1T5YA

Crystal structure of northeast structural genomics consortium target hr2118: a human homolog of saccharomyces cerevisiae nip7p
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
170
structure length
170
Chain Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Northeast Structural Genomics Consortium Target HR2118: A Human Homolog of Saccharomyces cerevisiae Nip7p
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords SACCHAROMYCES CEREVISIAE Nip7p HOMOLOG
total genus 43
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03657 UPF0113 UPF0113 PUA domain
A PF17833 UPF0113_N UPF0113 Pre-PUA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.10 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 PUA domain 1t5yA02
3.10.450.220 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1t5yA01
3LDFA 1SQWA 2B78A 1R3FA 1K8WA 1ZL3A 3UAIA 2Q07A 1SGVA 4DMGA 1WXWA 1ZE2A 1IT8A 3D79A 1IQ8A 2AS0A 1IT7A 1WXXA 2AB4A 1ZS7A 1J2BA 2J5TA 2J5VA 2CWWA 3C0KA 4Q1TA 1R3EA 1ZE1A 2CX1A 3VSEA 2CX0A 1T5YA 1Q7HA 2P38A
chains in the Genus database with same CATH superfamily
3U28A 4OUQA 1I8VA 2XFSA 1SQWA 2WGQA 1B2SA 3GZBA 2B78A 3DGOA 2P0XA 3KSPA 4EBGA 1CYVA 4K61A 1N9JA 3K63A 5FGOA 1O7HB 3CCU3 3CCL3 3KZTA 3F8XA 2KAAA 2BT3A 4IT7A 3NQYA 3B8LA 4HM3B 3SXXA 1FYSA 2HVYA 3CCQ3 3BB9A 4GHOA 3N8BA 1FW7A 3G713 2H0HA 2KF5A 1K9M4 3GZRA 1ASKA 3WMDA 1GMPA 1LOYA 1VQ73 2SBLA 3IPTA 1FA3A 3LH4A 1RGKA 4JRFA 4Q1TA 4HM5B 3VGNA 4HJLB 4EV2A 5IEOA 3WODG 2F5WA 2JDIH 2LQVA 1OGXA 3FLJA 3K9MC 4WHAA 1BNRA 3LWPA 3ROBA 3J7Yd 2OCTA 2F4YA 3MQKA 1BVIA 2CWUA 3PXMA 3D9RA 2CFWA 4HM0B 4HM4B 4FMDA 3HJWA 2GXFA 3DY5A 4IIAA 3RGAA 5I97A 3PZWA 5TGNA 4CPKA 2L4VA 2GBWB 4XM4A 1M1XB 1BRIA 1RMSA 4QWTA 2EY4A 2CH9A 5IW9A 5G1KA 2F5MA 3NV0A 1OGZA 2XEPA 1OHSA 2F98A 2BMOB 4R9LA 1ZX2A 1BNSA 1ZE1A 1D6YA 3D4AA 4HM2B 3B7CA 1BIRA 5IG5A 4R80A 3DUKA 1O7GB 1C54A 1N5HA 2UX0A 2KF3A 3DM8A 3EBTA 1RNTA 2A15A 4RNZA 1T3BA 2ML5A 5ELUA 2BMRB 4HM8B 4BL2A 2R41A 2W56A 3ZFZA 5FW5A 1R4CA 4ZM8A 3CD63 2QEX3 1UW1A 1RKYA 1VQN3 2E2VA 4R9KA 1SARA 4RBNA 1E97A 3K7CA 5AIFA 1B2ZA 1TRPA 2Z77A 1OF5A 3FCSB 1LRAA 1O7WB 4G1MB 2INXA 1UGIA 1RGAA 1RRLA 1W6YA 2H0IA 2W9PA 5D83A 1QAKA 1LVNA 1N9EA 2UGIA 1NU3A 2CG1A 2KF6A 1LXEA 3G8ZA 3HJYA 1UI7A 1VQK3 1BAOA 1B2UA 8RNTA 3ALAA 3FZWA 1STFI 3LOYA 1BSBA 2ML6A 1TIJA 1BNIA 1RRHA 2XGLA 3F7SA 2CWTA 3JUOA 4L8PA 5BVBA 3S5CA 2LYXA 3WDGB 4RZMA 2WOHA 4HBRA 1FUTA 1OCVA 1BRHA 1JRQA 4AKZA 2GEXA 1VQ93 2MC8A 2D42A 1HZ1A 2CFDA 1N5PA 1ZO2A 1QJGA 1YIT3 1YIJ3 1T2IA 1UI8A 3DGLA 2J5TA 3EN1B 3K0ZA 4K1UA 2KF4A 5AIGA 3FH1A 1O7PB 1BRKA 4N6TA 1BANA 4HYZA 4R4KA 4WWUC 2CFKA 5M19A 1VQ63 1ULIB 2KKUA 3GZXB 1CH0A 1B21A 1T5YA 3LJCA 2KCDA 1RGHA 4HM6B 3M8CA 4HVNA 2ZA4A 1D6ZA 2GEYA 3S27A 3DMCA 1A67A 1YVSA 3DXOA 3EJVA 1V74A 1YNVX 1US1A 2KXGA 1VQ43 3U1WA 1I3FA 3H51A 6RNTA 2W03A 3CCR3 3CCV3 1KQS2 4BTYA 5IG4A 1JN5B 3OXAA 1AVLA 4WFOA 4CCVA 5IEPA 1BU4A 1ISKA 1DETA 3BIRA 1M904 3SOYA 2Z7AA 4HZ9B 3A5EA 2Z76A 3RNTA 3FG3A 3KCHA 1W01A 1G02A 