1T5YA

Crystal structure of northeast structural genomics consortium target hr2118: a human homolog of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
170
Chain Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords SACCHAROMYCES CEREVISIAE Nip7p HOMOLOG
publication title Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p
rcsb
source organism Homo sapiens
total genus 43
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1t5yA02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1t5yA01
2B78A 1WXXA 1K8WA 4DMGA 2P38A 2Q07A 1SQWA 3C0KA 1IT7A 3LDFA 1ZS7A 3D79A 1WXWA 1R3FA 2CX1A 2CX0A 1ZE2A 1IQ8A 2J5TA 1R3EA 3VSEA 1J2BA 1ZL3A 3UAIA 1T5YA 1ZE1A 2AS0A 4Q1TA 2J5VA 2CWWA 1Q7HA 1SGVA 1IT8A 2AB4A
chains in the Genus database with same CATH superfamily
1GOYA 1A2PA 2FNQA 1BRHA 1RMSA 4R9LA 3CCU3 1NJI4 3X42A 1Y4KA 1DMNA 3MQKA 2R4IA 4LMIA 5RNTA 1GS3A 3NX0A 3OWSA 4J5GA 4AKZA 3LTBA 2RCDA 1IVXA 3LH4A 1CEWI 1OGZA 3BB9A 3L0RA 3EE1A 1TFKA 1YVBI 1ASKA 2WOHA 2KF6A 3GRDA 3S28A 2K0MA 3LTDA 2KKUA 4EXRA 1YJN3 1Q7Y4 1KQS2 4HZBB 2E2VA 2OOVA 1UCIA 4BU4A 5I97A 4FCMA 1TRPA 3EBYA 2BMRB 1JB4A 1A67A 1DETA 1B3SA 3GZBA 4N6MA 1ZL3A 2F5WA 4OK0A 3UAIA 1VQ93 2CWWA 4AKYA 3M6XA 1PFPA 1FGTA 3F14A 1RCLA 5CXOA 3Q90A 1SIIA 4HAAA 4HYZA 3NM2A 1D6ZA 2CFWA 1DVCA 3GSPA 4CI1B 2W9QA 4L7KA 1B2UA 1ISKA 3MG3A 1XNEA 3DGOA 2E5OA 3EC9A 3MG2A 5AIFA 3UJMA 2OTL3 3G4S3 2CX0A 3HIGA 3NBRA 3GAXA 1O7PB 1QVG2 1EUIC 1RGCA 3NUVA 3FLJA 3SXXA 3MHEA 2P0MA 2Y74A 1YIJ3 1I3FA 2RFRA 4KT3B 2HOHA 5M1AA 4J8TA 1C7HA 2M7OA 5IG4A 2CHCA 4N6TA 5KP4A 1RSNA 1FUSA 1LOWA 3DXOA 3CPOA 2O3OA 1GY5A 3H3HA 3OWUA 3B4PA 4I5QA 4MMYB 4TX4A 2HMLB 3OXAA 2KF5A 3CCL3 3HAXA 1GOVA 2V1LA 1STDA 1JB5A 5AEUB 1GY6A 5IF6A 1A2KA 3B7CA 2WGQA 1UUWB 3GWRA 3M8CA 4ZM8A 1LQMB 2ZL8A 1IVWA 1W7CA 1RN4A 5KP3A 5IENA 2KAAA 2DP9A 5G1KA 5IEPA 3LWRA 1VQ53 3KSED 3WA3A 1O7MB 2XEPA 3EF8A 3S27A 2FXTA 4L8OA 3UNLA 1NU3A 3EN1B 1N8R4 5AYSC 2KCDA 4CI2B 1WQLB 3X41A 1BSAA 3IUWA 3CME3 1FGQA 3KSPA 1U8CB 1UW1A 1K734 3M65A 1BRGA 2AB4A 2F98A 2HMOB 2BMOB 5EEOA 1V58A 1IK3A 1NWWA 3AGOA 2CG1A 2KF4A 2QEX3 3CC23 4HBRA 3X3XA 1BNJA 1IT7A 4ILFA 3S29A 2CFKA 2K3DA 3CU3A 4XM4A 2KF3A 2W6JH 5HGRA 2JDIH 3QRDA 1K8A4 3DH2A 3RGRA 2Z7AA 1VZZA 3K5TA 2L1SA 3MPHA 1IQ8A 1Q864 4TZ4C 1GSPA 4HM0B 4XDWA 2XRXB 1Q814 1US1A 1PY3A 1W00A 3ZV0C 2AUSA 3KE7A 4HKVB 1UDII 1TUHA 1J2BA 3F7SA 2W0QA 2H0HA 1A2VA 2KRTA 2ZHXB 1WMPA 2J5VA 1BGSA 1MNLA 3M6VA 1BSEA 3WMDA 3KCHA 1C54A 3KN4A 2GBXB 2BU4A 7STDA 4O02B 1NNVA 1WXXA 4WYKB 1SPUA 4IPBA 1IDPA 3N9HA 1T2HA 2HVYA 1FW7A 1UCLA 2WO0A 1BNIA 1OPYA 3HK4A 2INXA 3Q1CA 5AIHA 2BHMA 3DZLA 1BNEA 1GMPA 3T8NA 2ML6A 1DMQA 3T0UA 7RNTA 2RFKA 1DVDA 4LSOA 1RKYA 1BSCA 5IG3A 4MJDA 4HOHA 3SOYA 1YI23 3G8ZA 1BNSA 3KZTA 3ZG0A 4FMDA 1RJOA 1AVKA 3X3ZA 1UCJA 3VF1A 4CJNA 1ZE1A 2KXGA 5A0OB 4K1UA 5G2GA 2F86B 3N54B 4R1KA 2IUJA 2BT3A 2UGIA 1RGAA 1W02A 1EEJA 1VQL3 2F4YA 1LOYA 1UUVB 1VQ73 3A5EA 3DGMA 2ZA4A 1TTOA 1LOVA 2APOA 1I0XA 3RDEA 3I553 1SIHA 3CCJ3 1R3FA 2B1XB 2W03A 3WR2A 2IY2A 2QIYA 1RLSA 3J7Yd 1B21A 4NREA 2XSHB 4BTXA 2XFSA 4X2HA 4EV2A 4LZIA 4XB5A 1YHQ3 4EYCA 1HKXA 1RGEA 3VSEA 1BOXA 1VQQA 2YX9A 3PYJA 3G713 4RBNA 5BIRA 3K9MC 1OH0A 1T5YA 3CPW2 3NM7A 4G1MB 1YGEA 2W56A 1VQ63 5CF2A 2ML5A 1BUQA 1I2FA 3SEDA 4I4KA 1MWUA 2B78A 3WOFB 1L5GB 3GZRA 1IQYA 1JBSA 1R4YA 4GHOA 1E97A 3HIIA 1TJDA 1DMMA 1S723 1MWTA 5STDA 1WNHA 1RGHA 3VGNA 2P09A 1TE7A 3M4XA 4WWUC 3IJEB 3PCRA 3EBTA 4HZ9B 1I70A 6RNTA 1FYSA 3ROBA 3CC73 1T2IA 3WDGB 1BSDA 3BNCA 4RNZA 5JPPA 3IPTA 1SARA 1JN5A 2I9WA 4HM5B 4NPBA 4KFDA 5EQLA 1CH0A 3AGNA 3AMOB 3IMAB 1GD4A 3ZFZA 3K63A 2XSOB 2LQVA 1T3BA 4N6V0 1S04A 1W6CA 1QMAA 4CCVA 1RN7A 1B2ZA 2HMJB 2IYJA 2YFJB 2A15A 3LWPA 4N6UA 1NDOB 2W56B 2XGLA 1O7HB 1KD14 3T8UA 2GU3A 1GY7A 4N6LA 2P38A 5BVBA 1VQP3 2Q07A 5AIGA 1YJW3 3H51A 3X3YA 1ZBOA 3V98A 3NQZA 3LDFA 4XBXA 1AVLA 1I3IA 3LMLA 3HJYA 