1T5YA

Crystal structure of northeast structural genomics consortium target hr2118: a human homolog of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
170
Chain Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SACCHAROMYCES CEREVISIAE Nip7p HOMOLOG
publication title Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 43
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1t5yA02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1t5yA01
1WXXA 3VSEA 1ZE1A 1SQWA 1IQ8A 1IT8A 3UAIA 1IT7A 2P38A 1J2BA 1R3FA 1ZE2A 1R3EA 2J5VA 2B78A 2Q07A 2J5TA 3C0KA 3LDFA 4Q1TA 1T5YA 1Q7HA 1WXWA 2CX0A 4DMGA 1K8WA 2AB4A 2CWWA 1ZL3A 2CX1A 1ZS7A 3D79A 1SGVA 2AS0A
chains in the Genus database with same CATH superfamily
1CYVA 1DMNA 1GOUA 1LXEA 6STDA 4N6V0 3MG2A 3ALAA 2CWUA 3Q1CA 4PEJA 1WK2A 4CDLA 2QGUA 1OPYA 1JV2B 3HZPA 2Z76A 3I553 1NJI4 3NBRA 3WR2A 3K9MC 3FF2A 1UI7A 5FW5A 3F7XA 3LTCA 2W6JH 1GD4A 1NO3A 5ELUA 3M6WA 3LTAA 2YX9A 1S5AA 3OX9A 1LOXA 2HVYA 4N6MA 4OK0A 3PZWA 4L7KA 2H0HA 2BU4A 3ZG5A 4EV2A 3D9RA 3F7SA 2FRXA 1RGFA 5BU4A 5IW9A 1ZS7A 1BU4A 1QAFA 4WP5A 1WMOA 3UJMA 1AQZA 1VQ53 1G0TA 4ILFA 1EUIC 3V98A 1S04A 3GZXB 1Q824 1LVNA 1EEJA 4XDWA 1FGQA 3SX1A 3EJVA 5JBSA 3MQKA 1M9GA 1RGGA 2CWVA 2IA7A 2AUSA 3DZLA 2XEPA 3EBYA 3HI7A 5KP3A 4N6LA 4BL2A 2LYXA 1BGSA 1LQMB 1Q42A 4KVHA 1RGCA 1ROVA 3C0KA 3HAXA 2J5TA 3X3ZA 5BIRA 3CMA3 2Z6BA 3EB8A 1GOYA 2HMMB 2UUGC 1BRJA 1IDPA 2F4YA 2K3DA 2J8XB 3BB9A 3CCE3 3MSOA 3NQZA 2RSXA 2CH9A 4FMDA 2HMKB 3LTDA 3RDEA 1HU9A 4NHFA 1K28A 3AGNA 3HOHA 1BRIA 3E99A 4HM3B 1V58A 1Z1SA 1WXXA 2V1LA 1RRHA 4OVMA 1QAKA 2ML6A 1Q40B 2CFGA 1MNLA 1OACA 3D3LA 1VQN3 1XNEA 4RNYA 1GY7A 4BTXA 3G0KA 3N54B 3S67A 1N5HA 4FR9A 1GMPA 1UCLA 2O9UX 1LQGC 2OQEC 4STDA 2BNGA 2CFWA 1ISKA 3KN4A 3K0ZA 2LQVA 3EC9A 2W9PA 1AVLA 5HGRA 3SYUA 3HIGA 1BRHA 3JVCA 3CCL3 4XBYA 5AIGA 1UUGB 1IQXA 2CWWA 1GMQA 3NM2A 3AGOA 1BRGA 3AHSA 3EN1B 3BNDA 5TGNA 1T3BA 1AVKA 1PFPA 1GYBA 3BU4A 2XSOB 4KFEA 1VQL3 4FCJA 2H0IA 5JPUA 4HM6B 3B7CA 5G1LA 3GAXA 2QEX3 3M6XA 3WOEB 1SQWA 1OHOA 3EHCA 1N8QA 1IQ8A 2F5MA 4FMCA 1JZDA 3JUMA 1I2EA 5KP1A 3CCR3 1I0VA 1MGRA 4MMYB 4AKYA 1BSEA 2B78A 3GSPA 4R9LA 3STDA 2YFLB 1YHQ3 2SBLA 3KIIA 2BIRA 3EN8A 4WWUC 1T5YA 1FGMA 4LZIA 5CF2A 1RGHA 3BNBA 2I9WA 1LOYA 2W04A 2Z0TA 1ZL3A 1US1A 4HM2B 2CX1A 1Q7Y4 1X1XA 1JBRA 2CK3H 5AYSC 3F8XA 1RGAA 3MPHA 4MJDA 5A0OB 1BUJA 2UX0A 4BTYA 4HYZA 3CME3 2FXTA 3OWUA 1K8A4 2CG0A 2ML5A 3MG3A 4LGQA 4ZM8A 3TDGA 1W2ZA 1LNIA 3RNTA 4IT7A 5FGOA 7RNTA 3F40A 4CI2B 4LMIA 4RNZA 4EYCA 1K9M4 2OOVA 3BIRA 1JN5B 1VQQA 2QA43 2ANEA 2RCDA 3CCJ3 4R80A 1CEWI 3LJCA 3QK9A 3T8UA 1KQS2 2XR8B 3NBJA 1NU3A 4N6NB 2DP9A 2XFTA 4LSOA 1S723 2CX0A 3D4AA 3CPW2 1BIRA 1M1K4 2KF3A 1NWWA 1UGHI 2HOHA 2Y73A 3DH2A 1B20A 1BNEA 3NV0A 3CC23 2KKUA 3L0RA 4CJNA 3EX9A 3LT9A 4J8TA 1O7MB 2SARA 3FF0A 1LRAA 1ROAA 1TFKA 3GRDA 1BNRA 1KC84 1O7PB 1Y4KA 3VSEA 2KF6A 2O3OA 4HM8B 1KSIA 3ZFZA 5JPPA 1BSCA 1OF5B 4EC6A 5AIIA 2CFKA 1I8VA 2ZDJA 3LYGA 1VQO3 4LEHA 1STFI 2E2UA 3LWQA 4AEQA 3H51A 1TTOA 1D6UA 1NNVA 3B8LA 1I70A 4DKIA 4RZMA 2Q07A 4BTWA 3UL5A 9RNTA 3CD63 1RRLA 1PYLA 1NDOB 1OHSA 1TRQA 1FZUA 2W03A 1OUNA 1RN7A 1YGEA 2AADA 4DMGA 3AHWA 1EKMA 1W5ZA 4L8OA 2E2VA 2BMRB 1RNBA 2E2TA 1TRPA 4HBRA 1FUTA 3LWVA 1BSAA 1KD14 3SOYA 3NV0B 3B4PA 3O8YA 1Q40A 1JZOA 3NUVA 3SOAA 1IYYA 5RNTA 4IIAA 1OHPA 1ZE1A 3LWRA 2GBWB 3NQYA 1RCLA 1RGKA 1Q864 3PCSA 1TUHA 2L4VA 2PZVA 3K5TA 1RTUA 3CCV3 3M65A 1OCVA 1U8CB 3S5CA 2KF4A 1IV9A 1VQ43 2JDIH 1ZX2A 2W9QA 4K61A 3WHOA 1BUQA 1I2GA 2QIYA 1FYSA 1G02A 2RBIA 3KFQC 4KFDA 1FUWA 5AI1A 2RFRA 2BHMA 3EE1A 2C10A 4WHAA 3CXC2 2GXFA 3D5IA 3FCSB 5IEPA 1MOLA 2RNTA 1RNTA 1TFOA 3FGYA 3K7CA 3T8NA 1JBTA 2OQEA 3MHEA 2WOFA 4FCZA 3UL6A 4CI1B 1V74A 3HX8A 5STDA 3N8BA 1SPUA 1U5OA 3MG1A 4RBNA 2CFLA 2MF7A 3CPOA 3G8ZA 1VQM3 2RGQA 4H3UA 2GU1A 5ELJA 3V99A 7GSPA 1RGLA 1R3EA 3QRDA 5IERA 1ZBOA 1VQP3 4MEIA 