1IYYA 2CWWA 1TFKA 1WQLB 3H3HA 4HM7B 2FNQA 3V98A 1WK2A 1Y4KA 4R1KA 1LOVA 3S29A 3I563 3T0UA 1JBSA 3QRDA 1EG9B 1GY6A 1IVUA 5AYRB 1S723 4CI3B 1K8WA 3X41A 1Z1SA 3CCM3 3HAXA 2W6JH 2CHCA 4Q53A 1V58A 1GMQA 3CCS3 2CK3H 2STDA 3KE7A 1Q814 1RGFA 1EEJA 1RN4A 2IUKA 1RNBA 1JKGB 1BNJA 5BXQA 1BSEA 1RGEA 2W9QA 5D81A 1PFPA 1UCLA 5DRVA 3HIIA 3CXC2 3LZAA 3SX1A 1E3RA 1YHQ3 2CKFB 4DKIA 1VQ83 7RNTA 4MMZB 2C10A 1ROVA 3MG3A 2CC3A 1S04A 3LWVA 1K41A 5CF1A 1FGTA 4K90B 3G6E3 1VQP3 1CYUA 2R4IA 4L8OA 3CU3A 2GBXB 1Q7Y4 4HOHA 3T8UA 2XSOB 1MGWA 3URPA 8CHOA 1YGWA 1IT7A 1MNLA 2CWVA 4XBYA 3AGNA 5CLKA 4BIRA 1Q42A 3KN4A 1OUNA 1GOVA 4EV5A 2CG0A 1VQO3 4LZIA 3WA3A 1MWUA 2K0MA 1NWWA 3PGBA 4TZ4C 4LMIA 4OVMA 2OWPA 5STDA 4EXRA 5BU4A 1WNHA 1IQXA 2F56A 2HMLB 3FKAA 1JV2B 2HOHA 4XBXA 4ILFA 1VQ53 1QMAA 3G0KA 2W2CA 1TRQA 4N6NB 1RCLA 4H61A 3VF1A 1VQM3 2P09A 4BU4A 1KSIA 1UDII 2ZL8A 1UGHI 1LNHA 1Q40B 2AADA 2IYJA 2XRXB 2UUGC 4FMBA 3SVAA 6STDA 4FMAA 3UL6A 4DMGA 5M1AA 1EA2A 1WTHA 3F8HA 5EVHA 2GU3A 4CJNA 3X3ZA 1MGRA 3WHOA 1AVKA 4LYLB 3LMLA 4AEQA 1GYBA 3HIGA 1LQMB 3CPOA 3KSED 3PCSA 2L1SA 2RBIA 4MEIA 1RSNA 2IUJA 3LT8A 3WOFB 1B2XA 3IUWA 2P0MA 3DGMA 5KP4A 3TDGA 3SOAA 7STDA 1CQSA 1NB3I 1DMQA 2RCDA 1A2PA 4AKYA 5G2GA 1GSPA 3MG1A 4FCMA 4K1VA 4NHFA 3L0RA 2AAEA 1IVVA 2E5OA 1VQL3 3PCRA 3M4XA 1IK3A 2H0GA 3ZG5A 2YFJB 2XF3A 1EUIC 1W00A 4N6MA 3CC23 3NX0A 1ZL3A 1D6UA 3B4PA 4O3VA 2RFRA 4X2HA 1OHOA 3KIIA 2AS0A 1AR0A 1N8QA 1YVBI 1UCJA 3F9SA 4WYKB 1I2EA 1BUQA 1FUSA 3D3LA 1FGOA 2RGQA 4GSPA 3M6WA 3AMOA 2Z0TA 2BU4A 4KFDA 4RNTA 4KZ1A 1I0VA 3BU4A 4IPBA 4XBTA 1FGRA 3GRDA 3UL5A 3CPW2 2QA43 5IERA 1U8CB 3VSEA 2ANEA 1WMPA 1XNEA 2M7OA 4HKVB 2O3OA 2CX0A 1BRGA 3NXJA 1JJ22 2Z6BA 4XDVA 1SIHA 4BTWA 4CDLA 3OW22 2K54A 4CI2B 1O7MB 3LDFA 1DVCA 1BSDA 1B27A 3N9HA 4J5KA 1X1UA 3GSPA 4CI1B 2XR8B 4GB5A 1TU5A 3CCJ3 3ZV0C 2B1XB 3CMA3 2HMOB 3D79A 3F14A 3IMAB 2BIRA 3LTCA 1STDA 3M6UA 4XDWA 1T2HA 1U5OA 3Q1CA 4J5GA 2P05A 1G96A 2HMJB 1L5GB 1RHLA 1FZUA 5JPPA 3V92A 3IJEB 2J5VA 2XGNA 3CNMA 5IG0A 1SPUA 3BNCA 4N6UA 1PU4A 1I2GA 4LEHA 1IVWA 1BOXA 1JBTA 1BNEA 1X1WA 3AHSA 4FCJA 3JUPA 3SYUA 2QIYA 2I9WA 1YJW3 1W2B2 2BMQB 4HAAA 2F99A 3UNLA 3LTAA 3OWUA 4X2OA 2D1WA 1A2KA 3NBJA 1JZDA 1GD3A 1W6CA 1W02A 3EBYA 2HMNB 3EF8A 1SGVA 1UUVB 1R4YA 3OX9A 4N3VA 3NBRA 4NPBA 1IT8A 2JQ5A 2FRXA 1I70A 1A2VA 1Q40A 2WO0A 4FMCA 3JUQA 1X1YA 1VZZA 4MJDA 4RNYA 1E3VA 3O8YA 2OQEC 4EW5A 1NNVA 1YJN3 4I5QA 5M18A 2PNCA 4O02B 1BSCA 3MKIA 3S67A 3VSYA 2HMMB 2WGOA 3D5GA 3LWOA 2O9UX 5JPUA 3OV4A 2FXTA 3HZPA 3MWZA 1IV9A 3BLZA 1R3EA 1FGMA 1KWIA 5G1LA 2V1LA 3NM7A 3UB1A 1NB5I 1W6GA 2BNGA 3GAXA 3HX8A 1RGLA 1Q7HA 1TP6A 3DGYA 1ZGXA 3MPHA 4O8SA 3X40A 1UUGB 3ECFA 3NM2A 4J8TA 4WP5A 3I0YA 3FG4A 5CF2A 1TTOA 1R3FA 1MWTA 3LTDA 4OK0A 1IV7A 1DYUA 3DZLA 3EQQB 1OACA 5ELJA 1QALA 3Q3FA 1ZE2A 2RSXA 4N6OB 3V99A 4EC6A 7GSPA 5HGRA 2GSPA 1V57A 1IQ8A 2E2TA 1JB2A 3AMOB 3BNBA 1B2MA 1EQKA 1K8A4 1FUWA 3UJMA 4FCZA 4WYKA 3E99A 4STDA 3U97A 1J2BA 3STDA 5IENA 1ZBOA 1S5AA 1CEWI 2OQEA 3SEDA 1KC84 1KD14 5IF6A 1QAFA 3B4OA 5DREA 