3F8HA 4HM6B 4O8SA 3STDA 2CX1A 2GEYA 3KIIA 3MSOA 3VSYA 2BIRA 1VQK3 4XBYA 1STFI 2LYXA 1DE3A 1ZE2A 1O7NB 4BTWA 3EQQB 2H0IA 3CCM3 2P05A 1MWSA 2CW9A 2HMKB 1UI7A 4FMAA 1BRJA 5IEOA 4STDA 1M904 1LXEA 2GBWB 2YFIB 4XBTA 5D81A 1WMOA 4FCZA 1O7GB 2W9PA 5M19A 1JN5B 1GD3A 3FF0A 3BNDA 6GSPA 1JNQA 1F8NA 3EN8A 3CC43 1OUNA 4WYKA 1VQN3 2YFLB 1FA3A 5AYRB 1K8WA 4MEIA 1B2MA 3N8BA 3BLZA 1TIJA 4QWTA 3RGAA 3JUOA 3LOYA 1ZS7A 1RRHA 4BTYA 2GEXA 4FR9A 4HM4B 5M18A 1BNRA 1JBTA 1LRAA 1RNTA 3HX8A 3LWVA 3CXC2 2JQ5A 3AHSA 4R4KA 1RTUA 4WP5A 2J5TA 4CI3B 2O9UX 2UUGC 1OCVA 1UGIA 1R3EA 3FH1A 3WHOA 3OW22 4K90B 3U1WA 3D5IA 1OHPA 3DUKA 1G02A 1FGRA 5BU4A 3LT9A 1S5AA 4FMBA 1GMQA 3LYGA 1YNVX 3F9SA 1Q7HA 7GSPA 1IT8A 4X2OA 1I2EA 3LT8A 1RGLA 1FGMA 1K9M4 3CNXA 3NV0A 2WGOA 2CG0A 3Q3FA 1IQXA 2IUKA 4Q53A 2CFLA 1SQWA 4WHAA 2ZDJA 2Z77A 4U13A 4NHFA 1B20A 3DY5A 3U97A 2SBLA 2E2TA 1JKGA 1BNFA 4EBGA 2F5MA 5GSPA 1YGWA 5ELUA 1JZOA 5CK6A 2OCTA 2L4VA 5FW5A 1EG9B 1BUJA 5HOHA 4IT7A 3DGYA 2CFDA 3FG1A 1IV9A 2GXFA 4Q1TA 4JRFA 3WOEB 1EA2A 4GL6A 4EV5A 2CWUA 3D5GA 3EX9A 4LGQA 1M1XB 1PYLA 5AIIA 1NO3A 1BU4A 4KZ1A 2EY4A 5DREA 3HZPA 1IVVA 4DMGA 1I0VA 1W4NA 3MKIA 3URPA 2CC3A 3C0KA 4N3VA 4RNTA 4EW5A 3CCQ3 3NV0B 3FG4A 3K7CA 4XDVA 5KP1A 1X1YA 3MG1A 2AAEA 1MGWA 3S67A 3TDGA 3PCSA 1RGKA 3F7XA 3FGYA 5LC7A 2C4BA 3BIRA 1JKGB 3JVCA 3AMOA 2CFGA 4MMZB 3LZAA 1BANA 1RHLA 3CMA3 1YIT3 5IG5A 2GU1A 3JUMA 1VQM3 1Z1SA 1E3RA 2F99A 1E3VA 3FSDA 3Q2PA 1W6YA 2RSXA 1WK2A 3CD63 1W2ZA 3M6WA 3NHXA 1RCKA 2CH9A 3CNMA 4O3VA 1SGVA 4KFFA 5IERA 3D9RA 1UUGB 4HM1B 3NQYA 3E99A 1AR0A 1BRNL 2IA7A 3FG3A 3QK9A 1QJGA 2K54A 2Z6BA 3BNBA 1X1XA 3DGNA 1FZUA 3F40A 3X40A 1W01A 2QA43 1EQKA 3SX1A 2E2UA 1ZGXA 3FCSB 5AEWB 4HVNA 1FUTA 1ROVA 1ZO2A 3V92A 1GMRA 8RNTA 3B4OA 1BIRA 1I2GA 1IYYA 3OV4A 1KC84 3JUQA 5FGOA 2HMNB 1D6UA 1Q40A 3DMCA 1AV4A 4HJLB 1NB3I 2R41A 2STDA 4CPKA 3SOAA 2BO9B 1WMNA 1OHOA 3OX9A 3BNEA 1N9EA 3ER7A 1K28A 4AEQA 3F8XA 8CHOA 2W2CA 1RDSA 1U5OA 4GB5A 5DRVA 1MWRA 2ANEA 2FRXA 1V74A 1RN1A 1BNGA 1QAKA 2QGUA 1UGHI 1SJWA 1VQ83 3V99A 1IV7A 2XH9A 4CDLA 3HJWA 1YVSA 2AADA 5CF1A 1RNBA 2CWVA 2D42A 2J8XB 2D1WA 1X1UA 3CCE3 1NB5I 1IU7A 1MOLA 1Q42A 2XF3A 4HM3B 4EC6A 2PZVA 3JUPA 1N8QA 1GYBA 1ULIB 1BRIA 2OWPA 3WA2X 2RGQA 1JV2B 3G16A 3A76A 3LXUX 1JRQA 3PXMA 5JPUA 1IVUA 1CYVA 1WTHA 1TRQA 3D3LA 1FGOA 1PU4A 3UL5A 1LQGC 4RNYA 3KKGA 4ORLA 1OHSA 1CQSA 2HMMB 1Q40B 3GZXB 1JJ22 2BNGA 2RNTA 4H3UA 3BU4A 1DYUA 1LVNA 1W6GA 1B27A 3FZWA 2F56A 3JUNA 3LJCA 1QVF2 3PS8A 1GOUA 3NBBA 1ZX2A 3DM8A 1X1WA 3UL6A 1BRSA 1TP6A 4WFOA 4K61A 4IIAA 1AY7A 1W2B2 3G6E3 1WXWA 1OGXA 4BL2A 1UI8A 3I563 3HOHA 5CLKA 2C10A 3HI7A 1A90A 4HM2B 1UOYA 2Z0TA 3M6UA 2FGTA 3NXJA 4H61A 4HM8B 3RNTA 1JB2A 1R4CA 1V57A 2CWTA 2MF7A 1LNIA 1LNHA 1MGRA 2XR8B 4R80A 1JBRA 1D6YA 2CK3H 2IMJA 4GSPA 3ZG5A 2AS0A 2XFTA 1Q824 1ROAA 2B24B 2PNCA 5TGNA 9RNTA 5ELJA 1UCKA 4J9AA 1HYFA 1ULJB 4O2HA 4R9KA 3MWZA 5JBSA 1OF5A 3SVAA 2OOVC 4OVMA 3EB8A 1BRKA 1N5HA 5AI1A 4BL3A 2OTJ3 3SYUA 1G0TA 2CKFB 3LTAA 3KFQC 1BAOA 3NBJA 3PGBA 1BVIA 1YJ93 3O8YA 1TU5A 1O7WB 2MC8A 4PEJA 3D79A 5EVHA 3CCV3 6STDA 1CYUA 1RGFA 3OWYA 1EKMA 2SARA 3AHWA 2Y73A 3MYTA 4OUQA 4RZMA 3UB1A 1VQO3 3FF2A 3G0KA 1M9GA 3PZWA 1FUWA 1BSBA 4N6OB 5G1LA 3U28A 1QALA 3LWQA 3WODG 4HM7B 4L8PA 3CCR3 2UX0A 3LTCA 2WOFA 5D83A 1RGGA 1HZ1A 1KSIA 2C11A 5IW9A 1B2SA 2RBIA 4LYLB 4KVHA 1HU9A 3I0YA 2P0XA 3B8LA 3SLUA 1JZDA 3GZYB 4LEHA 3EHCA 4N6NB 4J5KA 1OF5B 1OACA 1KWIA 1TFOA 5LC6A 2XGNA 4DKIA 1W5ZA 3S5CA 4FCJA 3K0ZA 3EJVA 1Q9EA 1RRLA 2OQEA 1G96A 3FKAA 4K1VA 3D4AA 2OQEC 1N5PA 2CIUA 1K41A 3DGLA 2W04A 5D82A 1AQZA 3ALAA 5BXQA 2Z76A 1VQ43 1LOXA 4MMXB 3CCS3 1M1K4 4BIRA 2BMQB 1QAFA 2GSPA 1I8VA 2H0GA 4FMCA 1B2XA 1N9JA 3ECFA 3LWOA 5IG0A 4KFEA 4JF8A
chains in the Genus database with same CATH topology