1Q9EA 3DGNA 4IPBA 3SLUA 2FNQA 4HM0B 2XRXB 1GY6A 1IVWA 1DVCA 6RNTA 1M1XB 1GS3A 3HJWA 1Q7HA 1VQK3 1JB4A 4EXRA 4FMAA 2OTJ3 5EQLA 3KZTA 2W56A 3F14A 4TX4A 1BOXA 2CWTA 2B1XB 1JB5A 1RMSA 1WNHA 3FG1A 1WTHA 3LH4A 3PXMA 2OCTA 3AMOA 3U97A 2E5OA 1GD3A 1TE7A 4I5QA 1IK3A 3G6E3 1W01A 3S29A 2D42A 1YVSA 4GL6A 5EEOA 1HKXA 1RCKA 3X3YA 1FGOA 5IG3A 2Z7AA 1LOWA 4EV5A 1I2FA 4BIRA 1M904 1A2PA 1IT7A 2IMJA 1JN5A 1N9JA 1ULJB 3BLZA 3U28A 3LTBA 1EQKA 1K41A 5G2GA 1A90A 1QMAA 5D81A 3LDFA 1I0XA 1QJGA 1LOVA 1STDA 2R41A 1G96A 3FSDA 1LNHA 3HIIA 3WA3A 4K90B 2JQ5A 3WDGB 1BSBA 1B27A 1K8WA 1DMQA 2WO0A 4KT3B 1DVDA 3ROBA 1A2VA 1C7HA 2GU3A 1ZGXA 1UDII 3SVAA 2W56B 1JNQA 4ORLA 5D82A 1SIIA 3ER7A 3KSED 2R4IA 5AIHA 4HKVB 3CCM3 3AMOB 1OF5A 4N6OB 1GSPA 1MWTA 1D6ZA 4J9AA 3DXOA 1FUSA 2RFKA 1DYUA 4K1UA 2KXGA 3V92A 3BNEA 1N5PA 4L8PA 4EBGA 3HK4A 1AY7A 3M4XA 1N9EA 3HJYA 2P05A 3FG3A 5GSPA 4BL3A 5BXQA 1JBSA 1E3RA 1HYFA 4HM7B 3PS8A 4MMZB 4R4KA 5M19A 1K734 3UB1A 3VGNA 1WXWA 3Q2PA 3DMCA 1TIJA 1VZZA 2CW9A 2D1WA 4JRFA 3LWOA 2XF3A 5CLKA 1BRNL 1B3SA 1IVXA 3EF8A 4HZBB 3WA2X 5AEWB 3FLJA 3X42A 3Q3FA 5IG0A 1TU5A 1QVG2 2ZA4A 1SGVA 4XB5A 4WYKA 1PU4A 3NM7A 1IV7A 1W4NA 3K63A 3MWZA 5IG5A 4J5KA 2YFIB 1UGIA 4N6UA 3PYJA 3WMDA 1UCJA 1ULIB 2HMOB 4R9KA 3S28A 1IT8A 1MWUA 1W02A 5LC6A 3A76A 1RSNA 4HZ9B 2IUJA 2BO9B 2W2CA 1BRSA 1VQ73 1D6YA 2XFSA 3G4S3 1B2UA 3OWYA 3G713 1X1UA 3CC43 7STDA 4HM4B 1FW7A 1OGXA 2XGLA 2L1SA 1C54A 3NXJA 4BU4A 1ASKA 3JUOA 3OWSA 3OV4A 3CNXA 5IEOA 1CH0A 1W6YA 3DUKA 5AEUB 3BNCA 4GB5A 2WGQA 4CCVA 1EA2A 2YFJB 1IVVA 4XBXA 1MWSA 4G1MB 1YIT3 1TP6A 1E3VA 2K54A 2XSHB 2P38A 3LWPA 3CCS3 3X3XA 2F98A 2XH9A 3LT8A 1O7WB 2STDA 4O2HA 3DGLA 4WYKB 3IJEB 3DGYA 3VF1A 3PCRA 3NHXA 4FMBA 1UCKA 4CI3B 4XBTA 1ZO2A 3KCHA 1JKGB 3MYTA 1IVUA 4KFFA 2GSPA 1BNFA 3NBBA 5M1AA 5IG4A 4X2OA 1YJ93 1BNGA 1VQ83 4O3VA 1I3IA 1CQSA 2IY2A 5IF6A 4WFOA 2HMJB 1VQ63 2GEXA 2GBXB 5EVHA 3LZAA 1X1YA 2AAEA 1F8NA 3SXXA 3IPTA 2BMOB 5BVBA 1EG9B 3G16A 1WMPA 3T0UA 1JJ22 3M6UA 1RGEA 1B2SA 2GEYA 3I0YA 4R1KA 3WODG 4CPKA 1UI8A 2KF5A 2Z77A 1YI23 8CHOA 2XGNA 4K1VA 2OTL3 3WOFB 3LOYA 3KKGA 3I563 3CNMA 3IUWA 1L5GB 1W6CA 1O7GB 1PY3A 3KSPA 1KWIA 2KAAA 4GHOA 5CF1A 2F99A 1BVIA 2M7OA 3KE7A 1BAOA 3CC73 2CFDA 1W7CA 3SEDA 2B24B 2WOHA 2HMLB 3U1WA 2INXA 3CCU3 2K0MA 1BNJA 6GSPA 1A67A 4AKZA 4RNTA 2ZL8A 5HOHA 1BSDA 3DY5A 4H61A 5AIFA 1BNIA 1IU7A 1RLSA 3B4OA 3FZWA 1YIJ3 3LMLA 3EQQB 4U13A 1J2BA 1B2XA 1AR0A 2ZHXB 4EW5A 3DM8A 4X2HA 1FGTA 2P0XA 3DGOA 1UW1A 1YNVX 1MGWA 3D5GA 3LXUX 1SJWA 2A15A 2F86B 4NREA 1R4YA 1RJOA 3GZBA 4O02B 1RN4A 1UUVB 1R3FA 1ZE2A 4MMXB 3CCQ3 4Q1TA 1BNSA 3UNLA 2C11A 2APOA 4HM5B 4TZ4C 1HZ1A 4HAAA 3OW22 3FH1A 1V57A 3J7Yd 4XDVA 4HOHA 5AYRB 1FGRA 2FGTA 3URPA 1JB2A 2OWPA 1CYUA 1Q814 1W2B2 1B2MA 1VQ93 1SARA 4QWTA 4XM4A 3D79A 2F5WA 3GWRA 3NX0A 2KCDA 1GY5A 1R4CA 2AS0A 1SIHA 3ZV0C 1W00A 2IUKA 1OH0A 3EBTA 3ECFA 4FCMA 2UGIA 4N3VA 2CG1A 4J5GA 1O7HB 3F8HA 3GZYB 1I3FA 2W0QA 4N6TA 2CHCA 3CU3A 3RGRA 3VSYA 3FG4A 3UAIA 4GSPA 2IYJA 1DETA 1T2IA 1GMRA 4JF8A 2P0MA 1A2KA 1IQYA 2P09A 4I4KA 4O8SA 4HJLB 1JRQA 3Q90A 4KZ1A 2C4BA 2BT3A 3N9HA 3JUNA 1FA3A 2AB4A 5CK6A 3M6VA 1RDSA 3MKIA 2MC8A 3RGAA 2HMNB 1OGZA 3F9SA 3H3HA 3JUQA 5KP4A 1YGWA 1GOVA 3GZRA 4HVNA 5D83A 2KRTA 1NB5I 1QALA 4Q53A 8RNTA 1T2HA 1UUWB 3OXAA 5IENA 1BRKA 3ZG0A 1N8R4 1B21A 1QVF2 3M8CA 1WQLB 1MWRA 3IMAB 1YVBI 5M18A 4NPBA 3S27A 1JKGA 1X1WA 2H0GA 3JUPA 3FKAA 3A5EA 1YJN3 1NB3I 1RHLA 1AV4A 1DMMA 1DE3A 2J5VA 2CIUA 3X41A 4OUQA 2WGOA 5DRVA 5I97A 1UCIA 1B2ZA 2BMQB 2CKFB 1YJW3 2PNCA 3DGMA 1WMNA 1E97A 5DREA 1W6GA 2OOVC 3PGBA 2CC3A 5G1KA 3X40A 1RN1A 4LYLB 5CXOA 1RKYA 1UOYA 4HM1B 1O7NB 2F56A 5LC7A 2EY4A 1BANA 1TJDA 2Y74A
chains in the Genus database with same CATH topology