1TFOA 1BSAA 4LSOA 1BRJA 1X1XA 2KRTA 3T8NA 9RNTA 1PYLA 2ZHXB 2APOA 3BNEA 3DGNA 5AIHA 1QVG2 3LTBA 1JKGA 4H3UA 5AYSC 3F7XA 1M9GA 3EB8A 3EX9A 4N6LA 4O2HA 3QK9A 2XH9A 1PY3A 1RGCA 3WA2X 3LYGA 1YJ93 3X3YA 3LXUX 4TX4A 1A90A 1VQQA 3RGRA 4KFFA 1LOWA 5AI1A 2BHMA 1WXWA 3FF0A 1FGQA 1EKMA 5KP1A 1UOYA 5IG3A 2CIUA 3KKGA 2BO9B 1HKXA 2PZVA 3EE1A 2K3DA 1F8NA 5AIIA 2OOVA 1BRNL 2OOVC 5JBSA 1ULJB 2AB4A 1RN7A 1IDPA 1UUWB 1OHPA 1GOUA 3A76A 3FSDA 1OPYA 1B3SA 3G4S3 1RJOA 4HZBB 5EQLA 1RLSA 2F86B 4MMXB 3LWRA 1GOYA 3LWQA 3HI7A 1HYFA 1BGSA 2YFLB 5D82A 3CME3 1BNGA 1TUHA 1WMOA 1LQGC 1AV4A 1YGEA 1W7CA 3AHWA 1M1K4 2QGUA 3CC73 3NUVA 3N54B 2OTJ3 3M6VA 5RNTA 3EC9A 1DMNA 2C11A 3GZYB 4NREA 5AEWB 3PYJA 1G0TA 3CCE3 1Q9EA 4GL6A 3Q90A 5HOHA 2Q07A 5GSPA 1JNQA 1NJI4 1TE7A 1O7NB 1BNFA 3BNDA 3DH2A 3WOEB 5KP3A 1YI23 1WXXA 2GU1A 1Q864 5CK6A 1Q824 2AUSA 3X42A 1GMRA 4KT3B 1ZS7A 1IQYA 1HU9A 1SIIA 1UCIA 1BRSA 2Y73A 1MWSA 3JUNA 4N6V0 1DMMA 1RDSA 2YFIB 3C0KA 1JZOA 4XB5A 4KFEA 3PS8A 2MF7A 2C4BA 2W0QA 1GS3A 3JUMA 3SLUA 3CC43 1AY7A 4JF8A 3NQZA 4HM1B 4EYCA 2CFLA 1NO3A 4PEJA 1MOLA 3M6XA 2HMKB 2SARA 2B24B 3D5IA 3GWRA 2CW9A 3NBBA 4FR9A 1I2FA 1C7HA 3I553 1JB4A 4LGQA 1K28A 3Q2PA 1WMNA 4U13A 1MWRA 1W4NA 1AQZA 4BL3A 3AGOA 1IU7A 1I3IA 3HK4A 3ZG0A 1W2ZA 2ZDJA 2J8XB 5CXOA 3OWYA 1ROAA 2IA7A 1LNIA 3MSOA 2W04A 5AEUB 3ER7A 3LT9A 3HOHA 1GY7A 2CX1A 4MMYB 3M65A 3FF2A 2DP9A 3MHEA 1K734 4KVHA 1OF5B 1RN1A 3EHCA 3EN8A 1GD4A 1DE3A 6GSPA 2WOFA 2P38A 4I4KA 2Y74A 1IVXA 2OTL3 2IY2A 2W56B 3FGYA 1NDOB 3KFQC 1LOXA 3JVCA 2XSHB 4BTXA 3UAIA 3FG1A 1DVDA 1BUJA 5LC7A 5A0OB 3X3XA 2XFTA 2IMJA 1OH0A 3MYTA 1JBRA 1RCKA 1RTUA 5LC6A 1N8R4 1W5ZA 3K5TA 3RDEA 3OWSA 2FGTA 2RFKA 1TJDA 1JB5A 1JN5A 4L7KA 3S28A 1QVF2 1GY5A 2CFGA 2RNTA 3F40A 3NHXA 5EEOA 3MG2A 3CNXA 2E2UA 5BIRA 1RGGA 3G16A 2YX9A 3NV0B 1B20A 4J9AA 4ORLA 3WR2A 1UCKA 1I0XA 1SJWA
chains in the Genus database with same CATH topology
4OUQA 1YJ93 2XFSA 1SQWA 2WGQA 3GZBA 3KSPA 2B78A 3DGOA 2P0XA 4EBGA 1CYVA 4K61A 1N9JA 3K63A 5FGOA 1O7HB 3CCU3 3CCL3 3KZTA 3F8XA 4IT7A 2BT3A 3NQYA 3B8LA 4HM3B 3SXXA 3CCQ3 3BB9A 3N8BA 3G713 1K9M4 3GZRA 1ASKA 3WMDA 1VQ73 2SBLA 3IPTA 1FA3A 3LH4A 4JRFA 4Q1TA 4HM5B 3VGNA 4HJLB 4EV2A 5IEOA 3WODG 2JDIH 2LQVA 1OGXA 3FLJA 3K9MC 4WHAA 3ROBA 3J7Yd 2OCTA 2CWUA 3PXMA 3D9RA 2CFWA 4HM0B 4HM4B 4FMDA 2GXFA 3DY5A 4IIAA 3RGAA 5I97A 3PZWA 5TGNA 2L4VA 2GBWB 4XM4A 1M1XB 4QWTA 2CH9A 5IW9A 3NV0A 1OGZA 2XEPA 1OHSA 2F98A 2BMOB 4R9LA 1ZX2A 1ZE1A 1D6YA 4HM2B 3B7CA 5IG5A 4R80A 3DUKA 1O7GB 1N5HA 2UX0A 3DM8A 3EBTA 2A15A 4RNZA 2ML5A 5ELUA 2BMRB 4HM8B 2W56A 5FW5A 1R4CA 4ZM8A 3CD63 2QEX3 1UW1A 1RKYA 1VQN3 2E2VA 4R9KA 4RBNA 1E97A 3K7CA 5AIFA 2Z77A 1OF5A 3FCSB 1O7WB 4G1MB 2INXA 1W6YA 2W9PA 1RRLA 5D83A 1QAKA 1LVNA 1N9EA 1NU3A 2CG1A 1LXEA 3G8ZA 1UI7A 1VQK3 3ALAA 3FZWA 1STFI 3LOYA 2ML6A 1TIJA 2XGLA 1RRHA 3F7SA 3JUOA 2CWTA 4L8PA 5BVBA 3S5CA 2LYXA 3WDGB 4RZMA 2WOHA 4HBRA 1OCVA 1JRQA 4AKZA 2GEXA 1VQ93 2MC8A 2D42A 2CFDA 1N5PA 1ZO2A 1QJGA 1YIT3 1YIJ3 1UI8A 3DGLA 2J5TA 3EN1B 3K0ZA 4K1UA 5AIGA 