2FNQA 3CCU3 1NJI4 4R9LA 3X42A 1Y4KA 1DMNA 2R4IA 4LMIA 1GS3A 3NX0A 3OWSA 4AKZA 3LTBA 2RCDA 1IVXA 3LH4A 1CEWI 1OGZA 3BB9A 3L0RA 3EE1A 1TFKA 1YVBI 1ASKA 2WOHA 4EXRA 3GRDA 3S28A 2K0MA 3LTDA 1YJN3 1Q7Y4 1KQS2 4HZBB 2E2VA 2OOVA 5I97A 4FCMA 3EBYA 2BMRB 1JB4A 1A67A 3GZBA 4N6MA 1ZL3A 4OK0A 3UAIA 1VQ93 2CWWA 4AKYA 1PFPA 1FGTA 3F14A 5CXOA 3Q90A 1SIIA 4HYZA 3NM2A 1D6ZA 2CFWA 1DVCA 2W9QA 4L7KA 1ISKA 3MG3A 5AIFA 3DGOA 3UJMA 3EC9A 3MG2A 2OTL3 3G4S3 2CX0A 3HIGA 3NBRA 3GAXA 1O7PB 1QVG2 3NUVA 3FLJA 3SXXA 3MHEA 2P0MA 2Y74A 1YIJ3 2RFRA 4J8TA 1C7HA 2M7OA 5IG4A 2CHCA 4N6TA 5KP4A 3DXOA 2OQEA 3CPOA 2O3OA 1GY5A 3H3HA 3OWUA 3B4PA 4TX4A 4MMYB 2HMLB 3OXAA 3CCL3 2V1LA 1STDA 1JB5A 5AEUB 1GY6A 5IF6A 1A2KA 3B7CA 2WGQA 1UUWB 3GWRA 3M8CA 4ZM8A 2ZL8A 1IVWA 1W7CA 5KP3A 5IENA 1VQ53 5IEPA 3KSED 3WA3A 1O7MB 2XEPA 3EF8A 3S27A 2FXTA 4L8OA 3UNLA 1NU3A 3EN1B 1N8R4 5AYSC 2KCDA 1WQLB 3CME3 1FGQA 3KSPA 1U8CB 1UW1A 1K734 1IK3A 5EEOA 2AB4A 2F98A 2HMOB 2BMOB 1NWWA 2CG1A 2QEX3 3CC23 4HBRA 3X3XA 1IT7A 3S29A 2CFKA 3CU3A 4XM4A 2W6JH 5HGRA 2JDIH 3QRDA 1K8A4 3RGRA 2Z7AA 1VZZA 3K5TA 1Q864 3MPHA 1IQ8A 4HM0B 4XDWA 2XRXB 1Q814 1US1A 1W00A 3KE7A 4HKVB 1TUHA 1J2BA 3F7SA 2W0QA 1A2VA 2KRTA 1WMPA 2J5VA 3WMDA 1MNLA 3KN4A 2GBXB 4O02B 1WXXA 4WYKB 1SPUA 4IPBA 1IDPA 3N9HA 2WO0A 1OPYA 3HK4A 2INXA 3Q1CA 5AIHA 2BHMA 3DZLA 3T8NA 2ML6A 1DMQA 3T0UA 1DVDA 4LSOA 1RKYA 5IG3A 4MJDA 3SOYA 1YI23 3G8ZA 3KZTA 4FMDA 1RJOA 1AVKA 3X3ZA 3VF1A 1ZE1A 2KXGA 5A0OB 4K1UA 5G2GA 2F86B 3N54B 4R1KA 2IUJA 2BT3A 1W02A 1VQL3 1UUVB 1VQ73 3DGMA 3RDEA 3I553 1SIHA 3CCJ3 1R3FA 2B1XB 2W03A 2QIYA 3J7Yd 4NREA 2XSHB 4BTXA 2XFSA 4X2HA 4EV2A 4LZIA 4XB5A 1YHQ3 4EYCA 1HKXA 3VSEA 2YX9A 3PYJA 3G713 3CPW2 4RBNA 3K9MC 1OH0A 1T5YA 3NM7A 4G1MB 1YGEA 2W56A 1VQ63 5CF2A 2ML5A 1BUQA 3SEDA 4I4KA 2B78A 3WOFB 1L5GB 3GZRA 1IQYA 1E97A 3HIIA 1DMMA 1S723 5STDA 1WNHA 3VGNA 2P09A 4WWUC 3IJEB 3PCRA 3EBTA 4HZ9B 3ROBA 3CC73 3WDGB 3BNCA 4RNZA 5JPPA 3IPTA 4HM5B 1JN5A 2I9WA 5EQLA 3X41A 4KFDA 6STDA 3AMOB 3IMAB 1GD4A 3K63A 2XSOB 2LQVA 4N6V0 1W6CA 1QMAA 4CCVA 1RN7A 2HMJB 2YFJB 2A15A 4N6UA 1NDOB 2W56B 2XGLA 1O7HB 1KD14 3T8UA 2GU3A 1GY7A 4N6LA 2P38A 5BVBA 1VQP3 2Q07A 5AIGA 1YJW3 3H51A 3X3YA 3V98A 3NQZA 3LDFA 4XBXA 1AVLA 4HM6B 3LMLA 3F8HA 3STDA 4O8SA 2CX1A 2GEYA 3KIIA 3MSOA 3VSYA 1VQK3 4XBYA 1STFI 2LYXA 1ZE2A 1O7NB 4BTWA 3EQQB 3CCM3 2P05A 2CW9A 2HMKB 1UI7A 4FMAA 5IEOA 4STDA 1M904 1LXEA 2GBWB 2YFIB 4XBTA 5D81A 1WMOA 4FCZA 2W9PA 1O7GB 1JN5B 1GD3A 3FF0A 3BNDA 1JNQA 1F8NA 3EN8A 3CC43 1OUNA 4WYKA 1VQN3 2YFLB 1FA3A 5AYRB 1K8WA 4MEIA 3N8BA 3BLZA 1TIJA 4QWTA 3RGAA 3JUOA 3LOYA 1ZS7A 1RRHA 4BTYA 2GEXA 4FR9A 4HM4B 3HX8A 3CXC2 2JQ5A 4R4KA 4WP5A 7STDA 2J5TA 2O9UX 3FH1A 1OCVA 3OW22 1R3EA 4K90B 3U1WA 1OHPA 3DUKA 1FGRA 3LT9A 1S5AA 4FMBA 3LYGA 3F9SA 1Q7HA 1IT8A 4X2OA 3LT8A 1FGMA 1K9M4 3CNXA 3NV0A 2WGOA 2CG0A 4Q53A 1IQXA 2IUKA 2CFLA 1SQWA 4WHAA 2ZDJA 2Z77A 4U13A 4NHFA 3DY5A 3U97A 2SBLA 2E2TA 1JKGA 4EBGA 5ELUA 5CK6A 2OCTA 2L4VA 5FW5A 1EG9B 4IT7A 2CFDA 3FG1A 1IV9A 2GXFA 4Q1TA 4JRFA 3WOEB 1EA2A 4GL6A 4EV5A 2CWUA 3EX9A 4LGQA 5AIIA 1M1XB 1NO3A 4KZ1A 5DREA 3HZPA 1IVVA 4DMGA 1W4NA 3MKIA 2CC3A 3C0KA 4N3VA 3CCQ3 3NV0B 3FG4A 3K7CA 4XDVA 5KP1A 3MG1A 3S67A 3TDGA 3PCSA 3F7XA 3FGYA 5LC7A 1JKGB 3JVCA 3AMOA 2CFGA 4MMZB 3LZAA 3CMA3 1YIT3 5IG5A 2GU1A 3JUMA 1VQM3 1Z1SA 1E3RA 2F99A 1E3VA 3FSDA 3Q2PA 1W6YA 2RSXA 3CD63 1W2ZA 3NHXA 2CH9A 3CNMA 4O3VA 1SGVA 4KFFA 5IERA 3D9RA 4HM1B 3NQYA 3E99A 1AR0A 2IA7A 3FG3A 3QK9A 1QJGA 2K54A 2Z6BA 3BNBA 3DGNA 3F40A 3X40A 1W01A 2QA43 1EQKA 3SX1A 2E2UA 3FCSB 5AEWB 4HVNA 1ROVA 1ZO2A 3V92A 3B4OA 3OV4A 1KC84 3JUQA 5FGOA 2HMNB 1D6UA 1Q40A 3DMCA 1AV4A 4HJLB 1NB3I 2STDA 3SOAA 2BO9B 1WMNA 1OHOA 3OX9A 3BNEA 1N9EA 3ER7A 1K28A 4AEQA 3F8XA 8CHOA 2W2CA 4GB5A 1U5OA 5DRVA 1V74A 1QAKA 2QGUA 1SJWA 1VQ83 3V99A 1IV7A 2XH9A 4CDLA 5CF1A 2CWVA 2D42A 2D1WA 3CCE3 1NB5I 1IU7A 1MOLA 1Q42A 2XF3A 4HM3B 4EC6A 2PZVA 3JUPA 1N8QA 1GYBA 1ULIB 2OWPA 3WA2X 2RGQA 1JV2B 3G16A 3A76A 3LXUX 1JRQA 3PXMA 