1CYVA 1DMNA 1LXEA 6STDA 4N6V0 3MG2A 3ALAA 2CWUA 3Q1CA 4PEJA 4CDLA 2QGUA 1OPYA 1JV2B 3HZPA 2Z76A 3I553 1NJI4 3NBRA 3K9MC 3FF2A 1UI7A 5FW5A 3F7XA 3LTCA 2W6JH 1GD4A 1NO3A 5ELUA 3LTAA 2YX9A 1S5AA 3OX9A 1LOXA 4N6MA 4OK0A 3PZWA 4L7KA 4EV2A 3D9RA 3F7SA 5IW9A 1ZS7A 1QAFA 4WP5A 1WMOA 3UJMA 1VQ53 3V98A 3GZXB 1Q824 1LVNA 4XDWA 3SX1A 1FGQA 3EJVA 5JBSA 2IA7A 1M9GA 2CWVA 3DZLA 3HI7A 5KP3A 2XEPA 3EBYA 4N6LA 2LYXA 1Q42A 4KVHA 1ROVA 3C0KA 2J5TA 3X3ZA 3CMA3 2Z6BA 3EB8A 2HMMB 1IDPA 3CCE3 3BB9A 3MSOA 3NQZA 2RSXA 2CH9A 4FMDA 2HMKB 3LTDA 3RDEA 1HU9A 4NHFA 1K28A 3E99A 4HM3B 1Z1SA 1WXXA 2V1LA 1RRHA 4OVMA 1QAKA 2ML6A 1Q40B 2CFGA 1MNLA 1OACA 3D3LA 1VQN3 4RNYA 1GY7A 4BTXA 3G0KA 3N54B 3S67A 1N5HA 4FR9A 2OQEC 2O9UX 1ISKA 4STDA 2BNGA 2CFWA 3KN4A 3K0ZA 2LQVA 3EC9A 2W9PA 1AVLA 5HGRA 3HIGA 3JVCA 3CCL3 4XBYA 5AIGA 1IQXA 2CWWA 3NM2A 3EN1B 3BNDA 5TGNA 1AVKA 1PFPA 1GYBA 2XSOB 4KFEA 1VQL3 4FCJA 5JPUA 4HM6B 3B7CA 3GAXA 2QEX3 3WOEB 1SQWA 1OHOA 3EHCA 1N8QA 1IQ8A 4FMCA 3CCR3 5KP1A 3JUMA 4MMYB 4AKYA 2B78A 4R9LA 3STDA 2YFLB 1YHQ3 2SBLA 3KIIA 3EN8A 4WWUC 1T5YA 1FGMA 4LZIA 5CF2A 3BNBA 2I9WA 2W04A 1ZL3A 1US1A 4HM2B 2CX1A 1Q7Y4 2CK3H 5AYSC 3F8XA 4MJDA 3MPHA 5A0OB 2UX0A 4BTYA 4HYZA 3CME3 2FXTA 3OWUA 1K8A4 2CG0A 2ML5A 3MG3A 4LGQA 4ZM8A 3TDGA 1W2ZA 4IT7A 5FGOA 3F40A 4LMIA 4RNZA 4EYCA 1K9M4 2OOVA 1JN5B 2QA43 2RCDA 3CCJ3 4R80A 1CEWI 3QK9A 3T8UA 1KQS2 2XR8B 3NBJA 1NU3A 4N6NB 2XFTA 4LSOA 1S723 2CX0A 3CPW2 1M1K4 1NWWA 2Y73A 3NV0A 3CC23 3L0RA 3EX9A 3LT9A 4J8TA 1O7MB 3FF0A 1ROAA 1TFKA 3GRDA 1KC84 1O7PB 1Y4KA 3VSEA 4HM8B 2O3OA 1KSIA 5JPPA 1OF5B 4EC6A 5AIIA 2CFKA 2ZDJA 3LYGA 1VQO3 4LEHA 1STFI 2E2UA 4AEQA 3H51A 1D6UA 3B8LA 4RZMA 2Q07A 4BTWA 3UL5A 3CD63 1RRLA 1NDOB 1OHSA 2W03A 1OUNA 1RN7A 1YGEA 4DMGA 1EKMA 1W5ZA 4L8OA 2E2VA 2BMRB 2E2TA 4HBRA 1KD14 3SOYA 3NV0B 3B4PA 3O8YA 1Q40A 3NUVA 3SOAA 4IIAA 1OHPA 1ZE1A 2GBWB 3NQYA 1Q864 3PCSA 1TUHA 2L4VA 2PZVA 3K5TA 3CCV3 1U8CB 1OCVA 3S5CA 1IV9A 1VQ43 2JDIH 1ZX2A 2W9QA 4K61A 1BUQA 2QIYA 3KFQC 4KFDA 1FUWA 5AI1A 2RFRA 2BHMA 3EE1A 2C10A 4WHAA 3CXC2 2GXFA 3FCSB 5IEPA 1MOLA 1TFOA 3FGYA 3K7CA 3T8NA 2OQEA 3MHEA 2WOFA 4FCZA 3UL6A 1V74A 3HX8A 5STDA 3N8BA 1SPUA 1U5OA 3MG1A 4RBNA 2CFLA 2MF7A 3CPOA 3G8ZA 1VQM3 2RGQA 4H3UA 2GU1A 5ELJA 3V99A 1R3EA 3QRDA 5IERA 1VQP3 4MEIA 3DGNA 4IPBA 3SLUA 2FNQA 4HM0B 2XRXB 1GY6A 1IVWA 1DVCA 1M1XB 1GS3A 1Q7HA 1VQK3 1JB4A 4EXRA 4FMAA 2OTJ3 5EQLA 3KZTA 2W56A 3F14A 4TX4A 2CWTA 2B1XB 1JB5A 1WNHA 3FG1A 3LH4A 1WTHA 3PXMA 5AIFA 2OCTA 3AMOA 3U97A 1GD3A 1IK3A 3G6E3 1W01A 3S29A 2D42A 5EEOA 4GL6A 1HKXA 3X3YA 1FGOA 5IG3A 2Z7AA 4EV5A 1M904 1IT7A 2IMJA 1JN5A 1N9JA 1ULJB 3BLZA 3LTBA 1EQKA 1K41A 5G2GA 1A90A 1QMAA 5D81A 3LDFA 1QJGA 1STDA 1G96A 3FSDA 1LNHA 3HIIA 3WA3A 4K90B 2JQ5A 3WDGB 2WO0A 1K8WA 1DMQA 1DVDA 3ROBA 1A2VA 1C7HA 2GU3A 3SVAA 2W56B 1JNQA 4ORLA 5D82A 1SIIA 3ER7A 3KSED 2R4IA 5AIHA 4HKVB 3CCM3 3AMOB 1OF5A 4N6OB 1D6ZA 4J9AA 3DXOA 1DYUA 4K1UA 2KXGA 3V92A 3BNEA 1N5PA 4L8PA 4EBGA 3HK4A 1N9EA 3FG3A 5BXQA 2P05A 1E3RA 4HM7B 3PS8A 4MMZB 4R4KA 1K734 3UB1A 3VGNA 1WXWA 3Q2PA 3DMCA 1TIJA 1VZZA 2CW9A 2D1WA 4JRFA 5CLKA 2XF3A 1IVXA 3EF8A 4HZBB 3WA2X 5AEWB 3FLJA 3X42A 5IG0A 1TU5A 1QVG2 4XB5A 1SGVA 4WYKA 3NM7A 1IV7A 1W4NA 3K63A 3MWZA 5IG5A 2YFIB 4N6UA 3PYJA 3WMDA 1ULIB 2HMOB 4R9KA 3S28A 1IT8A 1W02A 5LC6A 3A76A 4HZ9B 2IUJA 2BO9B 2W2CA 1VQ73 1D6YA 2XFSA 3G4S3 3OWYA 3G713 3CC43 7STDA 4HM4B 1OGXA 2XGLA 3NXJA 1ASKA 3JUOA 3OWSA 3OV4A 3CNXA 5IEOA 1W6YA 3DUKA 5AEUB 3BNCA 4GB5A 2WGQA 4CCVA 1EA2A 2YFJB 1IVVA 4XBXA 1YIT3 4G1MB 1TP6A 1E3VA 2K54A 2XSHB 2P38A 3CCS3 3X3XA 2F98A 2XH9A 3LT8A 1O7WB 2STDA 4O2HA 3DGLA 4WYKB 3IJEB 3VF1A 3PCRA 3NHXA 4FMBA 4XBTA 1ZO2A 1JKGB 3MYTA 1IVUA 4KFFA 5IG4A 1YJ93 3NBBA 4X2OA 1VQ83 4O3VA 1CQSA 5IF6A 4WFOA 2HMJB 1VQ63 2GEXA 2GBXB 5EVHA 3LZAA 1F8NA 3SXXA 3IPTA 2BMOB 5BVBA 1EG9B 3G16A 1WMPA 3T0UA 1JJ22 2GEYA 3I0YA 3WODG 4R1KA 1UI8A 2Z77A 1YI23 8CHOA 2XGNA 4K1VA 2OTL3 3WOFB 3LOYA 3KKGA 3I563 3CNMA 1L5GB 1W6CA 1O7GB 3KSPA 1KWIA 5CF1A 2F99A 2M7OA 3KE7A 3CC73 2CFDA 