3VSE A;  3BNE A;  1B3S A;  2YX9 A;  1VQ6 3;  2W0Q A;  3WMD A;  1W6C A;  1JBT A;  2Z76 A;  3JVC A;  1BUQ A;  3LWP A;  1ZE1 A;  1XNE A;  2IYJ A;  1BNR A;  1O7M B;  4CI3 B;  3AGN A;  4XM4 A;  3G4S 3;  1IU7 A;  1M9G A;  2P05 A;  3M65 A;  1LOV A;  3F7X A;  4EV5 A;  1GD4 A;  1STF I;  5G1L A;  1VQO 3;  4RNY A;  4EV2 A;  4HJL B;  2XSH B;  1GYB A;  2XFT A;  1B2U A;  1IV7 A;  2MC8 A;  4JRF A;  1NNV A;  5I97 A;  3CME 3;  3IUW A;  3IJE B;  1W01 A;  3Q90 A;  2QIY A;  4WP5 A;  1OH0 A;  1CYV A;  3EX9 A;  2CFD A;  3T8U A;  1FW7 A;  3EF8 A;  4ZM8 A;  2Z7A A;  1JN5 A;  4H3U A;  1G0T A;  2J5T A;  4K90 B;  3CCU 3;  1X1W A;  3DZL A;  3EN8 A;  2RSX A;  4HM7 B;  3ZG0 A;  3BIR A;  2SBL A;  1JV2 B;  2KXG A;  4WYK A;  3CNM A;  2UX0 A;  1FGT A;  2IMJ A;  3FKA A;  2LQV A;  5RNT A;  1T5Y A;  3D79 A;  1YVB I;  1PFP A;  2XSO B;  2IY2 A;  1W2B 2;  1ISK A;  1FUW A;  3U97 A;  2HML B;  1EG9 B;  3F7S A;  1FGR A;  2E2V A;  4WHA A;  1VQ8 3;  1C54 A;  3CPO A;  3NXJ A;  3CCM 3;  1QJG A;  1R3E A;  3D5I A;  1ZS7 A;  2Q07 A;  5BXQ A;  4CCV A;  1S04 A;  1VQ4 3;  5KP3 A;  3MG3 A;  4R80 A;  1JN5 B;  1GY6 A;  3BB9 A;  1RGK A;  3EBT A;  1IVX A;  1TRQ A;  4RNZ A;  1BOX A;  1VQL 3;  1T2I A;  4WYK B;  3MKI A;  3PCS A;  1YI2 3;  5AEU B;  3MSO A;  4GHO A;  4HM8 B;  3V98 A;  3PZW A;  2GBW B;  2M7O A;  4IIA A;  1W6G A;  1SAR A;  1C7H A;  3BNB A;  2OQE A;  3S27 A;  3OW2 2;  3HOH A;  2MF7 A;  4BTX A;  4R9K A;  5IG0 A;  1BNI A;  1QAL A;  1RDS A;  3MYT A;  1NB5 I;  1EUI C;  3LYG A;  1QVF 2;  1R3F A;  1Q86 4;  1SII A;  3F9S A;  1O7H B;  2R41 A;  1I8V A;  1MWR A;  3KSP A;  1K9M 4;  2H0H A;  3S28 A;  3LTA A;  1DVC A;  2Y73 A;  3AHW A;  1TRP A;  2KKU A;  1T2H A;  2KCD A;  3KKG A;  3T0U A;  3CCQ 3;  3DGY A;  3URP A;  2K0M A;  1BSB A;  4N6V 0;  1RNT A;  2WOH A;  2HMK B;  3ROB A;  1BRH A;  1D6Y A;  3D9R A;  2F86 B;  1KC8 4;  1GD3 A;  3B8L A;  3IPT A;  1E3R A;  2QGU A;  4R1K A;  5LC7 A;  1KD1 4;  3BNC A;  2R4I A;  1RMS A;  3NQZ A;  1N9E A;  3UL5 A;  3V99 A;  4BL2 A;  3ZFZ A;  1OPY A;  4RZM A;  1I3F A;  5IEP