5JPUA 1IVUA 1CYVA 1WTHA 3D3LA 1FGOA 1PU4A 3UL5A 4RNYA 3KKGA 4ORLA 1OHSA 1CQSA 2HMMB 1Q40B 3GZXB 1JJ22 2BNGA 4H3UA 1DYUA 1LVNA 1W6GA 3FZWA 3JUNA 1QVF2 3PS8A 3NBBA 1ZX2A 3DM8A 3UL6A 1TP6A 4WFOA 4K61A 4IIAA 1W2B2 3G6E3 1WXWA 1OGXA 1UI8A 3I563 5CLKA 2C10A 3HI7A 1A90A 4HM2B 3NXJA 4HM8B 2FGTA 4H61A 1JB2A 1R4CA 2CWTA 2MF7A 1LNHA 2XR8B 4R80A 1D6YA 2CK3H 2IMJA 2AS0A 2XFTA 1Q824 1ROAA 2B24B 2PNCA 5TGNA 5ELJA 4J9AA 1ULJB 4R9KA 4O2HA 5JBSA 3MWZA 1OF5A 3SVAA 2OOVC 4OVMA 3EB8A 1N5HA 5AI1A 2OTJ3 2CKFB 3LTAA 3KFQC 3NBJA 3PGBA 1YJ93 3O8YA 1TU5A 1O7WB 2MC8A 4PEJA 3D79A 5EVHA 3CCV3 1CYUA 3OWYA 1EKMA 3MYTA 4OUQA 2Y73A 3UB1A 1VQO3 4RZMA 3FF2A 3G0KA 1M9GA 3PZWA 1FUWA 4N6OB 1QALA 3WODG 4HM7B 4L8PA 3CCR3 2UX0A 3LTCA 2WOFA 5D83A 5IW9A 1KSIA 2C11A 4KVHA 1HU9A 3I0YA 2P0XA 3B8LA 3SLUA 3GZYB 4LEHA 3EHCA 4N6NB 1OF5B 1OACA 1KWIA 1TFOA 5LC6A 2XGNA 1W5ZA 3S5CA 4FCJA 3K0ZA 3EJVA 1RRLA 1G96A 3FKAA 4K1VA 2OQEC 1N5PA 2CIUA 1K41A 3DGLA 2W04A 5D82A 3ALAA 5BXQA 2Z76A 1VQ43 1LOXA 4MMXB 3CCS3 1M1K4 2BMQB 1QAFA 4FMCA 1N9JA 3ECFA 5IG0A 4KFEA 4JF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B78 A;  1WXX A;  1K8W A;  4DMG A;  2P38 A;  2Q07 A;  1SQW A;  3C0K A;  1IT7 A;  3LDF A;  1ZS7 A;  3D79 A;  1WXW A;  1R3F A;  2CX1 A;  2CX0 A;  1ZE2 A;  1IQ8 A;  2J5T A;  1R3E A;  3VSE A;  1J2B A;  1ZL3 A;  3UAI A;  1T5Y A;  1ZE1 A;  2AS0 A;  4Q1T A;  2J5V A;  2CWW A;  1Q7H A;  1SGV A;  1IT8 A;  2AB4 A; 
#chains in the Genus database with same CATH topology
 1GOY A;  1A2P A;  2FNQ A;  1BRH A;  1RMS A;  4R9L A;  3CCU 3;  1NJI 4;  3X42 A;  1Y4K A;  1DMN A;  3MQK A;  2R4I A;  4LMI A;  5RNT A;  1GS3 A;  3NX0 A;  3OWS A;  4J5G A;  4AKZ A;  3LTB A;  2RCD A;  1IVX A;  3LH4 A;  1CEW I;  1OGZ A;  3BB9 A;  3L0R A;  3EE1 A;  1TFK A;  1YVB I;  1ASK A;  2WOH A;  2KF6 A;  3GRD A;  3S28 A;  2K0M A;  3LTD A;  2KKU A;  4EXR A;  1YJN 3;  1Q7Y 4;  1KQS 2;  4HZB B;  2E2V A;  2OOV A;  1UCI A;  4BU4 A;  5I97 A;  4FCM A;  1TRP A;  3EBY A;  2BMR B;  1JB4 A;  1A67 A;  1DET A;  1B3S A;  3GZB A;  4N6M A;  1ZL3 A;  2F5W A;  4OK0 A;  3UAI A;  1VQ9 3;  2CWW A;  4AKY A;  3M6X A;  1PFP A;  1FGT A;  3F14 A;  1RCL A;  5CXO A;  3Q90 A;  1SII A;  4HAA A;  4HYZ A;  3NM2 A;  1D6Z A;  2CFW A;  1DVC A;  3GSP A;  4CI1 B;  2W9Q A;  4L7K A;  1B2U A;  1ISK A;  3MG3 A;  1XNE A;  3DGO A;  2E5O A;  3EC9 A;  3MG2 A;  5AIF A;  3UJM A;  2OTL 3;  3G4S 3;  2CX0 A;  3HIG A;  3NBR A;  3GAX A;  1O7P B;  1QVG 2;  1EUI C;  1RGC A;  3NUV A;  3FLJ A;  3SXX A;  3MHE A;  2P0M A;  2Y74 A;  1YIJ 3;  1I3F A;  2RFR A;  4KT3 B;  2HOH A;  5M1A A;  4J8T A;  1C7H A;  2M7O A;  5IG4 A;  2CHC A;  4N6T A;  5KP4 A;  1RSN A;  1FUS A;  1LOW A;  3DXO A;  3CPO A;  2O3O A;  1GY5 A;  3H3H A;  3OWU A;  3B4P A;  4I5Q A;  4MMY B;  4TX4 A;  2HML B;  3OXA A;  2KF5 A;  3CCL 3;  3HAX A;  1GOV A;  2V1L A;  1STD A;  1JB5 A;  5AEU B;  1GY6 A;  5IF6 A;  1A2K A;  3B7C A;  2WGQ A;  1UUW B;  3GWR A;  3M8C A;  4ZM8 A;  1LQM B;  2ZL8 A;  1IVW A;  1W7C A;  1RN4 A;  5KP3 A;  5IEN A;  2KAA A;  2DP9 A;  5G1K A;  5IEP A;  3LWR A;  1VQ5 3;  3KSE D;  3WA3 A;  1O7M B;  2XEP A;  3EF8 A;  3S27 A;  2FXT A;  4L8O A;  3UNL A;  1NU3 A;  3EN1 B;  1N8R 4;  5AYS C;  2KCD A;  4CI2 B;  1WQL B;  3X41 A;  1BSA A;  3IUW A;  3CME 3;  1FGQ A;  3KSP A;  1U8C B;  1UW1 A;  1K73 4;  3M65 A;  1BRG A;  2AB4 A;  2F98 A;  2HMO B;  2BMO B;  5EEO A;  1V58 A;  1IK3 A;  1NWW A;  3AGO A;  2CG1 A;  2KF4 A;  2QEX 3;  3CC2 3;  4HBR A;  3X3X A;  1BNJ A;  1IT7 A;  4ILF A;  3S29 A;  2CFK A;  2K3D A;  3CU3 A;  4XM4 A;  2KF3 A;  2W6J H;  5HGR A;  2JDI H;  3QRD A;  1K8A 4;  3DH2 A;  3RGR A;  2Z7A A;  1VZZ A;  3K5T A;  2L1S A;  3MPH A;  1IQ8 A;  1Q86 4;  4TZ4 C;  1GSP A;  4HM0 B;  4XDW A;  2XRX B;  1Q81 4;  1US1 A;  1PY3 A;  1W00 A;  3ZV0 C;  2AUS A;  3KE7 A;  4HKV B;  1UDI I;  1TUH A;  1J2B A;  3F7S A;  