3FH1A 1O7PB 4N6TA 4R4KA 4HYZA 4WWUC 2CFKA 1VQ63 1ULIB 3GZXB 1T5YA 2KCDA 4HM6B 3M8CA 4HVNA 1D6ZA 2GEYA 3S27A 3DMCA 1A67A 3EJVA 3DXOA 1V74A 1US1A 2KXGA 1VQ43 3U1WA 3H51A 2W03A 3CCR3 3CCV3 1KQS2 4BTYA 5IG4A 1JN5B 3OXAA 1AVLA 4WFOA 4CCVA 5IEPA 1ISKA 1M904 3SOYA 2Z7AA 4HZ9B 2Z76A 3FG3A 1W01A 2CWWA 1TFKA 1WQLB 3H3HA 4HM7B 2FNQA 3V98A 4R1KA 1Y4KA 3S29A 3I563 3T0UA 3QRDA 1EG9B 1GY6A 1IVUA 5AYRB 1S723 1K8WA 3X41A 1Z1SA 3CCM3 2W6JH 2CHCA 4Q53A 3CCS3 2CK3H 2STDA 3KE7A 1Q814 2IUKA 1JKGB 5BXQA 2W9QA 5D81A 1PFPA 3CXC2 5DRVA 3HIIA 3LZAA 3SX1A 1E3RA 1YHQ3 2CKFB 1VQ83 4MMZB 2C10A 1ROVA 3MG3A 2CC3A 1K41A 5CF1A 1FGTA 4K90B 3G6E3 1VQP3 1CYUA 2R4IA 4L8OA 3CU3A 2GBXB 1Q7Y4 3T8UA 2XSOB 8CHOA 1IT7A 1MNLA 2CWVA 4XBYA 5CLKA 1Q42A 3KN4A 1OUNA 4EV5A 2CG0A 1VQO3 4LZIA 3WA3A 5STDA 2K0MA 1NWWA 3PGBA 4LMIA 4OVMA 4EXRA 2OWPA 1EQKA 1WNHA 1IQXA 2HMLB 3FKAA 1JV2B 4XBXA 1VQ53 1QMAA 3G0KA 2W2CA 4N6NB 3VF1A 4H61A 1VQM3 2P09A 1KSIA 2ZL8A 4FMBA 1LNHA 1VQL3 1Q40B 2XRXB 6STDA 3SVAA 4FMAA 3UL6A 4DMGA 1EA2A 1WTHA 3F8HA 5EVHA 2GU3A 3X3ZA 1AVKA 3LMLA 4AEQA 1GYBA 3HIGA 3CPOA 3KSED 3PCSA 4MEIA 2IUJA 3LT8A 3WOFB 3DGMA 5KP4A 2P0MA 3TDGA 3SOAA 7STDA 1CQSA 1NB3I 1DMQA 2RCDA 4AKYA 5G2GA 3MG1A 4FCMA 4K1VA 4NHFA 3L0RA 1IVVA 3PCRA 1IK3A 2YFJB 2XF3A 1W00A 4N6MA 3CC23 3NX0A 1ZL3A 1D6UA 3B4PA 4O3VA 2RFRA 4X2HA 1OHOA 3KIIA 2AS0A 1AR0A 1N8QA 1YVBI 3F9SA 4WYKB 1BUQA 3D3LA 1FGOA 2RGQA 3AMOA 4KFDA 4KZ1A 4XBTA 4IPBA 3UL5A 1FGRA 3GRDA 3CPW2 2QA43 5IERA 1U8CB 3VSEA 1WMPA 2M7OA 4HKVB 2O3OA 2CX0A 3NXJA 1JJ22 2Z6BA 4XDVA 1SIHA 4BTWA 4CDLA 3OW22 2K54A 1O7MB 3LDFA 1DVCA 3N9HA 3CCJ3 2XR8B 4GB5A 1TU5A 2B1XB 3CMA3 2HMOB 3D79A 3F14A 3IMAB 3LTCA 1STDA 4XDWA 1U5OA 3Q1CA 2P05A 1G96A 2HMJB 1L5GB 5JPPA 3V92A 3IJEB 2J5VA 2XGNA 3CNMA 5IG0A 1SPUA 3BNCA 4N6UA 1PU4A 4LEHA 1IVWA 4FCJA 3JUPA 1YJW3 2QIYA 2I9WA 1W2B2 2BMQB 2F99A 3UNLA 3LTAA 3OWUA 4X2OA 2D1WA 1A2KA 3NBJA 1W6CA 1GD3A 3OX9A 1W02A 3EBYA 2HMNB 3EF8A 1SGVA 1UUVB 4N3VA 3NBRA 1IT8A 2JQ5A 1Q40A 1A2VA 2WO0A 4FMCA 1YJN3 3JUQA 4MJDA 1VZZA 4RNYA 1E3VA 3O8YA 2OQEC 2PNCA 4O02B 3MKIA 3S67A 3VSYA 2HMMB 2WGOA 2O9UX 5JPUA 3OV4A 2FXTA 3HZPA 3MWZA 3BLZA 1IV9A 1R3EA 1FGMA 1KWIA 2V1LA 3NM7A 3UB1A 1NB5I 1W6GA 2BNGA 3GAXA 3HX8A 1Q7HA 1TP6A 3MPHA 4O8SA 3X40A 3NM2A 3ECFA 4J8TA 4WP5A 3I0YA 3FG4A 5CF2A 1R3FA 3LTDA 4OK0A 1IV7A 1DYUA 3DZLA 3EQQB 1OACA 5ELJA 1QALA 1ZE2A 2RSXA 4N6OB 3V99A 4EC6A 5HGRA 1IQ8A 2E2TA 3BNBA 1JB2A 3AMOB 1K8A4 1FUWA 3UJMA 4FCZA 4WYKA 3E99A 4STDA 3U97A 1J2BA 3STDA 5IENA 1KD14 1S5AA 1CEWI 2OQEA 3SEDA 1KC84 5IF6A 1QAFA 3B4OA 5DREA 1TFOA 4LSOA 2KRTA 3T8NA 5AIHA 3BNEA 3DGNA 1QVG2 3LTBA 1JKGA 4H3UA 5AYSC 3F7XA 1M9GA 3EB8A 3EX9A 4N6LA 4O2HA 3QK9A 2XH9A 3WA2X 3LYGA 3X3YA 3LXUX 4TX4A 1A90A 3RGRA 4KFFA 5AI1A 2BHMA 1WXWA 3FF0A 1FGQA 1EKMA 5KP1A 5IG3A 2CIUA 3KKGA 2BO9B 1HKXA 2PZVA 3EE1A 5AIIA 1F8NA 2OOVA 2OOVC 5JBSA 1ULJB 2AB4A 1RN7A 1IDPA 1UUWB 1OHPA 3A76A 3FSDA 3G4S3 1OPYA 1RJOA 4HZBB 5EQLA 2F86B 4MMXB 3HI7A 2YFLB 3CME3 5D82A 1TUHA 1WMOA 1AV4A 1YGEA 1W7CA 1M1K4 