A;  3QK9 A;  2AB4 A;  2ZA4 A;  2RBI A;  2F5M A;  3LT9 A;  2CFK A;  4EW5 A;  4FR9 A;  3DH2 A;  1OUN A;  2J8X B;  3Q2P A;  1YJ9 3;  1LOX A;  3NHX A;  3OWS A;  3BU4 A;  2UUG C;  1DET A;  2QA4 3;  4AKY A;  1UGI A;  1NWW A;  5LC6 A;  1T3B A;  3QRD A;  1AVL A;  1MWU A;  1VQK 3;  3PGB A;  2AUS A;  2CWU A;  2DP9 A;  4G1M B;  1SIH A;  3ECF A;  4HBR A;  3PCR A;  3LWQ A;  1I0V A;  4J5K A;  4XB5 A;  4ORL A;  1CH0 A;  3WOD G;  1HYF A;  2WGO A;  3LTB A;  3AGO A;  3NM7 A;  1Q7H A;  1UUV B;  2WGQ A;  5D83 A;  4EYC A;  2PZV A;  2AS0 A;  1RN7 A;  1OF5 A;  3KFQ C;  1FUT A;  4FCZ A;  3CC2 3;  1YIJ 3;  1IVV A;  1NB3 I;  2RFK A;  3X3Z A;  2P0M A;  3FSD A;  3CCE 3;  3FF2 A;  1FA3 A;  4HM6 B;  3DM8 A;  1BSA A;  1O7W B;  2BT3 A;  3N8B A;  3ZV0 C;  2KF6 A;  4HM1 B;  1TE7 A;  3OXA A;  4X2H A;  3CCS 3;  1BUJ A;  3MG2 A;  1IYY A;  3LTC A;  1J2B A;  2K3D A;  2W03 A;  3EJV A;  4KFD A;  3JUM A;  2C10 A;  1YJN 3;  1X1Y A;  4KVH A;  1KSI A;  1CYU A;  2KF4 A;  2Z0T A;  2E2U A;  1OF5 B;  1RGA A;  5CLK A;  1EA2 A;  2WOF A;  2XEP A;  1YGW A;  3G8Z A;  2IUJ A;  2BMQ B;  1NDO B;  3WA2 X;  5BIR A;  5HGR A;  3LXU X;  1WMP A;  1JNQ A;  2A15 A;  5IG4 A;  3M6U A;  3NX0 A;  5AIG A;  1HZ1 A;  3NQY A;  3BLZ A;  4GB5 A;  2CX1 A;  1VQQ A;  3NBJ A;  1A2V A;  1ULI B;  2W04 A;  1BNJ A;  4BL3 A;  3LWV A;  2BIR A;  2XGL A;  3SOA A;  4BTY A;  1U8C B;  5BVB A;  3LOY A;  3M6W A;  5KP4 A;  3G6E 3;  1GMR A;  1LQG C;  2H0G A;  3D4A A;  1LNI A;  1WMN A;  4O02 B;  5A0O B;  4IPB A;  3CC7 3;  3LWR A;  1I3I A;  2BNG A;  1W7C A;  1D6Z A;  1Q42 A;  3DGN A;  3HI7 A;  1HKX A;  1O7N B;  1BSC A;  1MNL A;  3HX8 A;  1CEW I;  3NBR A;  5KP1 A;  1VQ5 3;  4J5G A;  9RNT A;  3DGM A;  3MWZ A;  3EC9 A;  1A2K A;  2P38 A;  4XDV A;  3RDE A;  1SJW A;  1AR0 A;  1B21 A;  3L0R A;  1I2G A;  2F4Y A;  2P0X A;  3SXX A;  1IT7 A;  4GSP A;  2F98 A;  3UNL A;  2GEX A;  3EBY A;  3CPW 2;  1RCL A;  3O8Y A;  3DGO A;  6RNT A;  3CCJ 3;  1FUS A;  1JRQ A;  2LYX A;  3GAX A;  2CH9 A;  5IF6 A;  3CCV 3;  2CHC A;  1B27 A;  3KE7 A;  1GMP A;  2F56 