2W0Q A;  2H0H A;  1A2V A;  2KRT A;  2ZHX B;  1WMP A;  2J5V A;  1BGS A;  1MNL A;  3M6V A;  1BSE A;  3WMD A;  3KCH A;  1C54 A;  3KN4 A;  2GBX B;  2BU4 A;  7STD A;  4O02 B;  1NNV A;  1WXX A;  4WYK B;  1SPU A;  4IPB A;  1IDP A;  3N9H A;  1T2H A;  2HVY A;  1FW7 A;  1UCL A;  2WO0 A;  1BNI A;  1OPY A;  3HK4 A;  2INX A;  3Q1C A;  5AIH A;  2BHM A;  3DZL A;  1BNE A;  1GMP A;  3T8N A;  2ML6 A;  1DMQ A;  3T0U A;  7RNT A;  2RFK A;  1DVD A;  4LSO A;  1RKY A;  1BSC A;  5IG3 A;  4MJD A;  4HOH A;  3SOY A;  1YI2 3;  3G8Z A;  1BNS A;  3KZT A;  3ZG0 A;  4FMD A;  1RJO A;  1AVK A;  3X3Z A;  1UCJ A;  3VF1 A;  4CJN A;  1ZE1 A;  2KXG A;  5A0O B;  4K1U A;  5G2G A;  2F86 B;  3N54 B;  4R1K A;  2IUJ A;  2BT3 A;  2UGI A;  1RGA A;  1W02 A;  1EEJ A;  1VQL 3;  2F4Y A;  1LOY A;  1UUV B;  1VQ7 3;  3A5E A;  3DGM A;  2ZA4 A;  1TTO A;  1LOV A;  2APO A;  1I0X A;  3RDE A;  3I55 3;  1SIH A;  3CCJ 3;  1R3F A;  2B1X B;  2W03 A;  3WR2 A;  2IY2 A;  2QIY A;  1RLS A;  3J7Y d;  1B21 A;  4NRE A;  2XSH B;  4BTX A;  2XFS A;  4X2H A;  4EV2 A;  4LZI A;  4XB5 A;  1YHQ 3;  4EYC A;  1HKX A;  1RGE A;  3VSE A;  1BOX A;  1VQQ A;  2YX9 A;  3PYJ A;  3G71 3;  4RBN A;  5BIR A;  3K9M C;  1OH0 A;  1T5Y A;  3CPW 2;  3NM7 A;  4G1M B;  1YGE A;  2W56 A;  1VQ6 3;  5CF2 A;  2ML5 A;  1BUQ A;  1I2F A;  3SED A;  4I4K A;  1MWU A;  2B78 A;  3WOF B;  1L5G B;  3GZR A;  1IQY A;  1JBS A;  1R4Y A;  4GHO A;  1E97 A;  3HII A;  1TJD A;  1DMM A;  1S72 3;  1MWT A;  5STD A;  1WNH A;  1RGH A;  3VGN A;  2P09 A;  1TE7 A;  3M4X A;  4WWU C;  3IJE B;  3PCR A;  3EBT A;  4HZ9 B;  1I70 A;  6RNT A;  1FYS A;  3ROB A;  3CC7 3;  1T2I A;  3WDG B;  1BSD A;  3BNC A;  4RNZ A;  5JPP A;  3IPT A;  1SAR A;  1JN5 A;  2I9W A;  4HM5 B;  4NPB A;  4KFD A;  5EQL A;  1CH0 A;  3AGN A;  3AMO B;  3IMA B;  1GD4 A;  3ZFZ A;  3K63 A;  2XSO B;  2LQV A;  1T3B A;  4N6V 0;  1S04 A;  1W6C A;  1QMA A;  4CCV A;  1RN7 A;  1B2Z A;  2HMJ B;  2IYJ A;  2YFJ B;  2A15 A;  3LWP A;  4N6U A;  1NDO B;  2W56 B;  2XGL A;  1O7H B;  1KD1 4;  3T8U A;  2GU3 A;  1GY7 A;  4N6L A;  2P38 A;  5BVB A;  1VQP 3;  2Q07 A;  5AIG A;  1YJW 3;  3H51 A;  3X3Y A;  1ZBO A;  3V98 A;  3NQZ A;  3LDF A;  4XBX A;  1AVL A;  1I3I A;  3LML A;  3HJY A;  3F8H A;  4HM6 B;  4O8S A;  3STD A;  2CX1 A;  2GEY A;  3KII A;  3MSO A;  3VSY A;  2BIR A;  1VQK 3;  4XBY A;  1STF I;  2LYX A;  1DE3 A;  1ZE2 A;  1O7N B;  4BTW A;  3EQQ B;  2H0I A;  3CCM 3;  2P05 A;  1MWS A;  2CW9 A;  2HMK B;  1UI7 A;  4FMA A;  1BRJ A;  5IEO A;  4STD A;  1M90 4;  1LXE A;  2GBW B;  2YFI B;  4XBT A;  5D81 A;  1WMO A;  4FCZ A;  1O7G B;  2W9P A;  5M19 A;  1JN5 B;  1GD3 A;  3FF0 A;  3BND A;  6GSP A;  1JNQ A;  1F8N A;  3EN8 A;  3CC4 3;  1OUN A;  4WYK A;  1VQN 3;  2YFL B;  1FA3 A;  5AYR B;  1K8W A;  4MEI A;  1B2M A;  3N8B A;  3BLZ A;  1TIJ A;  4QWT A;  3RGA A;  3JUO A;  3LOY A;  1ZS7 A;  1RRH A;  4BTY A;  2GEX A;  4FR9 A;  4HM4 B;  5M18 A;  1BNR A;  1JBT A;  1LRA A;  1RNT A;  3HX8 A;  3LWV A;  3CXC 2;  2JQ5 A;  3AHS A;  4R4K A;  1RTU A;  4WP5 A;  2J5T A;  4CI3 B;  2O9U X;  2UUG C;  1OCV A;  1UGI A;  1R3E A;  3FH1 A;  3WHO A;  3OW2 2;  4K90 B;  3U1W A;  3D5I A;  1OHP A;  3DUK A;  1G02 A;  1FGR A;  5BU4 A;  3LT9 A;  1S5A A;  4FMB A;  1GMQ A;  3LYG A;  1YNV X;  3F9S A;  1Q7H A;  7GSP A;  1IT8 A;  4X2O A;  1I2E A;  3LT8 A;  1RGL A;  1FGM A;  1K9M 4;  3CNX A;  3NV0 A;  2WGO A;  2CG0 A;  3Q3F A;  1IQX A;  2IUK A;  4Q53 A;  2CFL A;  1SQW A;  4WHA A;  2ZDJ A;  2Z77 A;  4U13 A;  4NHF A;  1B20 A;  3DY5 A;  3U97 A;  2SBL A;  2E2T A;  1JKG A;  1BNF A;  4EBG A;  2F5M A;  5GSP A;  1YGW A;  5ELU A;  1JZO A;  5CK6 A;  2OCT A;  2L4V A;  5FW5 A;  1EG9 B;  1BUJ A;  5HOH A;  4IT7 A;  3DGY A;  2CFD A;  3FG1 A;  1IV9 A;  2GXF A;  4Q1T A;  4JRF A;  3WOE B;  1EA2 A;  4GL6 A;  4EV5 A;  2CWU A;  3D5G A;  3EX9 A;  4LGQ A;  1M1X B;  1PYL A;  5AII A;  1NO3 