1W7CA 3SEDA 2B24B 2WOHA 2HMLB 3U1WA 2INXA 3CCU3 2K0MA 1A67A 4AKZA 2ZL8A 3DY5A 4H61A 1IU7A 3B4OA 3FZWA 1YIJ3 3LMLA 3EQQB 4U13A 1J2BA 1AR0A 3DM8A 4X2HA 1FGTA 2P0XA 3DGOA 1UW1A 3LXUX 4NREA 1SJWA 2A15A 2F86B 1RJOA 3GZBA 4O02B 1UUVB 1R3FA 1ZE2A 4MMXB 3CCQ3 4Q1TA 3UNLA 2C11A 4HM5B 3OW22 3FH1A 3J7Yd 4XDVA 5AYRB 1FGRA 2FGTA 1JB2A 2OWPA 1CYUA 1Q814 1W2B2 1VQ93 4QWTA 4XM4A 3D79A 3NX0A 3GWRA 1PU4A 2KCDA 1GY5A 1R4CA 2AS0A 1SIHA 1W00A 2IUKA 1OH0A 3EBTA 3ECFA 4FCMA 4N3VA 2CG1A 1O7HB 3F8HA 3GZYB 2W0QA 4N6TA 2CHCA 3CU3A 3RGRA 3VSYA 3FG4A 3UAIA 4JF8A 2P0MA 1A2KA 1IQYA 2P09A 4I4KA 4O8SA 4HJLB 1JRQA 3Q90A 4KZ1A 2BT3A 3N9HA 3JUNA 1FA3A 2AB4A 5CK6A 3MKIA 2MC8A 3RGAA 2HMNB 1OGZA 3F9SA 3H3HA 3JUQA 5KP4A 4HVNA 3GZRA 5D83A 1NB5I 2KRTA 1QALA 4Q53A 1UUWB 3OXAA 5IENA 1N8R4 1QVF2 3M8CA 1WQLB 3IMAB 1YVBI 3S27A 1JKGA 3JUPA 3FKAA 1YJN3 1NB3I 1AV4A 1DMMA 2J5VA 2CIUA 3X41A 4OUQA 2WGOA 5DRVA 5I97A 2BMQB 2CKFB 1YJW3 2PNCA 3DGMA 1WMNA 1E97A 5DREA 1W6GA 2OOVC 3PGBA 2CC3A 3X40A 5CXOA 1RKYA 4HM1B 1O7NB 5LC7A 2Y74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXX A;  3VSE A;  1ZE1 A;  1SQW A;  1IQ8 A;  1IT8 A;  3UAI A;  1IT7 A;  2P38 A;  1J2B A;  1R3F A;  1ZE2 A;  1R3E A;  2J5V A;  2B78 A;  2Q07 A;  2J5T A;  3C0K A;  3LDF A;  4Q1T A;  1T5Y A;  1Q7H A;  1WXW A;  2CX0 A;  4DMG A;  1K8W A;  2AB4 A;  2CWW A;  1ZL3 A;  2CX1 A;  1ZS7 A;  3D79 A;  1SGV A;  2AS0 A; 
#chains in the Genus database with same CATH topology
 1CYV A;  1DMN A;  1GOU A;  1LXE A;  6STD A;  4N6V 0;  3MG2 A;  3ALA A;  2CWU A;  3Q1C A;  4PEJ A;  1WK2 A;  4CDL A;  2QGU A;  1OPY A;  1JV2 B;  3HZP A;  2Z76 A;  3I55 3;  1NJI 4;  3NBR A;  3WR2 A;  3K9M C;  3FF2 A;  1UI7 A;  5FW5 A;  3F7X A;  3LTC A;  2W6J H;  1GD4 A;  1NO3 A;  5ELU A;  3M6W A;  3LTA A;  2YX9 A;  1S5A A;  3OX9 A;  1LOX A;  2HVY A;  4N6M A;  4OK0 A;  3PZW A;  4L7K A;  2H0H A;  2BU4 A;  3ZG5 A;  4EV2 A;  3D9R A;  3F7S A;  2FRX A;  1RGF A;  5BU4 A;  5IW9 A;  1ZS7 A;  1BU4 A;  1QAF A;  4WP5 A;  1WMO A;  3UJM A;  1AQZ A;  1VQ5 3;  1G0T A;  4ILF A;  1EUI C;  3V98 A;  1S04 A;  3GZX B;  1Q82 4;  1LVN A;  1EEJ A;  4XDW A;  1FGQ A;  3SX1 A;  3EJV A;  5JBS A;  3MQK A;  1M9G A;  1RGG A;  2CWV A;  2IA7 A;  2AUS A;  3DZL A;  2XEP A;  3EBY A;  3HI7 A;  5KP3 A;  4N6L A;  4BL2 A;  2LYX A;  1BGS A;  1LQM B;  1Q42 A;  4KVH A;  1RGC A;  1ROV A;  3C0K A;  3HAX A;  2J5T A;  3X3Z A;  5BIR A;  3CMA 3;  2Z6B A;  3EB8 A;  1GOY A;  2HMM B;  2UUG C;  1BRJ A;  1IDP A;  2F4Y A;  2K3D A;  2J8X B;  3BB9 A;  3CCE 3;  3MSO A;  3NQZ A;  2RSX A;  2CH9 A;  4FMD A;  2HMK B;  3LTD A;  3RDE A;  1HU9 A;  4NHF A;  1K28 A;  3AGN A;  3HOH A;  1BRI A;  3E99 A;  4HM3 B;  1V58 A;  1Z1S A;  1WXX A;  2V1L A;  1RRH A;  4OVM A;  1QAK A;  2ML6 A;  1Q40 B;  2CFG A;  1MNL A;  1OAC A;  3D3L A;  1VQN 3;  1XNE A;  4RNY A;  1GY7 A;  4BTX A;  3G0K A;  3N54 B;  3S67 A;  1N5H A;  4FR9 A;  1GMP A;  1UCL A;  2O9U X;  1LQG C;  2OQE C;  4STD A;  2BNG A;  2CFW A;  1ISK A;  3KN4 A;  3K0Z A;  2LQV A;  3EC9 A;  2W9P A;  1AVL A;  5HGR A;  3SYU A;  3HIG A;  1BRH A;  3JVC A;  3CCL 3;  4XBY A;  5AIG A;  1UUG B;  1IQX A;  2CWW A;  1GMQ A;  3NM2 A;  3AGO A;  1BRG A;  3AHS A;  3EN1 B;  3BND A;  5TGN A;  1T3B A;  1AVK A;  1PFP A;  1GYB A;  3BU4 A;  2XSO B;  4KFE A;  1VQL 3;  4FCJ A;  2H0I A;  5JPU A;  4HM6 B;  3B7C A;  5G1L A;  3GAX A;  2QEX 3;  3M6X A;  3WOE B;  1SQW A;  1OHO A;  3EHC A;  1N8Q A;  1IQ8 A;  2F5M A;  4FMC A;  1JZD A;  3JUM A;  1I2E A;  5KP1 A;  3CCR 3;  1I0V A;  1MGR A;  4MMY B;  4AKY A;  1BSE A;  2B78 A;  3GSP A;  4R9L A;  3STD A;  2YFL B;  1YHQ 3;  2SBL A;  3KII A;  2BIR A;  3EN8 A;  4WWU C;  1T5Y A;  1FGM A;  4LZI A;  5CF2 A;  1RGH A;  3BNB A;  2I9W A;  1LOY A;  2W04 A;  2Z0T A;  1ZL3 A;  1US1 A;  4HM2 B;  2CX1 A;  1Q7Y 4;  1X1X A;  1JBR A;  2CK3 H;  5AYS C;  3F8X A;  1RGA A;  