A;  2JQ5 A;  3EB8 A;  1V57 A;  4EXR A;  1IVU A;  2L1S A;  2CX0 A;  1PY3 A;  3U1W A;  5M18 A;  1RRL A;  4JF8 A;  2AAE A;  5AI1 A;  1JB5 A;  1N5P A;  3DUK A;  1OHS A;  1IQ8 A;  2CW9 A;  4LEH A;  3CD6 3;  1UCK A;  3K5T A;  5CXO A;  1YIT 3;  2KRT A;  1O7P B;  1Q7Y 4;  3DGL A;  2OOV C;  1A2P A;  2JDI H;  2UGI A;  4GL6 A;  1AY7 A;  1EKM A;  1FGM A;  4I5Q A;  3F8H A;  1EEJ A;  1W02 A;  1TUH A;  3MG1 A;  2IUK A;  1VQM 3;  4L8P A;  1RNB A;  1K73 4;  4XBT A;  5HOH A;  2E5O A;  1YJW 3;  2SAR A;  3SLU A;  2FXT A;  1B2Z A;  2ZHX B;  2BHM A;  1CQS A;  1VQN 3;  1KWI A;  1RGH A;  4H61 A; 
#chains in the Genus database with same CATH homology
 4LGQ A;  1K41 A;  3K7C A;  3VGN A;  2C11 A;  3HZP A;  2WO0 A;  3WOE B;  3NBB A;  3N54 B;  4XBX A;  2CKF B;  3LML A;  3FG4 A;  3HII A;  2I9W A;  3E99 A;  3K63 A;  5CK6 A;  2STD A;  3GZY B;  4STD A;  1IQX A;  2GXF A;  3J7Y d;  2XGN A;  4X2O A;  3K9M C;  1OHO A;  4RBN A;  3SOY A;  1JB2 A;  3N9H A;  5ELJ A;  1UI8 A;  1N8Q A;  3RGR A;  4K1U A;  4DMG A;  3GRD A;  4N3V A;  4PEJ A;  1DVD A;  3PS8 A;  5G2G A;  1R4C A;  4KZ1 A;  1U5O A;  1W6Y A;  2W6J H;  4KFF A;  2L4V A;  4HYZ A;  1W4N A;  3LTD A;  4LMI A;  5JPU A;  1ZL3 A;  1STD A;  5IG3 A;  2XR8 B;  3UJM A;  1IK3 A;  3NM2 A;  3FGY A;  2OOV A;  5IG5 A;  1HU9 A;  3EN1 B;  3CCR 3;  1TU5 A;  2RGQ A;  4L8O A;  1EQK A;  3RGA A;  5IEO A;  2OWP A;  3B7C A;  1NJI 4;  4WWU C;  1YGE A;  3ER7 A;  3JUP A;  2B1X B;  3BND A;  1N5H A;  4FCM A;  3GWR A;  3Q1C A;  4OK0 A;  5DRV A;  1SPU A;  3GZX B;  4R9L A;  3D3L A;  1V74 A;  3FG3 A;  3X41 A;  4Q53 A;  2ZDJ A;  4AKZ A;  5IER A;  2W2C A;  1L5G B;  4EBG A;  1WXX A;  2XH9 A;  2YFL B;  4WFO A;  3G71 3;  1DYU A;  3EQQ B;  2OTL 3;  4XDW A;  1VQ7 3;  3F14 A;  3PYJ A;  1W2Z A;  2CC3 A;  2V1L A;  3FH1 A;  1FGQ A;  1QAF A;  2O3O A;  3FG1 A;  1S72 3;  2PNC A;  1Q40 A;  1QVG 2;  1AV4 A;  5FW5 A;  4EC6 A;  4N6N B;  5EEO A;  4LZI A;  1ZX2 A;  3WDG B;  1NU3 A;  2HMN B;  4OUQ A;  4U13 A;  1GY5 A;  1ZO2 A;  2CFG A;  2E2T A;  3MPH A;  3OWU A;  4O2H A;  1ASK