A;  1BU4 A;  4KZ1 A;  2EY4 A;  5DRE A;  3HZP A;  1IVV A;  4DMG A;  1I0V A;  1W4N A;  3MKI A;  3URP A;  2CC3 A;  3C0K A;  4N3V A;  4RNT A;  4EW5 A;  3CCQ 3;  3NV0 B;  3FG4 A;  3K7C A;  4XDV A;  5KP1 A;  1X1Y A;  3MG1 A;  2AAE A;  1MGW A;  3S67 A;  3TDG A;  3PCS A;  1RGK A;  3F7X A;  3FGY A;  5LC7 A;  2C4B A;  3BIR A;  1JKG B;  3JVC A;  3AMO A;  2CFG A;  4MMZ B;  3LZA A;  1BAN A;  1RHL A;  3CMA 3;  1YIT 3;  5IG5 A;  2GU1 A;  3JUM A;  1VQM 3;  1Z1S A;  1E3R A;  2F99 A;  1E3V A;  3FSD A;  3Q2P A;  1W6Y A;  2RSX A;  1WK2 A;  3CD6 3;  1W2Z A;  3M6W A;  3NHX A;  1RCK A;  2CH9 A;  3CNM A;  4O3V A;  1SGV A;  4KFF A;  5IER A;  3D9R A;  1UUG B;  4HM1 B;  3NQY A;  3E99 A;  1AR0 A;  1BRN L;  2IA7 A;  3FG3 A;  3QK9 A;  1QJG A;  2K54 A;  2Z6B A;  3BNB A;  1X1X A;  3DGN A;  1FZU A;  3F40 A;  3X40 A;  1W01 A;  2QA4 3;  1EQK A;  3SX1 A;  2E2U A;  1ZGX A;  3FCS B;  5AEW B;  4HVN A;  1FUT A;  1ROV A;  1ZO2 A;  3V92 A;  1GMR A;  8RNT A;  3B4O A;  1BIR A;  1I2G A;  1IYY A;  3OV4 A;  1KC8 4;  3JUQ A;  5FGO A;  2HMN B;  1D6U A;  1Q40 A;  3DMC A;  1AV4 A;  4HJL B;  1NB3 I;  2R41 A;  2STD A;  4CPK A;  3SOA A;  2BO9 B;  1WMN A;  1OHO A;  3OX9 A;  3BNE A;  1N9E A;  3ER7 A;  1K28 A;  4AEQ A;  3F8X A;  8CHO A;  2W2C A;  1RDS A;  1U5O A;  4GB5 A;  5DRV A;  1MWR A;  2ANE A;  2FRX A;  1V74 A;  1RN1 A;  1BNG A;  1QAK A;  2QGU A;  1UGH I;  1SJW A;  1VQ8 3;  3V99 A;  1IV7 A;  2XH9 A;  4CDL A;  3HJW A;  1YVS A;  2AAD A;  5CF1 A;  1RNB A;  2CWV A;  2D42 A;  2J8X B;  2D1W A;  1X1U A;  3CCE 3;  1NB5 I;  1IU7 A;  1MOL A;  1Q42 A;  2XF3 A;  4HM3 B;  4EC6 A;  2PZV A;  3JUP A;  1N8Q A;  1GYB A;  1ULI B;  1BRI A;  2OWP A;  3WA2 X;  2RGQ A;  1JV2 B;  3G16 A;  3A76 A;  3LXU X;  1JRQ A;  3PXM A;  5JPU A;  1IVU A;  1CYV A;  1WTH A;  1TRQ A;  3D3L A;  1FGO A;  1PU4 A;  3UL5 A;  1LQG C;  4RNY A;  3KKG A;  4ORL A;  1OHS A;  1CQS A;  2HMM B;  1Q40 B;  3GZX B;  1JJ2 2;  2BNG A;  2RNT A;  4H3U A;  3BU4 A;  1DYU A;  1LVN A;  1W6G A;  1B27 A;  3FZW A;  2F56 A;  3JUN A;  3LJC A;  1QVF 2;  3PS8 A;  1GOU A;  3NBB A;  1ZX2 A;  3DM8 A;  1X1W A;  3UL6 A;  1BRS A;  1TP6 A;  4WFO A;  4K61 A;  4IIA A;  1AY7 A;  1W2B 2;  3G6E 3;  1WXW A;  1OGX A;  4BL2 A;  1UI8 A;  3I56 3;  3HOH A;  5CLK A;  2C10 A;  3HI7 A;  1A90 A;  4HM2 B;  1UOY A;  2Z0T A;  3M6U A;  2FGT A;  3NXJ A;  4H61 A;  4HM8 B;  3RNT A;  1JB2 A;  1R4C A;  1V57 A;  2CWT A;  2MF7 A;  1LNI A;  1LNH A;  1MGR A;  2XR8 B;  4R80 A;  1JBR A;  1D6Y A;  2CK3 H;  2IMJ A;  4GSP A;  3ZG5 A;  2AS0 A;  2XFT A;  1Q82 4;  1ROA A;  2B24 B;  2PNC A;  5TGN A;  9RNT A;  5ELJ A;  1UCK A;  4J9A A;  1HYF A;  1ULJ B;  4O2H A;  4R9K A;  3MWZ A;  5JBS A;  1OF5 A;  3SVA A;  2OOV C;  4OVM A;  3EB8 A;  1BRK A;  1N5H A;  5AI1 A;  4BL3 A;  2OTJ 3;  3SYU A;  1G0T A;  2CKF B;  3LTA A;  3KFQ C;  1BAO A;  3NBJ A;  3PGB A;  1BVI A;  1YJ9 3;  3O8Y A;  1TU5 A;  1O7W B;  2MC8 A;  4PEJ A;  3D79 A;  5EVH A;  3CCV 3;  6STD A;  1CYU A;  1RGF A;  3OWY A;  1EKM A;  2SAR A;  3AHW A;  2Y73 A;  3MYT A;  4OUQ A;  4RZM A;  3UB1 A;  1VQO 3;  3FF2 A;  3G0K A;  1M9G A;  3PZW A;  1FUW A;  1BSB A;  4N6O B;  5G1L A;  3U28 A;  1QAL A;  3LWQ A;  3WOD G;  4HM7 B;  4L8P A;  3CCR 3;  2UX0 A;  3LTC A;  2WOF A;  5D83 A;  1RGG A;  1HZ1 A;  1KSI A;  2C11 A;  5IW9 A;  1B2S A;  2RBI A;  4LYL B;  4KVH A;  1HU9 A;  3I0Y A;  2P0X A;  3B8L A;  3SLU A;  1JZD A;  3GZY B;  4LEH A;  3EHC A;  4N6N B;  4J5K A;  1OF5 B;  1OAC A;  1KWI A;  1TFO A;  5LC6 A;  2XGN A;  4DKI A;  1W5Z A;  3S5C A;  4FCJ A;  3K0Z A;  3EJV A;  1Q9E A;  1RRL A;  2OQE A;  1G96 A;  3FKA A;  4K1V A;  3D4A A;  2OQE C;  1N5P A;  2CIU A;  1K41 A;  3DGL A;  2W04 A;  5D82 A;  1AQZ A;  3ALA A;  5BXQ A;  2Z76 A;  1VQ4 3;  1LOX A;  4MMX B;  3CCS 3;  1M1K 4;  4BIR A;  2BMQ B;  1QAF A;  2GSP A;  1I8V A;  2H0G A;  4FMC A;  1B2X A;  1N9J A;  3ECF A;  3LWO A;  5IG0 A;  4KFE A;  4JF8 A; 