2OTJ3 2QGUA 3CC73 3NUVA 3N54B 3EC9A 1DMNA 2C11A 3GZYB 4NREA 5AEWB 3PYJA 3CCE3 4GL6A 3Q90A 2Q07A 1JNQA 1NJI4 1O7NB 3BNDA 3WOEB 5KP3A 1YI23 1WXXA 2GU1A 1Q864 5CK6A 1Q824 3X42A 1ZS7A 1IQYA 1HU9A 1SIIA 2Y73A 3JUNA 4N6V0 1DMMA 2YFIB 3C0KA 4XB5A 4KFEA 3PS8A 2MF7A 2W0QA 1GS3A 3JUMA 3SLUA 3CC43 4JF8A 3NQZA 4HM1B 4EYCA 2CFLA 1NO3A 4PEJA 1MOLA 2HMKB 3NBBA 2B24B 3GWRA 4FR9A 2CW9A 1C7HA 3I553 1JB4A 4LGQA 1K28A 3Q2PA 1WMNA 4U13A 1W4NA 1IU7A 3HK4A 1W2ZA 2ZDJA 5CXOA 3OWYA 1ROAA 2IA7A 3MSOA 2W04A 5AEUB 3ER7A 3LT9A 1GY7A 2CX1A 4MMYB 3FF2A 3MHEA 1K734 4KVHA 1OF5B 3EHCA 3EN8A 1GD4A 2WOFA 2P38A 4I4KA 2Y74A 1IVXA 2OTL3 2W56B 3FGYA 1NDOB 3KFQC 1LOXA 3JVCA 2XSHB 4BTXA 3UAIA 3FG1A 1DVDA 5LC7A 5A0OB 3X3XA 2XFTA 2IMJA 1OH0A 3MYTA 5LC6A 1N8R4 1W5ZA 3K5TA 3RDEA 3OWSA 2FGTA 1JB5A 1JN5A 4L7KA 3S28A 1QVF2 1GY5A 2CFGA 3F40A 3NHXA 5EEOA 3MG2A 3CNXA 2E2UA 3G16A 2YX9A 3NV0B 4J9AA 4ORLA 1SJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDF A;  1SQW A;  2B78 A;  1R3F A;  1K8W A;  1ZL3 A;  3UAI A;  2Q07 A;  1SGV A;  4DMG A;  1WXW A;  1ZE2 A;  1IT8 A;  3D79 A;  1IQ8 A;  2AS0 A;  1IT7 A;  1WXX A;  2AB4 A;  1ZS7 A;  1J2B A;  2J5T A;  2J5V A;  2CWW A;  3C0K A;  4Q1T A;  1R3E A;  1ZE1 A;  2CX1 A;  3VSE A;  2CX0 A;  1T5Y A;  1Q7H A;  2P38 A; 
#chains in the Genus database with same CATH topology
 3U28 A;  4OUQ A;  1I8V A;  2XFS A;  1SQW A;  2WGQ A;  1B2S A;  3GZB A;  2B78 A;  3DGO A;  2P0X A;  3KSP A;  4EBG A;  1CYV A;  4K61 A;  1N9J A;  3K63 A;  5FGO A;  1O7H B;  3CCU 3;  3CCL 3;  3KZT A;  3F8X A;  2KAA A;  2BT3 A;  4IT7 A;  3NQY A;  3B8L A;  4HM3 B;  3SXX A;  1FYS A;  2HVY A;  3CCQ 3;  3BB9 A;  4GHO A;  3N8B A;  1FW7 A;  3G71 3;  2H0H A;  2KF5 A;  1K9M 4;  3GZR A;  1ASK A;  3WMD A;  1GMP A;  1LOY A;  1VQ7 3;  2SBL A;  3IPT A;  1FA3 A;  3LH4 A;  1RGK A;  4JRF A;  4Q1T A;  4HM5 B;  3VGN A;  4HJL B;  4EV2 A;  5IEO A;  3WOD G;  2F5W A;  2JDI H;  2LQV A;  1OGX A;  3FLJ A;  3K9M C;  4WHA A;  1BNR A;  3LWP A;  3ROB A;  3J7Y d;  2OCT A;  2F4Y A;  3MQK A;  1BVI A;  2CWU A;  3PXM A;  3D9R A;  2CFW A;  4HM0 B;  4HM4 B;  4FMD A;  3HJW A;  2GXF A;  3DY5 A;  4IIA A;  3RGA A;  5I97 A;  3PZW A;  5TGN A;  4CPK A;  2L4V A;  2GBW B;  4XM4 A;  1M1X B;  1BRI A;  1RMS A;  4QWT A;  2EY4 A;  2CH9 A;  5IW9 A;  5G1K A;  2F5M A;  3NV0 A;  1OGZ A;  2XEP A;  1OHS A;  2F98 A;  2BMO B;  4R9L A;  1ZX2 A;  1BNS A;  1ZE1 A;  1D6Y A;  3D4A A;  4HM2 B;  3B7C A;  1BIR A;  5IG5 A;  4R80 A;  3DUK A;  1O7G B;  1C54 A;  1N5H A;  2UX0 A;  2KF3 A;  3DM8 A;  3EBT A;  1RNT A;  2A15 A;  4RNZ A;  1T3B A;  2ML5 A;  5ELU A;  2BMR B;  4HM8 B;  4BL2 A;  2R41 A;  2W56 A;  3ZFZ A;  5FW5 A;  1R4C A;  4ZM8 A;  3CD6 3;  2QEX 3;  1UW1 A;  1RKY A;  1VQN 3;  2E2V A;  4R9K A;  1SAR A;  4RBN A;  1E97 A;  3K7C A;  5AIF A;  1B2Z A;  1TRP A;  2Z77 A;  1OF5 A;  3FCS B;  1LRA A;  1O7W B;  4G1M B;  2INX A;  1UGI A;  1RGA A;  1RRL A;  1W6Y A;  2H0I A;  2W9P A;  5D83 A;  1QAK A;  1LVN A;  1N9E A;  2UGI A;  1NU3 A;  2CG1 A;  2KF6 