3MPH A;  4MJD A;  5A0O B;  1BUJ A;  2UX0 A;  4BTY A;  4HYZ A;  3CME 3;  2FXT A;  3OWU A;  1K8A 4;  2CG0 A;  2ML5 A;  3MG3 A;  4LGQ A;  4ZM8 A;  3TDG A;  1W2Z A;  1LNI A;  3RNT A;  4IT7 A;  5FGO A;  7RNT A;  3F40 A;  4CI2 B;  4LMI A;  4RNZ A;  4EYC A;  1K9M 4;  2OOV A;  3BIR A;  1JN5 B;  1VQQ A;  2QA4 3;  2ANE A;  2RCD A;  3CCJ 3;  4R80 A;  1CEW I;  3LJC A;  3QK9 A;  3T8U A;  1KQS 2;  2XR8 B;  3NBJ A;  1NU3 A;  4N6N B;  2DP9 A;  2XFT A;  4LSO A;  1S72 3;  2CX0 A;  3D4A A;  3CPW 2;  1BIR A;  1M1K 4;  2KF3 A;  1NWW A;  1UGH I;  2HOH A;  2Y73 A;  3DH2 A;  1B20 A;  1BNE A;  3NV0 A;  3CC2 3;  2KKU A;  3L0R A;  4CJN A;  3EX9 A;  3LT9 A;  4J8T A;  1O7M B;  2SAR A;  3FF0 A;  1LRA A;  1ROA A;  1TFK A;  3GRD A;  1BNR A;  1KC8 4;  1O7P B;  1Y4K A;  3VSE A;  2KF6 A;  2O3O A;  4HM8 B;  1KSI A;  3ZFZ A;  5JPP A;  1BSC A;  1OF5 B;  4EC6 A;  5AII A;  2CFK A;  1I8V A;  2ZDJ A;  3LYG A;  1VQO 3;  4LEH A;  1STF I;  2E2U A;  3LWQ A;  4AEQ A;  3H51 A;  1TTO A;  1D6U A;  1NNV A;  3B8L A;  1I70 A;  4DKI A;  4RZM A;  2Q07 A;  4BTW A;  3UL5 A;  9RNT A;  3CD6 3;  1RRL A;  1PYL A;  1NDO B;  1OHS A;  1TRQ A;  1FZU A;  2W03 A;  1OUN A;  1RN7 A;  1YGE A;  2AAD A;  4DMG A;  3AHW A;  1EKM A;  1W5Z A;  4L8O A;  2E2V A;  2BMR B;  1RNB A;  2E2T A;  1TRP A;  4HBR A;  1FUT A;  3LWV A;  1BSA A;  1KD1 4;  3SOY A;  3NV0 B;  3B4P A;  3O8Y A;  1Q40 A;  1JZO A;  3NUV A;  3SOA A;  1IYY A;  5RNT A;  4IIA A;  1OHP A;  1ZE1 A;  3LWR A;  2GBW B;  3NQY A;  1RCL A;  1RGK A;  1Q86 4;  3PCS A;  1TUH A;  2L4V A;  2PZV A;  3K5T A;  1RTU A;  3CCV 3;  3M65 A;  1OCV A;  1U8C B;  3S5C A;  2KF4 A;  1IV9 A;  1VQ4 3;  2JDI H;  1ZX2 A;  2W9Q A;  4K61 A;  3WHO A;  1BUQ A;  1I2G A;  2QIY A;  1FYS A;  1G02 A;  2RBI A;  3KFQ C;  4KFD A;  1FUW A;  5AI1 A;  2RFR A;  2BHM A;  3EE1 A;  2C10 A;  4WHA A;  3CXC 2;  2GXF A;  3D5I A;  3FCS B;  5IEP A;  1MOL A;  2RNT A;  1RNT A;  1TFO A;  3FGY A;  3K7C A;  3T8N A;  1JBT A;  2OQE A;  3MHE A;  2WOF A;  4FCZ A;  3UL6 A;  4CI1 B;  1V74 A;  3HX8 A;  5STD A;  3N8B A;  1SPU A;  1U5O A;  3MG1 A;  4RBN A;  2CFL A;  2MF7 A;  3CPO A;  3G8Z A;  1VQM 3;  2RGQ A;  4H3U A;  2GU1 A;  5ELJ A;  3V99 A;  7GSP A;  1RGL A;  1R3E A;  3QRD A;  5IER A;  1ZBO A;  1VQP 3;  4MEI A;  1Q9E A;  3DGN A;  4IPB A;  3SLU A;  2FNQ A;  4HM0 B;  2XRX B;  1GY6 A;  1IVW A;  1DVC A;  6RNT A;  1M1X B;  1GS3 A;  3HJW A;  1Q7H A;  1VQK 3;  1JB4 A;  4EXR A;  4FMA A;  2OTJ 3;  5EQL A;  3KZT A;  2W56 A;  3F14 A;  4TX4 A;  1BOX A;  2CWT A;  2B1X B;  1JB5 A;  1RMS A;  1WNH A;  3FG1 A;  1WTH A;  3LH4 A;  3PXM A;  2OCT A;  3AMO A;  3U97 A;  2E5O A;  1GD3 A;  1TE7 A;  4I5Q A;  1IK3 A;  3G6E 3;  1W01 A;  3S29 A;  2D42 A;  1YVS A;  4GL6 A;  5EEO A;  1HKX A;  1RCK A;  3X3Y A;  1FGO A;  5IG3 A;  2Z7A A;  1LOW A;  4EV5 A;  1I2F A;  4BIR A;  1M90 4;  1A2P A;  1IT7 A;  2IMJ A;  1JN5 A;  1N9J A;  1ULJ B;  3BLZ A;  3U28 A;  3LTB A;  1EQK A;  1K41 A;  5G2G A;  1A90 A;  1QMA A;  5D81 A;  3LDF A;  1I0X A;  1QJG A;  1LOV A;  1STD A;  2R41 A;  1G96 A;  3FSD A;  1LNH A;  3HII A;  3WA3 A;  4K90 B;  2JQ5 A;  3WDG B;  1BSB A;  1B27 A;  1K8W A;  1DMQ A;  2WO0 A;  4KT3 B;  1DVD A;  3ROB A;  1A2V A;  1C7H A;  2GU3 A;  1ZGX A;  1UDI I;  3SVA A;  2W56 B;  1JNQ A;  4ORL A;  5D82 A;  1SII A;  3ER7 A;  3KSE D;  2R4I A;  5AIH A;  4HKV B;  3CCM 3;  3AMO B;  1OF5 A;  4N6O B;  1GSP A;  1MWT A;  1D6Z A;  4J9A A;  3DXO A;  1FUS A;  2RFK A;  1DYU A;  4K1U A;  2KXG A;  3V92 A;  3BNE A;  1N5P A;  4L8P A;  4EBG A;  3HK4 A;  1AY7 A;  3M4X A;  1N9E A;  3HJY A;  2P05 A;  3FG3 A;  5GSP A;  4BL3 A;  5BXQ A;  1JBS A;  1E3R A;  1HYF A;  4HM7 B;  3PS8 A;  4MMZ B;  4R4K A;  5M19 A;  1K73 4;  3UB1 A;  3VGN A;  1WXW A;  3Q2P A;  3DMC A;  1TIJ A;  1VZZ A;  2CW9 A;  2D1W A;  4JRF A;  3LWO A;  2XF3 A;  5CLK A;  1BRN L;  1B3S A;  1IVX