#chains in the Genus database with same CATH homology
 2FNQ A;  3CCU 3;  1NJI 4;  4R9L A;  3X42 A;  1Y4K A;  1DMN A;  2R4I A;  4LMI A;  1GS3 A;  3NX0 A;  3OWS A;  4AKZ A;  3LTB A;  2RCD A;  1IVX A;  3LH4 A;  1CEW I;  1OGZ A;  3BB9 A;  3L0R A;  3EE1 A;  1TFK A;  1YVB I;  1ASK A;  2WOH A;  4EXR A;  3GRD A;  3S28 A;  2K0M A;  3LTD A;  1YJN 3;  1Q7Y 4;  1KQS 2;  4HZB B;  2E2V A;  2OOV A;  5I97 A;  4FCM A;  3EBY A;  2BMR B;  1JB4 A;  1A67 A;  3GZB A;  4N6M A;  1ZL3 A;  4OK0 A;  3UAI A;  1VQ9 3;  2CWW A;  4AKY A;  1PFP A;  1FGT A;  3F14 A;  5CXO A;  3Q90 A;  1SII A;  4HYZ A;  3NM2 A;  1D6Z A;  2CFW A;  1DVC A;  2W9Q A;  4L7K A;  1ISK A;  3MG3 A;  5AIF A;  3DGO A;  3UJM A;  3EC9 A;  3MG2 A;  2OTL 3;  3G4S 3;  2CX0 A;  3HIG A;  3NBR A;  3GAX A;  1O7P B;  1QVG 2;  3NUV A;  3FLJ A;  3SXX A;  3MHE A;  2P0M A;  2Y74 A;  1YIJ 3;  2RFR A;  4J8T A;  1C7H A;  2M7O A;  5IG4 A;  2CHC A;  4N6T A;  5KP4 A;  3DXO A;  2OQE A;  3CPO A;  2O3O A;  1GY5 A;  3H3H A;  3OWU A;  3B4P A;  4TX4 A;  4MMY B;  2HML B;  3OXA A;  3CCL 3;  2V1L A;  1STD A;  1JB5 A;  5AEU B;  1GY6 A;  5IF6 A;  1A2K A;  3B7C A;  2WGQ A;  1UUW B;  3GWR A;  3M8C A;  4ZM8 A;  2ZL8 A;  1IVW A;  1W7C A;  5KP3 A;  5IEN A;  1VQ5 3;  5IEP A;  3KSE D;  3WA3 A;  1O7M B;  2XEP A;  3EF8 A;  3S27 A;  2FXT A;  4L8O A;  3UNL A;  1NU3 A;  3EN1 B;  1N8R 4;  5AYS C;  2KCD A;  1WQL B;  3CME 3;  1FGQ A;  3KSP A;  1U8C B;  1UW1 A;  1K73 4;  1IK3 A;  5EEO A;  2AB4 A;  2F98 A;  2HMO B;  2BMO B;  1NWW A;  2CG1 A;  2QEX 3;  3CC2 3;  4HBR A;  3X3X A;  1IT7 A;  3S29 A;  2CFK A;  3CU3 A;  4XM4 A;  2W6J H;  5HGR A;  2JDI H;  3QRD A;  1K8A 4;  3RGR A;  2Z7A A;  1VZZ A;  3K5T A;  1Q86 4;  3MPH A;  1IQ8 A;  4HM0 B;  4XDW A;  2XRX B;  1Q81 4;  1US1 A;  1W00 A;  3KE7 A;  4HKV B;  1TUH A;  1J2B A;  3F7S A;  2W0Q A;  1A2V A;  2KRT A;  1WMP A;  2J5V A;  3WMD A;  1MNL A;  3KN4 A;  2GBX B;  4O02 B;  1WXX A;  4WYK B;  1SPU A;  4IPB A;  1IDP A;  3N9H A;  2WO0 A;  1OPY A;  3HK4 A;  2INX A;  3Q1C A;  5AIH A;  2BHM A;  3DZL A;  3T8N A;  2ML6 A;  1DMQ A;  3T0U A;  1DVD A;  4LSO A;  1RKY A;  5IG3 A;  4MJD A;  3SOY A;  1YI2 3;  3G8Z A;  3KZT A;  4FMD A;  1RJO A;  1AVK A;  3X3Z A;  3VF1 A;  1ZE1 A;  2KXG A;  5A0O B;  4K1U A;  5G2G A;  2F86 B;  3N54 B;  4R1K A;  2IUJ A;  2BT3 A;  1W02 A;  1VQL 3;  1UUV B;  1VQ7 3;  3DGM A;  3RDE A;  3I55 3;  1SIH A;  3CCJ 3;  1R3F A;  2B1X B;  2W03 A;  2QIY A;  3J7Y d;  4NRE A;  2XSH B;  4BTX A;  2XFS A;  4X2H A;  4EV2 A;  4LZI A;  4XB5 A;  1YHQ 3;  4EYC A;  1HKX A;  3VSE A;  2YX9 A;  3PYJ A;  3G71 3;  3CPW 2;  4RBN A;  3K9M C;  1OH0 A;  1T5Y A;  3NM7 A;  4G1M B;  1YGE A;  2W56 A;  1VQ6 3;  5CF2 A;  2ML5 A;  1BUQ A;  3SED A;  4I4K A;  2B78 A;  3WOF B;  1L5G B;  3GZR A;  1IQY A;  1E97 A;  3HII A;  1DMM A;  1S72 3;  5STD A;  1WNH A;  3VGN A;  2P09 A;  4WWU C;  3IJE B;  3PCR A;  3EBT A;  4HZ9 B;  3ROB A;  3CC7 3;  3WDG B;  3BNC A;  4RNZ A;  5JPP A;  3IPT A;  4HM5 B;  1JN5 A;  2I9W A;  5EQL A;  3X41 A;  4KFD A;  6STD A;  3AMO B;  3IMA B;  1GD4 A;  3K63 A;  2XSO B;  2LQV A;  4N6V 0;  1W6C A;  1QMA A;  4CCV A;  1RN7 A;  2HMJ B;  2YFJ B;  2A15 A;  4N6U A;  1NDO B;  2W56 B;  2XGL A;  1O7H B;  1KD1 4;  3T8U A;  2GU3 A;  1GY7 A;  4N6L A;  2P38 A;  5BVB A;  1VQP 3;  2Q07 A;  5AIG A;  1YJW 3;  3H51 A;  3X3Y A;  3V98 A;  3NQZ A;  3LDF A;  4XBX A;  1AVL A;  4HM6 B;  3LML A;  3F8H A;  3STD A;  4O8S A;  2CX1 A;  2GEY A;  3KII A;  3MSO A;  3VSY A;  1VQK 3;  4XBY A;  1STF I;  2LYX A;  1ZE2 A;  1O7N B;  4BTW A;  3EQQ B;  3CCM 3;  2P05 A;  2CW9 A;  2HMK B;  1UI7 A;  4FMA A;  5IEO A;  4STD A;  1M90 4;  1LXE A;  2GBW B;  2YFI B;  4XBT A;  5D81 A;  1WMO A;  4FCZ A;  2W9P A;  1O7G B;  1JN5 B;  1GD3 A;  3FF0 A;  3BND A;  1JNQ A;  1F8N A;  3EN8 A;  3CC4 3;  1OUN