A;  1LXE A;  3G8Z A;  3HJY A;  1UI7 A;  1VQK 3;  1BAO A;  1B2U A;  8RNT A;  3ALA A;  3FZW A;  1STF I;  3LOY A;  1BSB A;  2ML6 A;  1TIJ A;  1BNI A;  1RRH A;  2XGL A;  3F7S A;  2CWT A;  3JUO A;  4L8P A;  5BVB A;  3S5C A;  2LYX A;  3WDG B;  4RZM A;  2WOH A;  4HBR A;  1FUT A;  1OCV A;  1BRH A;  1JRQ A;  4AKZ A;  2GEX A;  1VQ9 3;  2MC8 A;  2D42 A;  1HZ1 A;  2CFD A;  1N5P A;  1ZO2 A;  1QJG A;  1YIT 3;  1YIJ 3;  1T2I A;  1UI8 A;  3DGL A;  2J5T A;  3EN1 B;  3K0Z A;  4K1U A;  2KF4 A;  5AIG A;  3FH1 A;  1O7P B;  1BRK A;  4N6T A;  1BAN A;  4HYZ A;  4R4K A;  4WWU C;  2CFK A;  5M19 A;  1VQ6 3;  1ULI B;  2KKU A;  3GZX B;  1CH0 A;  1B21 A;  1T5Y A;  3LJC A;  2KCD A;  1RGH A;  4HM6 B;  3M8C A;  4HVN A;  2ZA4 A;  1D6Z A;  2GEY A;  3S27 A;  3DMC A;  1A67 A;  1YVS A;  3DXO A;  3EJV A;  1V74 A;  1YNV X;  1US1 A;  2KXG A;  1VQ4 3;  3U1W A;  1I3F A;  3H51 A;  6RNT A;  2W03 A;  3CCR 3;  3CCV 3;  1KQS 2;  4BTY A;  5IG4 A;  1JN5 B;  3OXA A;  1AVL A;  4WFO A;  4CCV A;  5IEP A;  1BU4 A;  1ISK A;  1DET A;  3BIR A;  1M90 4;  3SOY A;  2Z7A A;  4HZ9 B;  3A5E A;  2Z76 A;  3RNT A;  3FG3 A;  3KCH A;  1W01 A;  1G02 A;  1IYY A;  2CWW A;  1TFK A;  1WQL B;  3H3H A;  4HM7 B;  2FNQ A;  3V98 A;  1WK2 A;  1Y4K A;  4R1K A;  1LOV A;  3S29 A;  3I56 3;  3T0U A;  1JBS A;  3QRD A;  1EG9 B;  1GY6 A;  1IVU A;  5AYR B;  1S72 3;  4CI3 B;  1K8W A;  3X41 A;  1Z1S A;  3CCM 3;  3HAX A;  2W6J H;  2CHC A;  4Q53 A;  1V58 A;  1GMQ A;  3CCS 3;  2CK3 H;  2STD A;  3KE7 A;  1Q81 4;  1RGF A;  1EEJ A;  1RN4 A;  2IUK A;  1RNB A;  1JKG B;  1BNJ A;  5BXQ A;  1BSE A;  1RGE A;  2W9Q A;  5D81 A;  1PFP A;  1UCL A;  5DRV A;  3HII A;  3CXC 2;  3LZA A;  3SX1 A;  1E3R A;  1YHQ 3;  2CKF B;  4DKI A;  1VQ8 3;  7RNT A;  4MMZ B;  2C10 A;  1ROV A;  3MG3 A;  2CC3 A;  1S04 A;  3LWV A;  1K41 A;  5CF1 A;  1FGT A;  4K90 B;  3G6E 3;  1VQP 3;  1CYU A;  2R4I A;  4L8O A;  3CU3 A;  2GBX B;  1Q7Y 4;  4HOH A;  3T8U A;  2XSO B;  1MGW A;  3URP A;  8CHO A;  1YGW A;  1IT7 A;  1MNL A;  2CWV A;  4XBY A;  3AGN A;  5CLK A;  4BIR A;  1Q42 A;  3KN4 A;  1OUN A;  1GOV A;  4EV5 A;  2CG0 A;  1VQO 3;  4LZI A;  3WA3 A;  1MWU A;  2K0M A;  1NWW A;  3PGB A;  4TZ4 C;  4LMI A;  4OVM A;  2OWP A;  5STD A;  4EXR A;  5BU4 A;  1WNH A;  1IQX A;  2F56 A;  2HML B;  3FKA A;  1JV2 B;  2HOH A;  4XBX A;  4ILF A;  1VQ5 3;  1QMA A;  3G0K A;  2W2C A;  1TRQ A;  4N6N B;  1RCL A;  4H61 A;  3VF1 A;  1VQM 3;  2P09 A;  4BU4 A;  1KSI A;  1UDI I;  2ZL8 A;  1UGH I;  1LNH A;  1Q40 B;  2AAD A;  2IYJ A;  2XRX B;  2UUG C;  4FMB A;  3SVA A;  6STD A;  4FMA A;  3UL6 A;  4DMG A;  5M1A A;  1EA2 A;  1WTH A;  3F8H A;  5EVH A;  2GU3 A;  4CJN A;  3X3Z A;  1MGR A;  3WHO A;  1AVK A;  4LYL B;  3LML A;  4AEQ A;  1GYB A;  3HIG A;  1LQM B;  3CPO A;  3KSE D;  3PCS A;  2L1S A;  2RBI A;  4MEI A;  1RSN A;  2IUJ A;  3LT8 A;  3WOF B;  1B2X A;  3IUW A;  2P0M A;  3DGM A;  5KP4 A;  3TDG A;  3SOA A;  7STD A;  1CQS A;  1NB3 I;  1DMQ A;  2RCD A;  1A2P A;  4AKY A;  5G2G A;  1GSP A;  3MG1 A;  