A;  3EF8 A;  4HZB B;  3WA2 X;  5AEW B;  3FLJ A;  3X42 A;  3Q3F A;  5IG0 A;  1TU5 A;  1QVG 2;  2ZA4 A;  1SGV A;  4XB5 A;  4WYK A;  1PU4 A;  3NM7 A;  1IV7 A;  1W4N A;  3K63 A;  3MWZ A;  5IG5 A;  4J5K A;  2YFI B;  1UGI A;  4N6U A;  3PYJ A;  3WMD A;  1UCJ A;  1ULI B;  2HMO B;  4R9K A;  3S28 A;  1IT8 A;  1MWU A;  1W02 A;  5LC6 A;  3A76 A;  1RSN A;  4HZ9 B;  2IUJ A;  2BO9 B;  2W2C A;  1BRS A;  1VQ7 3;  1D6Y A;  2XFS A;  3G4S 3;  1B2U A;  3OWY A;  3G71 3;  1X1U A;  3CC4 3;  7STD A;  4HM4 B;  1FW7 A;  1OGX A;  2XGL A;  2L1S A;  1C54 A;  3NXJ A;  4BU4 A;  1ASK A;  3JUO A;  3OWS A;  3OV4 A;  3CNX A;  5IEO A;  1CH0 A;  1W6Y A;  3DUK A;  5AEU B;  3BNC A;  4GB5 A;  2WGQ A;  4CCV A;  1EA2 A;  2YFJ B;  1IVV A;  4XBX A;  1MWS A;  4G1M B;  1YIT 3;  1TP6 A;  1E3V A;  2K54 A;  2XSH B;  2P38 A;  3LWP A;  3CCS 3;  3X3X A;  2F98 A;  2XH9 A;  3LT8 A;  1O7W B;  2STD A;  4O2H A;  3DGL A;  4WYK B;  3IJE B;  3DGY A;  3VF1 A;  3PCR A;  3NHX A;  4FMB A;  1UCK A;  4CI3 B;  4XBT A;  1ZO2 A;  3KCH A;  1JKG B;  3MYT A;  1IVU A;  4KFF A;  2GSP A;  1BNF A;  3NBB A;  5M1A A;  5IG4 A;  4X2O A;  1YJ9 3;  1BNG A;  1VQ8 3;  4O3V A;  1I3I A;  1CQS A;  2IY2 A;  5IF6 A;  4WFO A;  2HMJ B;  1VQ6 3;  2GEX A;  2GBX B;  5EVH A;  3LZA A;  1X1Y A;  2AAE A;  1F8N A;  3SXX A;  3IPT A;  2BMO B;  5BVB A;  1EG9 B;  3G16 A;  1WMP A;  3T0U A;  1JJ2 2;  3M6U A;  1RGE A;  1B2S A;  2GEY A;  3I0Y A;  4R1K A;  3WOD G;  4CPK A;  1UI8 A;  2KF5 A;  2Z77 A;  1YI2 3;  8CHO A;  2XGN A;  4K1V A;  2OTL 3;  3WOF B;  3LOY A;  3KKG A;  3I56 3;  3CNM A;  3IUW A;  1L5G B;  1W6C A;  1O7G B;  1PY3 A;  3KSP A;  1KWI A;  2KAA A;  4GHO A;  5CF1 A;  2F99 A;  1BVI A;  2M7O A;  3KE7 A;  1BAO A;  3CC7 3;  2CFD A;  1W7C A;  3SED A;  2B24 B;  2WOH A;  2HML B;  3U1W A;  2INX A;  3CCU 3;  2K0M A;  1BNJ A;  6GSP A;  1A67 A;  4AKZ A;  4RNT A;  2ZL8 A;  5HOH A;  1BSD A;  3DY5 A;  4H61 A;  5AIF A;  1BNI A;  1IU7 A;  1RLS A;  3B4O A;  3FZW A;  1YIJ 3;  3LML A;  3EQQ B;  4U13 A;  1J2B A;  1B2X A;  1AR0 A;  2ZHX B;  4EW5 A;  3DM8 A;  4X2H A;  1FGT A;  2P0X A;  3DGO A;  1UW1 A;  1YNV X;  1MGW A;  3D5G A;  3LXU X;  1SJW A;  2A15 A;  2F86 B;  4NRE A;  1R4Y A;  1RJO A;  3GZB A;  4O02 B;  1RN4 A;  1UUV B;  1R3F A;  1ZE2 A;  4MMX B;  3CCQ 3;  4Q1T A;  1BNS A;  3UNL A;  2C11 A;  2APO A;  4HM5 B;  4TZ4 C;  1HZ1 A;  4HAA A;  3OW2 2;  3FH1 A;  1V57 A;  3J7Y d;  4XDV A;  4HOH A;  5AYR B;  1FGR A;  2FGT A;  3URP A;  1JB2 A;  2OWP A;  1CYU A;  1Q81 4;  1W2B 2;  1B2M A;  1VQ9 3;  1SAR A;  4QWT A;  4XM4 A;  3D79 A;  2F5W A;  3GWR A;  3NX0 A;  2KCD A;  1GY5 A;  1R4C A;  2AS0 A;  1SIH A;  3ZV0 C;  1W00 A;  2IUK A;  1OH0 A;  3EBT A;  3ECF A;  4FCM A;  2UGI A;  4N3V A;  2CG1 A;  4J5G A;  1O7H B;  3F8H A;  3GZY B;  1I3F A;  2W0Q A;  4N6T A;  2CHC A;  3CU3 A;  3RGR A;  3VSY A;  3FG4 A;  3UAI A;  4GSP A;  2IYJ A;  1DET A;  1T2I A;  1GMR A;  4JF8 A;  2P0M A;  1A2K A;  1IQY A;  2P09 A;  4I4K A;  4O8S A;  4HJL B;  1JRQ A;  3Q90 A;  4KZ1 A;  2C4B A;  2BT3 A;  3N9H A;  3JUN A;  1FA3 A;  2AB4 A;  5CK6 A;  3M6V A;  1RDS A;  3MKI A;  2MC8 A;  3RGA A;  2HMN B;  1OGZ A;  3F9S A;  3H3H A;  3JUQ A;  5KP4 A;  1YGW A;  1GOV A;  3GZR A;  4HVN A;  5D83 A;  2KRT A;  1NB5 I;  1QAL A;  4Q53 A;  8RNT A;  1T2H A;  1UUW B;  3OXA A;  5IEN A;  1BRK A;  3ZG0 A;  1N8R 4;  1B21 A;  1QVF 2;  3M8C A;  1WQL B;  1MWR A;  3IMA B;  1YVB I;  5M18 A;  4NPB A;  3S27 A;  1JKG A;  1X1W A;  2H0G A;  3JUP A;  3FKA A;  3A5E A;  1YJN 3;  1NB3 I;  1RHL A;  1AV4 A;  1DMM A;  1DE3 A;  2J5V A;  2CIU A;  3X41 A;  4OUQ A;  2WGO A;  5DRV A;  5I97 A;  1UCI A;  1B2Z A;  2BMQ B;  2CKF B;  1YJW 3;  2PNC A;  3DGM A;  1WMN A;  1E97 A;  5DRE A;  1W6G A;  2OOV C;  3PGB A;  2CC3 A;  5G1K A;  3X40 A;  1RN1 A;  4LYL B;  5CXO A;  1RKY A;  1UOY A;  4HM1 B;  1O7N B;  2F56 A;  5LC7 A;  2EY4 A;  1BAN A;  1TJD A;  2Y74 A; 