A;  4WYK A;  1VQN 3;  2YFL B;  1FA3 A;  5AYR B;  1K8W A;  4MEI A;  3N8B A;  3BLZ A;  1TIJ A;  4QWT A;  3RGA A;  3JUO A;  3LOY A;  1ZS7 A;  1RRH A;  4BTY A;  2GEX A;  4FR9 A;  4HM4 B;  3HX8 A;  3CXC 2;  2JQ5 A;  4R4K A;  4WP5 A;  7STD A;  2J5T A;  2O9U X;  3FH1 A;  1OCV A;  3OW2 2;  1R3E A;  4K90 B;  3U1W A;  1OHP A;  3DUK A;  1FGR A;  3LT9 A;  1S5A A;  4FMB A;  3LYG A;  3F9S A;  1Q7H A;  1IT8 A;  4X2O A;  3LT8 A;  1FGM A;  1K9M 4;  3CNX A;  3NV0 A;  2WGO A;  2CG0 A;  4Q53 A;  1IQX A;  2IUK A;  2CFL A;  1SQW A;  4WHA A;  2ZDJ A;  2Z77 A;  4U13 A;  4NHF A;  3DY5 A;  3U97 A;  2SBL A;  2E2T A;  1JKG A;  4EBG A;  5ELU A;  5CK6 A;  2OCT A;  2L4V A;  5FW5 A;  1EG9 B;  4IT7 A;  2CFD A;  3FG1 A;  1IV9 A;  2GXF A;  4Q1T A;  4JRF A;  3WOE B;  1EA2 A;  4GL6 A;  4EV5 A;  2CWU A;  3EX9 A;  4LGQ A;  5AII A;  1M1X B;  1NO3 A;  4KZ1 A;  5DRE A;  3HZP A;  1IVV A;  4DMG A;  1W4N A;  3MKI A;  2CC3 A;  3C0K A;  4N3V A;  3CCQ 3;  3NV0 B;  3FG4 A;  3K7C A;  4XDV A;  5KP1 A;  3MG1 A;  3S67 A;  3TDG A;  3PCS A;  3F7X A;  3FGY A;  5LC7 A;  1JKG B;  3JVC A;  3AMO A;  2CFG A;  4MMZ B;  3LZA A;  3CMA 3;  1YIT 3;  5IG5 A;  2GU1 A;  3JUM A;  1VQM 3;  1Z1S A;  1E3R A;  2F99 A;  1E3V A;  3FSD A;  3Q2P A;  1W6Y A;  2RSX A;  3CD6 3;  1W2Z A;  3NHX A;  2CH9 A;  3CNM A;  4O3V A;  1SGV A;  4KFF A;  5IER A;  3D9R A;  4HM1 B;  3NQY A;  3E99 A;  1AR0 A;  2IA7 A;  3FG3 A;  3QK9 A;  1QJG A;  2K54 A;  2Z6B A;  3BNB A;  3DGN A;  3F40 A;  3X40 A;  1W01 A;  2QA4 3;  1EQK A;  3SX1 A;  2E2U A;  3FCS B;  5AEW B;  4HVN A;  1ROV A;  1ZO2 A;  3V92 A;  3B4O A;  3OV4 A;  1KC8 4;  3JUQ A;  5FGO A;  2HMN B;  1D6U A;  1Q40 A;  3DMC A;  1AV4 A;  4HJL B;  1NB3 I;  2STD A;  3SOA A;  2BO9 B;  1WMN A;  1OHO A;  3OX9 A;  3BNE A;  1N9E A;  3ER7 A;  1K28 A;  4AEQ A;  3F8X A;  8CHO A;  2W2C A;  4GB5 A;  1U5O A;  5DRV A;  1V74 A;  1QAK A;  2QGU A;  1SJW A;  1VQ8 3;  3V99 A;  1IV7 A;  2XH9 A;  4CDL A;  5CF1 A;  2CWV A;  2D42 A;  2D1W A;  3CCE 3;  1NB5 I;  1IU7 A;  1MOL A;  1Q42 A;  2XF3 A;  4HM3 B;  4EC6 A;  2PZV A;  3JUP A;  1N8Q A;  1GYB A;  1ULI B;  2OWP A;  3WA2 X;  2RGQ A;  1JV2 B;  3G16 A;  3A76 A;  3LXU X;  1JRQ A;  3PXM A;  5JPU A;  1IVU A;  1CYV A;  1WTH A;  3D3L A;  1FGO A;  1PU4 A;  3UL5 A;  4RNY A;  3KKG A;  4ORL A;  1OHS A;  1CQS A;  2HMM B;  1Q40 B;  3GZX B;  1JJ2 2;  2BNG A;  4H3U A;  1DYU A;  1LVN A;  1W6G A;  3FZW A;  3JUN A;  1QVF 2;  3PS8 A;  3NBB A;  1ZX2 A;  3DM8 A;  3UL6 A;  1TP6 A;  4WFO A;  4K61 A;  4IIA A;  1W2B 2;  3G6E 3;  1WXW A;  1OGX A;  1UI8 A;  3I56 3;  5CLK A;  2C10 A;  3HI7 A;  1A90 A;  4HM2 B;  3NXJ A;  4HM8 B;  2FGT A;  4H61 A;  1JB2 A;  1R4C A;  2CWT A;  2MF7 A;  1LNH A;  2XR8 B;  4R80 A;  1D6Y A;  2CK3 H;  2IMJ A;  2AS0 A;  2XFT A;  1Q82 4;  1ROA A;  2B24 B;  2PNC A;  5TGN A;  5ELJ A;  4J9A A;  1ULJ B;  4R9K A;  4O2H A;  5JBS A;  3MWZ A;  1OF5 A;  3SVA A;  2OOV C;  4OVM A;  3EB8 A;  1N5H A;  5AI1 A;  2OTJ 3;  2CKF B;  3LTA A;  3KFQ C;  3NBJ A;  3PGB A;  1YJ9 3;  3O8Y A;  1TU5 A;  1O7W B;  2MC8 A;  4PEJ A;  3D79 A;  5EVH A;  3CCV 3;  1CYU A;  3OWY A;  1EKM A;  3MYT A;  4OUQ A;  2Y73 A;  3UB1 A;  1VQO 3;  4RZM A;  3FF2 A;  3G0K A;  1M9G A;  3PZW A;  1FUW A;  4N6O B;  1QAL A;  3WOD G;  4HM7 B;  4L8P A;  3CCR 3;  2UX0 A;  3LTC A;  2WOF A;  5D83 A;  5IW9 A;  1KSI A;  2C11 A;  4KVH A;  1HU9 A;  3I0Y A;  2P0X A;  3B8L A;  3SLU A;  3GZY B;  4LEH A;  3EHC A;  4N6N B;  1OF5 B;  1OAC A;  1KWI A;  1TFO A;  5LC6 A;  2XGN A;  1W5Z A;  3S5C A;  4FCJ A;  3K0Z A;  3EJV A;  1RRL A;  1G96 A;  3FKA A;  4K1V A;  2OQE C;  1N5P A;  2CIU A;  1K41 A;  3DGL A;  2W04 A;  5D82 A;  3ALA A;  5BXQ A;  2Z76 A;  1VQ4 3;  1LOX A;  4MMX B;  3CCS 3;  1M1K 4;  2BMQ B;  1QAF A;  4FMC A;  1N9J A;  3ECF A;  5IG0 A;  4KFE A;  4JF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...