A;  1K28 A;  4MMZ B;  1Q40 B;  3G0K A;  3DXO A;  1ROA A;  3CU3 A;  3CC4 3;  2P09 A;  3UB1 A;  1WMO A;  4FMA A;  5CF2 A;  4FMD A;  1SQW A;  2XF3 A;  4J8T A;  2CG0 A;  2W9Q A;  3WOF B;  1IV9 A;  2GBX B;  3CCL 3;  3JUO A;  3SED A;  5AIF A;  1VZZ A;  2XFS A;  3NV0 A;  2Z6B A;  1Q81 4;  3EHC A;  3I56 3;  2CWV A;  1OGX A;  3C0K A;  4HKV B;  4NRE A;  3LT8 A;  5AEW B;  1GS3 A;  5STD A;  3JUQ A;  1N9J A;  1WNH A;  4O3V A;  4O8S A;  1Y4K A;  1LVN A;  2ML5 A;  3UAI A;  1W00 A;  5DRE A;  2GEY A;  1E97 A;  2YFJ B;  4KFE A;  3I55 3;  3NV0 B;  1UUW B;  1IVW A;  3CNX A;  4K1V A;  3FF0 A;  2B78 A;  4FMC A;  2HMO B;  1N8R 4;  6STD A;  3OX9 A;  1M1K 4;  1IT8 A;  3KSE D;  2J5V A;  1K8A 4;  5D81 A;  1US1 A;  2IA7 A;  3B4P A;  1F8N A;  1K8W A;  1IDP A;  1OGZ A;  3FLJ A;  3K0Z A;  2GU1 A;  3IMA B;  3CCV 3;  1E3V A;  7STD A;  3F40 A;  1TP6 A;  2BO9 B;  3AMO A;  1YHQ 3;  5AIH A;  4MMY B;  2CK3 H;  3KN4 A;  2GU3 A;  1OHP A;  4N6O B;  2W56 A;  2CWW A;  2ZL8 A;  4R4K A;  2CFL A;  3VSY A;  1QAK A;  1A67 A;  3X40 A;  3SX1 A;  1VQP 3;  3OWY A;  5AYS C;  4I4K A;  2CWT A;  3AMO B;  5ELU A;  1RJO A;  3B4O A;  3HIG A;  4HVN A;  3SVA A;  2W56 B;  1JJ2 2;  1DMN A;  4N6L A;  2ML6 A;  2HMM B;  2CG1 A;  2XRX B;  4QWT A;  3JUN A;  3H3H A;  5FGO A;  3S67 A;  1ROV A;  2RCD A;  1Q82 4;  4XBY A;  4HM4 B;  4L7K A;  3X42 A;  3LZA A;  1TFK A;  3STD A;  2QEX 3;  3FCS B;  1M90 4;  4HM0 B;  1VQ9 3;  1UW1 A;  3FZW A;  1D6U A;  2K54 A;  4N6T A;  3GZB A;  1SGV A;  3MHE A;  3S29 A;  5D82 A;  1ULJ B;  5TGN A;  5IW9 A;  2BMO B;  1FGO A;  2YFI B;  3F8X A;  4HZB B;  4MMX B;  3T8N A;  2O9U X;  2OTJ 3;  1OCV A;  4LSO A;  4Q1T A;  2BMR B;  3PXM A;  5JPP A;  1MOL A;  2HMJ B;  1WXW A;  3ALA A;  4MEI A;  3CMA 3;  1UI7 A;  3I0Y A;  1IQY A;  3A76 A;  3VF1 A;  1G96 A;  4HM2 B;  2D42 A;  5EQL A;  2F99 A;  1PU4 A;  3S5C A;  5AYR B;  3OV4 A;  1JKG A;  1OAC A;  3LDF A;  5CF1 A;  4NHF A;  3G16 A;  3GZR A;  1O7G B;  4K61 A;  4FMB A;  4MJD A;  2RFR A;  1LXE A;  1TIJ A;  3CXC 2;  4HZ9 B;  3H51 A;  3DMC A;  3HK4 A;  