#chains in the Genus database with same CATH homology
 1CYV A;  1DMN A;  1LXE A;  6STD A;  4N6V 0;  3MG2 A;  3ALA A;  2CWU A;  3Q1C A;  4PEJ A;  4CDL A;  2QGU A;  1OPY A;  1JV2 B;  3HZP A;  2Z76 A;  3I55 3;  1NJI 4;  3NBR A;  3K9M C;  3FF2 A;  1UI7 A;  5FW5 A;  3F7X A;  3LTC A;  2W6J H;  1GD4 A;  1NO3 A;  5ELU A;  3LTA A;  2YX9 A;  1S5A A;  3OX9 A;  1LOX A;  4N6M A;  4OK0 A;  3PZW A;  4L7K A;  4EV2 A;  3D9R A;  3F7S A;  5IW9 A;  1ZS7 A;  1QAF A;  4WP5 A;  1WMO A;  3UJM A;  1VQ5 3;  3V98 A;  3GZX B;  1Q82 4;  1LVN A;  4XDW A;  3SX1 A;  1FGQ A;  3EJV A;  5JBS A;  2IA7 A;  1M9G A;  2CWV A;  3DZL A;  3HI7 A;  5KP3 A;  2XEP A;  3EBY A;  4N6L A;  2LYX A;  1Q42 A;  4KVH A;  1ROV A;  3C0K A;  2J5T A;  3X3Z A;  3CMA 3;  2Z6B A;  3EB8 A;  2HMM B;  1IDP A;  3CCE 3;  3BB9 A;  3MSO A;  3NQZ A;  2RSX A;  2CH9 A;  4FMD A;  2HMK B;  3LTD A;  3RDE A;  1HU9 A;  4NHF A;  1K28 A;  3E99 A;  4HM3 B;  1Z1S A;  1WXX A;  2V1L A;  1RRH A;  4OVM A;  1QAK A;  2ML6 A;  1Q40 B;  2CFG A;  1MNL A;  1OAC A;  3D3L A;  1VQN 3;  4RNY A;  1GY7 A;  4BTX A;  3G0K A;  3N54 B;  3S67 A;  1N5H A;  4FR9 A;  2OQE C;  2O9U X;  1ISK A;  4STD A;  2BNG A;  2CFW A;  3KN4 A;  3K0Z A;  2LQV A;  3EC9 A;  2W9P A;  1AVL A;  5HGR A;  3HIG A;  3JVC A;  3CCL 3;  4XBY A;  5AIG A;  1IQX A;  2CWW A;  3NM2 A;  3EN1 B;  3BND A;  5TGN A;  1AVK A;  1PFP A;  1GYB A;  2XSO B;  4KFE A;  1VQL 3;  4FCJ A;  5JPU A;  4HM6 B;  3B7C A;  3GAX A;  2QEX 3;  3WOE B;  1SQW A;  1OHO A;  3EHC A;  1N8Q A;  1IQ8 A;  4FMC A;  3CCR 3;  5KP1 A;  3JUM A;  4MMY B;  4AKY A;  2B78 A;  4R9L A;  3STD A;  2YFL B;  1YHQ 3;  2SBL A;  3KII A;  3EN8 A;  4WWU C;  1T5Y A;  1FGM A;  4LZI A;  5CF2 A;  3BNB A;  2I9W A;  2W04 A;  1ZL3 A;  1US1 A;  4HM2 B;  2CX1 A;  1Q7Y 4;  2CK3 H;  5AYS C;  3F8X A;  4MJD A;  3MPH A;  5A0O B;  2UX0 A;  4BTY A;  4HYZ A;  3CME 3;  2FXT A;  3OWU A;  1K8A 4;  2CG0 A;  2ML5 A;  3MG3 A;  4LGQ A;  4ZM8 A;  3TDG A;  1W2Z A;  4IT7 A;  5FGO A;  3F40 A;  4LMI A;  4RNZ A;  4EYC A;  1K9M 4;  2OOV A;  1JN5 B;  2QA4 3;  2RCD A;  3CCJ 3;  4R80 A;  1CEW I;  3QK9 A;  3T8U A;  1KQS 2;  2XR8 B;  3NBJ A;  1NU3 A;  4N6N B;  2XFT A;  4LSO A;  1S72 3;  2CX0 A;  3CPW 2;  1M1K 4;  1NWW A;  2Y73 A;  3NV0 A;  3CC2 3;  3L0R A;  3EX9 A;  3LT9 A;  4J8T A;  1O7M B;  3FF0 A;  1ROA A;  1TFK A;  3GRD A;  1KC8 4;  1O7P B;  1Y4K A;  3VSE A;  4HM8 B;  2O3O A;  1KSI A;  5JPP A;  1OF5 B;  4EC6 A;  5AII A;  2CFK A;  2ZDJ A;  3LYG A;  1VQO 3;  4LEH A;  1STF I;  2E2U A;  4AEQ A;  3H51 A;  1D6U A;  3B8L A;  4RZM A;  2Q07 A;  4BTW A;  3UL5 A;  3CD6 3;  1RRL A;  1NDO B;  1OHS A;  2W03 A;  1OUN A;  1RN7 A;  1YGE A;  4DMG A;  1EKM A;  1W5Z A;  4L8O A;  2E2V A;  2BMR B;  2E2T A;  4HBR A;  1KD1 4;  3SOY A;  3NV0 B;  3B4P A;  3O8Y A;  1Q40 A;  3NUV A;  3SOA A;  4IIA A;  1OHP A;  1ZE1 A;  2GBW B;  3NQY A;  1Q86 4;  3PCS A;  1TUH A;  2L4V A;  2PZV A;  3K5T A;  3CCV 3;  1U8C B;  1OCV A;  3S5C A;  1IV9 A;  1VQ4 3;  2JDI H;  1ZX2 A;  2W9Q A;  4K61 A;  1BUQ A;  2QIY A;  3KFQ C;  4KFD A;  1FUW A;  5AI1 A;  2RFR A;  2BHM A;  3EE1 A;  2C10 A;  4WHA A;  3CXC 2;  2GXF A;  3FCS B;  5IEP A;  1MOL A;  1TFO A;  3FGY A;  3K7C A;  3T8N A;  2OQE A;  3MHE A;  2WOF A;  4FCZ A;  3UL6 A;  1V74 A;  3HX8 A;  5STD A;  3N8B A;  1SPU A;  1U5O A;  3MG1 A;  4RBN A;  2CFL A;  2MF7 A;  3CPO A;  3G8Z A;  1VQM 3;  2RGQ A;  4H3U A;  2GU1 A;  5ELJ A;  3V99 A;  1R3E A;  3QRD A;  5IER A;  1VQP 3;  4MEI A;  3DGN A;  4IPB A;  3SLU A;  2FNQ A;  4HM0 B;  2XRX B;  1GY6 A;  1IVW A;  1DVC A;  1M1X B;  1GS3 A;  1Q7H A;  1VQK 3;  1JB4 A;  4EXR A;  4FMA A;  2OTJ 3;  5EQL A;  3KZT A;  2W56 A;  3F14 A;  4TX4 A;  2CWT A;  2B1X B;  1JB5 A;  1WNH A;  3FG1 A;  3LH4 A;  1WTH A;  3PXM A;  5AIF A;  2OCT A;  3AMO A;  3U97 A;  1GD3 A;  1IK3 A;  