4FCM A;  4K1V A;  4NHF A;  3L0R A;  2AAE A;  1IVV A;  2E5O A;  1VQL 3;  3PCR A;  3M4X A;  1IK3 A;  2H0G A;  3ZG5 A;  2YFJ B;  2XF3 A;  1EUI C;  1W00 A;  4N6M A;  3CC2 3;  3NX0 A;  1ZL3 A;  1D6U A;  3B4P A;  4O3V A;  2RFR A;  4X2H A;  1OHO A;  3KII A;  2AS0 A;  1AR0 A;  1N8Q A;  1YVB I;  1UCJ A;  3F9S A;  4WYK B;  1I2E A;  1BUQ A;  1FUS A;  3D3L A;  1FGO A;  2RGQ A;  4GSP A;  3M6W A;  3AMO A;  2Z0T A;  2BU4 A;  4KFD A;  4RNT A;  4KZ1 A;  1I0V A;  3BU4 A;  4IPB A;  4XBT A;  1FGR A;  3GRD A;  3UL5 A;  3CPW 2;  2QA4 3;  5IER A;  1U8C B;  3VSE A;  2ANE A;  1WMP A;  1XNE A;  2M7O A;  4HKV B;  2O3O A;  2CX0 A;  1BRG A;  3NXJ A;  1JJ2 2;  2Z6B A;  4XDV A;  1SIH A;  4BTW A;  4CDL A;  3OW2 2;  2K54 A;  4CI2 B;  1O7M B;  3LDF A;  1DVC A;  1BSD A;  1B27 A;  3N9H A;  4J5K A;  1X1U A;  3GSP A;  4CI1 B;  2XR8 B;  4GB5 A;  1TU5 A;  3CCJ 3;  3ZV0 C;  2B1X B;  3CMA 3;  2HMO B;  3D79 A;  3F14 A;  3IMA B;  2BIR A;  3LTC A;  1STD A;  3M6U A;  4XDW A;  1T2H A;  1U5O A;  3Q1C A;  4J5G A;  2P05 A;  1G96 A;  2HMJ B;  1L5G B;  1RHL A;  1FZU A;  5JPP A;  3V92 A;  3IJE B;  2J5V A;  2XGN A;  3CNM A;  5IG0 A;  1SPU A;  3BNC A;  4N6U A;  1PU4 A;  1I2G A;  4LEH A;  1IVW A;  1BOX A;  1JBT A;  1BNE A;  1X1W A;  3AHS A;  4FCJ A;  3JUP A;  3SYU A;  2QIY A;  2I9W A;  1YJW 3;  1W2B 2;  2BMQ B;  4HAA A;  2F99 A;  3UNL A;  3LTA A;  3OWU A;  4X2O A;  2D1W A;  1A2K A;  3NBJ A;  1JZD A;  1GD3 A;  1W6C A;  1W02 A;  3EBY A;  2HMN B;  3EF8 A;  1SGV A;  1UUV B;  1R4Y A;  3OX9 A;  4N3V A;  3NBR A;  4NPB A;  1IT8 A;  2JQ5 A;  2FRX A;  1I70 A;  1A2V A;  1Q40 A;  2WO0 A;  4FMC A;  3JUQ A;  1X1Y A;  1VZZ A;  4MJD A;  4RNY A;  1E3V A;  3O8Y A;  2OQE C;  4EW5 A;  1NNV A;  1YJN 3;  4I5Q A;  5M18 A;  2PNC A;  4O02 B;  1BSC A;  3MKI A;  3S67 A;  3VSY A;  2HMM B;  2WGO A;  3D5G A;  3LWO A;  2O9U X;  5JPU A;  3OV4 A;  2FXT A;  3HZP A;  3MWZ A;  1IV9 A;  3BLZ A;  1R3E A;  1FGM A;  1KWI A;  5G1L A;  2V1L A;  3NM7 A;  3UB1 A;  1NB5 I;  1W6G A;  2BNG A;  3GAX A;  3HX8 A;  1RGL A;  1Q7H A;  1TP6 A;  3DGY A;  1ZGX A;  3MPH A;  4O8S A;  3X40 A;  1UUG B;  3ECF A;  3NM2 A;  4J8T A;  4WP5 A;  3I0Y A;  3FG4 A;  5CF2 A;  1TTO A;  1R3F A;  1MWT A;  3LTD A;  4OK0 A;  1IV7 A;  1DYU A;  3DZL A;  3EQQ B;  1OAC A;  5ELJ A;  1QAL A;  3Q3F A;  1ZE2 A;  2RSX A;  4N6O B;  3V99 A;  4EC6 A;  7GSP A;  5HGR A;  2GSP A;  1V57 A;  1IQ8 A;  2E2T A;  1JB2 A;  3AMO B;  3BNB A;  1B2M A;  1EQK A;  1K8A 4;  1FUW A;  3UJM A;  4FCZ A;  4WYK A;  3E99 A;  4STD A;  3U97 A;  1J2B A;  3STD A;  5IEN A;  1ZBO A;  1S5A A;  1CEW I;  2OQE A;  3SED A;  1KC8 4;  1KD1 4;  5IF6 A;  1QAF A;  3B4O A;  5DRE A;  1TFO A;  1BSA A;  4LSO A;  1BRJ A;  1X1X A;  2KRT A;  3T8N A;  9RNT A;  1PYL A;  2ZHX B;  2APO A;  3BNE A;  3DGN A;  5AIH A;  1QVG 2;  3LTB A;  1JKG A;  4H3U A;  5AYS C;  3F7X A;  1M9G A;  3EB8 A;  3EX9 A;  4N6L A;  4O2H A;  3QK9 A;  2XH9 A;  1PY3 A;  1RGC A;  3WA2 X;  3LYG A;  1YJ9 3;  3X3Y A;  3LXU X;  4TX4 A;  1A90 A;  1VQQ A;  