1GY7 A;  1TFO A;  4IT7 A;  5AII A;  1AVK A;  4N6U A;  4J9A A;  3M8C A;  4N6M A;  1ZE2 A;  3KII A;  3TDG A;  1LNH A;  4TX4 A;  3X3X A;  2FGT A;  2CIU A;  2OCT A;  2Z77 A;  3DY5 A;  2INX A;  1JKG B;  2CFW A;  1WTH A;  3NUV A;  2W9P A;  2D1W A;  4HM5 B;  1JB4 A;  2FNQ A;  4CDL A;  5JBS A;  4HM3 B;  1RKY A;  3EE1 A;  3V92 A;  3LH4 A;  1A90 A;  2B24 B;  3UL6 A;  4FCJ A;  1DMM A;  3KZT A;  3WA3 A;  4OVM A;  1KQS 2;  1Z1S A;  1M1X B;  1S5A A;  1NO3 A;  2Y74 A;  2OQE C;  1WQL B;  4AEQ A;  5EVH A;  3X3Y A;  1QMA A;  1W5Z A;  4BTW A;  1DMQ A;  1RRH A;  3VSE A;  3BNE A;  1VQ6 3;  2YX9 A;  2W0Q A;  3WMD A;  1W6C A;  2Z76 A;  3JVC A;  1BUQ A;  1ZE1 A;  1O7M B;  3G4S 3;  4XM4 A;  1IU7 A;  1M9G A;  2P05 A;  3F7X A;  4EV5 A;  1GD4 A;  1STF I;  1VQO 3;  4RNY A;  4EV2 A;  4HJL B;  2XSH B;  1GYB A;  2XFT A;  1IV7 A;  2MC8 A;  4JRF A;  5I97 A;  3CME 3;  3IJE B;  1W01 A;  3Q90 A;  2QIY A;  4WP5 A;  1OH0 A;  1CYV A;  3EX9 A;  2CFD A;  3T8U A;  3EF8 A;  4ZM8 A;  2Z7A A;  1JN5 A;  4H3U A;  4K90 B;  2J5T A;  3CCU 3;  3DZL A;  3EN8 A;  2RSX A;  4HM7 B;  2SBL A;  1JV2 B;  2KXG A;  4WYK A;  3CNM A;  2UX0 A;  1FGT A;  2IMJ A;  3FKA A;  2LQV A;  1T5Y A;  3D79 A;  1YVB I;  1PFP A;  2XSO B;  1W2B 2;  1ISK A;  1FUW A;  3U97 A;  2HML B;  1EG9 B;  3F7S A;  1FGR A;  2E2V A;  4WHA A;  1VQ8 3;  3CPO A;  3NXJ A;  3CCM 3;  1QJG A;  1R3E A;  1ZS7 A;  2Q07 A;  5BXQ A;  4CCV A;  1VQ4 3;  5KP3 A;  3MG3 A;  4R80 A;  1JN5 B;  1GY6 A;  3BB9 A;  3EBT A;  1IVX A;  4RNZ A;  1VQL 3;  4WYK B;  3MKI A;  3PCS A;  1YI2 3;  5AEU B;  3MSO A;  4HM8 B;  3V98 A;  3PZW A;  2GBW B;  2M7O A;  4IIA A;  1W6G A;  3S27 A;  1C7H A;  3BNB A;  2OQE A;  3OW2 2;  2MF7 A;  4BTX A;  4R9K A;  5IG0 A;  1QAL A;  3MYT A;  1NB5 I;  1QVF 2;  3LYG A;  1R3F A;  1Q86 4;  1SII A;  3F9S A;  1O7H B;  3KSP A;  1K9M 4;  3S28 A;  3LTA A;  1DVC A;  2Y73 A;  3KKG A;  2KCD A;  3T0U A;  3CCQ 3;  2K0M A;  4N6V 0;  2WOH A;  2HMK B;  3ROB A;  1D6Y A;  3D9R A;  2F86 B;  1KC8 4;  1GD3 A;  3B8L A;  3IPT A;  1E3R A;  2QGU A;  4R1K A;  5LC7 