3G6E 3;  1W01 A;  3S29 A;  2D42 A;  5EEO A;  4GL6 A;  1HKX A;  3X3Y A;  1FGO A;  5IG3 A;  2Z7A A;  4EV5 A;  1M90 4;  1IT7 A;  2IMJ A;  1JN5 A;  1N9J A;  1ULJ B;  3BLZ A;  3LTB A;  1EQK A;  1K41 A;  5G2G A;  1A90 A;  1QMA A;  5D81 A;  3LDF A;  1QJG A;  1STD A;  1G96 A;  3FSD A;  1LNH A;  3HII A;  3WA3 A;  4K90 B;  2JQ5 A;  3WDG B;  2WO0 A;  1K8W A;  1DMQ A;  1DVD A;  3ROB A;  1A2V A;  1C7H A;  2GU3 A;  3SVA A;  2W56 B;  1JNQ A;  4ORL A;  5D82 A;  1SII A;  3ER7 A;  3KSE D;  2R4I A;  5AIH A;  4HKV B;  3CCM 3;  3AMO B;  1OF5 A;  4N6O B;  1D6Z A;  4J9A A;  3DXO A;  1DYU A;  4K1U A;  2KXG A;  3V92 A;  3BNE A;  1N5P A;  4L8P A;  4EBG A;  3HK4 A;  1N9E A;  3FG3 A;  5BXQ A;  2P05 A;  1E3R A;  4HM7 B;  3PS8 A;  4MMZ B;  4R4K A;  1K73 4;  3UB1 A;  3VGN A;  1WXW A;  3Q2P A;  3DMC A;  1TIJ A;  1VZZ A;  2CW9 A;  2D1W A;  4JRF A;  5CLK A;  2XF3 A;  1IVX A;  3EF8 A;  4HZB B;  3WA2 X;  5AEW B;  3FLJ A;  3X42 A;  5IG0 A;  1TU5 A;  1QVG 2;  4XB5 A;  1SGV A;  4WYK A;  3NM7 A;  1IV7 A;  1W4N A;  3K63 A;  3MWZ A;  5IG5 A;  2YFI B;  4N6U A;  3PYJ A;  3WMD A;  1ULI B;  2HMO B;  4R9K A;  3S28 A;  1IT8 A;  1W02 A;  5LC6 A;  3A76 A;  4HZ9 B;  2IUJ A;  2BO9 B;  2W2C A;  1VQ7 3;  1D6Y A;  2XFS A;  3G4S 3;  3OWY A;  3G71 3;  3CC4 3;  7STD A;  4HM4 B;  1OGX A;  2XGL A;  3NXJ A;  1ASK A;  3JUO A;  3OWS A;  3OV4 A;  3CNX A;  5IEO A;  1W6Y A;  3DUK A;  5AEU B;  3BNC A;  4GB5 A;  2WGQ A;  4CCV A;  1EA2 A;  2YFJ B;  1IVV A;  4XBX A;  1YIT 3;  4G1M B;  1TP6 A;  1E3V A;  2K54 A;  2XSH B;  2P38 A;  3CCS 3;  3X3X A;  2F98 A;  2XH9 A;  3LT8 A;  1O7W B;  2STD A;  4O2H A;  3DGL A;  4WYK B;  3IJE B;  3VF1 A;  3PCR A;  3NHX A;  4FMB A;  4XBT A;  1ZO2 A;  1JKG B;  3MYT A;  1IVU A;  4KFF A;  5IG4 A;  1YJ9 3;  3NBB A;  4X2O A;  1VQ8 3;  4O3V A;  1CQS A;  5IF6 A;  4WFO A;  2HMJ B;  1VQ6 3;  2GEX A;  2GBX B;  5EVH A;  3LZA A;  1F8N A;  3SXX A;  3IPT A;  2BMO B;  5BVB A;  1EG9 B;  3G16 A;  1WMP A;  3T0U A;  1JJ2 2;  2GEY A;  3I0Y A;  3WOD G;  4R1K A;  1UI8 A;  2Z77 A;  1YI2 3;  8CHO A;  2XGN A;  4K1V A;  2OTL 3;  3WOF B;  3LOY A;  3KKG A;  3I56 3;  3CNM A;  1L5G B;  1W6C A;  1O7G B;  3KSP A;  1KWI A;  5CF1 A;  2F99 A;  2M7O A;  3KE7 A;  3CC7 3;  2CFD A;  1W7C A;  3SED A;  2B24 B;  2WOH A;  2HML B;  3U1W A;  2INX A;  3CCU 3;  2K0M A;  1A67 A;  4AKZ A;  2ZL8 A;  3DY5 A;  4H61 A;  1IU7 A;  3B4O A;  3FZW A;  1YIJ 3;  3LML A;  3EQQ B;  4U13 A;  1J2B A;  1AR0 A;  3DM8 A;  4X2H A;  1FGT A;  2P0X A;  3DGO A;  1UW1 A;  3LXU X;  4NRE A;  1SJW A;  2A15 A;  2F86 B;  1RJO A;  3GZB A;  4O02 B;  1UUV B;  1R3F A;  1ZE2 A;  4MMX B;  3CCQ 3;  4Q1T A;  3UNL A;  2C11 A;  4HM5 B;  3OW2 2;  3FH1 A;  3J7Y d;  4XDV A;  5AYR B;  1FGR A;  2FGT A;  1JB2 A;  2OWP A;  1CYU A;  1Q81 4;  1W2B 2;  1VQ9 3;  4QWT A;  4XM4 A;  3D79 A;  3NX0 A;  3GWR A;  1PU4 A;  2KCD A;  1GY5 A;  1R4C A;  2AS0 A;  1SIH A;  1W00 A;  2IUK A;  1OH0 A;  3EBT A;  3ECF A;  4FCM A;  4N3V A;  2CG1 A;  1O7H B;  3F8H A;  3GZY B;  2W0Q A;  4N6T A;  2CHC A;  3CU3 A;  3RGR A;  3VSY A;  3FG4 A;  3UAI A;  4JF8 A;  2P0M A;  1A2K A;  1IQY A;  2P09 A;  4I4K A;  4O8S A;  4HJL B;  1JRQ A;  3Q90 A;  4KZ1 A;  2BT3 A;  3N9H A;  3JUN A;  1FA3 A;  2AB4 A;  5CK6 A;  3MKI A;  2MC8 A;  3RGA A;  2HMN B;  1OGZ A;  3F9S A;  3H3H A;  3JUQ A;  5KP4 A;  4HVN A;  3GZR A;  5D83 A;  1NB5 I;  2KRT A;  1QAL A;  4Q53 A;  1UUW B;  3OXA A;  5IEN A;  1N8R 4;  1QVF 2;  3M8C A;  1WQL B;  3IMA B;  1YVB I;  3S27 A;  1JKG A;  3JUP A;  3FKA A;  1YJN 3;  1NB3 I;  1AV4 A;  1DMM A;  2J5V A;  2CIU A;  3X41 A;  4OUQ A;  2WGO A;  5DRV A;  5I97 A;  2BMQ B;  2CKF B;  1YJW 3;  2PNC A;  3DGM A;  1WMN A;  1E97 A;  5DRE A;  1W6G A;  2OOV C;  3PGB A;  2CC3 A;  3X40 A;  5CXO A;  1RKY A;  4HM1 B;  1O7N B;  5LC7 A;  2Y74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...