A;  1KD1 4;  3BNC A;  2R4I A;  3NQZ A;  1N9E A;  3UL5 A;  3V99 A;  1OPY A;  4RZM A;  5IEP A;  3QK9 A;  2AB4 A;  3LT9 A;  2CFK A;  4FR9 A;  1OUN A;  3Q2P A;  1YJ9 3;  1LOX A;  3NHX A;  3OWS A;  2QA4 3;  4AKY A;  1NWW A;  5LC6 A;  3QRD A;  1AVL A;  1VQK 3;  3PGB A;  2CWU A;  4G1M B;  4XB5 A;  1SIH A;  3ECF A;  3PCR A;  4ORL A;  3WOD G;  2WGO A;  3LTB A;  3NM7 A;  1Q7H A;  1UUV B;  2WGQ A;  5D83 A;  4EYC A;  2PZV A;  2AS0 A;  1RN7 A;  1OF5 A;  3KFQ C;  4FCZ A;  3CC2 3;  1YIJ 3;  1IVV A;  1NB3 I;  3X3Z A;  2P0M A;  3FSD A;  3CCE 3;  3FF2 A;  1FA3 A;  4HM6 B;  3DM8 A;  1O7W B;  2BT3 A;  3N8B A;  4HM1 B;  3OXA A;  4X2H A;  3CCS 3;  3MG2 A;  3LTC A;  1J2B A;  2W03 A;  3EJV A;  4KFD A;  3JUM A;  2C10 A;  1YJN 3;  4KVH A;  1KSI A;  1CYU A;  2E2U A;  5CLK A;  1OF5 B;  5IEN A;  1EA2 A;  2WOF A;  2XEP A;  3G8Z A;  2IUJ A;  2BMQ B;  1NDO B;  3WA2 X;  5HGR A;  3LXU X;  1WMP A;  1JNQ A;  2A15 A;  5IG4 A;  5AIG A;  3NX0 A;  3NQY A;  3BLZ A;  4GB5 A;  2CX1 A;  3NBJ A;  1A2V A;  1ULI B;  2W04 A;  2XGL A;  3SOA A;  4BTY A;  1U8C B;  5BVB A;  3LOY A;  5KP4 A;  3G6E 3;  1WMN A;  4O02 B;  5A0O B;  4IPB A;  3CC7 3;  2BNG A;  1W7C A;  1D6Z A;  1Q42 A;  3DGN A;  3HI7 A;  1HKX A;  1O7N B;  1MNL A;  3HX8 A;  1CEW I;  3NBR A;  5KP1 A;  1VQ5 3;  3DGM A;  3MWZ A;  3EC9 A;  1A2K A;  2P38 A;  4XDV A;  3RDE A;  1SJW A;  1AR0 A;  3L0R A;  3UNL A;  2P0X A;  3SXX A;  8CHO A;  1IT7 A;  2F98 A;  3CPW 2;  2GEX A;  3EBY A;  3O8Y A;  3DGO A;  3CCJ 3;  1JRQ A;  2LYX A;  3GAX A;  2CH9 A;  5IF6 A;  2CHC A;  3KE7 A;  2JQ5 A;  3EB8 A;  4EXR A;  1IVU A;  3U1W A;  2CX0 A;  1RRL A;  4JF8 A;  5AI1 A;  1JB5 A;  1N5P A;  3DUK A;  1OHS A;  1IQ8 A;  2CW9 A;  4LEH A;  3CD6 3;  3K5T A;  5CXO A;  1YIT 3;  2KRT A;  1O7P B;  1Q7Y 4;  3DGL A;  2OOV C;  2JDI H;  4GL6 A;  1EKM A;  1FGM A;  3F8H A;  1W02 A;  1TUH A;  3MG1 A;  2IUK A;  1VQM 3;  4L8P A;  1K73 4;  4XBT A;  1YJW 3;  3SLU A;  2FXT A;  2BHM A;  1CQS A;  1VQN 3;  1KWI A;  4HBR A;  4H61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...