3RGR A;  4KFF A;  1LOW A;  5AI1 A;  2BHM A;  1WXW A;  3FF0 A;  1FGQ A;  1EKM A;  5KP1 A;  1UOY A;  5IG3 A;  2CIU A;  3KKG A;  2BO9 B;  1HKX A;  2PZV A;  3EE1 A;  2K3D A;  1F8N A;  5AII A;  2OOV A;  1BRN L;  2OOV C;  5JBS A;  1ULJ B;  2AB4 A;  1RN7 A;  1IDP A;  1UUW B;  1OHP A;  1GOU A;  3A76 A;  3FSD A;  1OPY A;  1B3S A;  3G4S 3;  1RJO A;  4HZB B;  5EQL A;  1RLS A;  2F86 B;  4MMX B;  3LWR A;  1GOY A;  3LWQ A;  3HI7 A;  1HYF A;  1BGS A;  2YFL B;  5D82 A;  3CME 3;  1BNG A;  1TUH A;  1WMO A;  1LQG C;  1AV4 A;  1YGE A;  1W7C A;  3AHW A;  1M1K 4;  2QGU A;  3CC7 3;  3NUV A;  3N54 B;  2OTJ 3;  3M6V A;  5RNT A;  3EC9 A;  1DMN A;  2C11 A;  3GZY B;  4NRE A;  5AEW B;  3PYJ A;  1G0T A;  3CCE 3;  1Q9E A;  4GL6 A;  3Q90 A;  5HOH A;  2Q07 A;  5GSP A;  1JNQ A;  1NJI 4;  1TE7 A;  1O7N B;  1BNF A;  3BND A;  3DH2 A;  3WOE B;  5KP3 A;  1YI2 3;  1WXX A;  2GU1 A;  1Q86 4;  5CK6 A;  1Q82 4;  2AUS A;  3X42 A;  1GMR A;  4KT3 B;  1ZS7 A;  1IQY A;  1HU9 A;  1SII A;  1UCI A;  1BRS A;  2Y73 A;  1MWS A;  3JUN A;  4N6V 0;  1DMM A;  1RDS A;  2YFI B;  3C0K A;  1JZO A;  4XB5 A;  4KFE A;  3PS8 A;  2MF7 A;  2C4B A;  2W0Q A;  1GS3 A;  3JUM A;  3SLU A;  3CC4 3;  1AY7 A;  4JF8 A;  3NQZ A;  4HM1 B;  4EYC A;  2CFL A;  1NO3 A;  4PEJ A;  1MOL A;  3M6X A;  2HMK B;  2SAR A;  2B24 B;  3D5I A;  3GWR A;  2CW9 A;  3NBB A;  4FR9 A;  1I2F A;  1C7H A;  3I55 3;  1JB4 A;  4LGQ A;  1K28 A;  3Q2P A;  1WMN A;  4U13 A;  1MWR A;  1W4N A;  1AQZ A;  4BL3 A;  3AGO A;  1IU7 A;  1I3I A;  3HK4 A;  3ZG0 A;  1W2Z A;  2ZDJ A;  2J8X B;  5CXO A;  3OWY A;  1ROA A;  2IA7 A;  1LNI A;  3MSO A;  2W04 A;  5AEU B;  3ER7 A;  3LT9 A;  3HOH A;  1GY7 A;  2CX1 A;  4MMY B;  3M65 A;  3FF2 A;  2DP9 A;  3MHE A;  1K73 4;  4KVH A;  1OF5 B;  1RN1 A;  3EHC A;  3EN8 A;  1GD4 A;  1DE3 A;  6GSP A;  2WOF A;  2P38 A;  4I4K A;  2Y74 A;  1IVX A;  2OTL 3;  2IY2 A;  2W56 B;  3FGY A;  1NDO B;  3KFQ C;  1LOX A;  3JVC A;  2XSH B;  4BTX A;  3UAI A;  3FG1 A;  1DVD A;  1BUJ A;  5LC7 A;  5A0O B;  3X3X A;  2XFT A;  2IMJ A;  1OH0 A;  3MYT A;  1JBR A;  1RCK A;  1RTU A;  5LC6 A;  1N8R 4;  1W5Z A;  3K5T A;  3RDE A;  3OWS A;  2FGT A;  2RFK A;  1TJD A;  1JB5 A;  1JN5 A;  4L7K A;  3S28 A;  1QVF 2;  1GY5 A;  2CFG A;  2RNT A;  3F40 A;  3NHX A;  5EEO A;  3MG2 A;  3CNX A;  2E2U A;  5BIR A;  1RGG A;  3G16 A;  2YX9 A;  3NV0 B;  1B20 A;  4J9A A;  4ORL A;  3WR2 A;  1UCK A;  1I0X A;  1SJW A; 
#chains in the Genus database with same CATH homology
 4OUQ A;  1YJ9 3;  2XFS A;  1SQW A;  2WGQ A;  3GZB A;  3KSP A;  2B78 A;  3DGO A;  2P0X A;  4EBG A;  1CYV A;  4K61 A;  1N9J A;  3K63 A;  5FGO A;  1O7H B;  3CCU 3;  3CCL 3;  3KZT A;  3F8X A;  4IT7 A;  2BT3 A;  3NQY A;  3B8L A;  4HM3 B;  3SXX A;  3CCQ 3;  3BB9 A;  3N8B A;  3G71 3;  1K9M 4;  3GZR A;  1ASK A;  3WMD A;  1VQ7 3;  2SBL A;  3IPT A;  1FA3 A;  3LH4 A;  4JRF A;  4Q1T A;  4HM5 B;  3VGN A;  4HJL B;  4EV2 A;  5IEO A;  3WOD G;  2JDI H;  2LQV A;  1OGX A;  3FLJ A;  3K9M C;  4WHA A;  3ROB A;  3J7Y d;  2OCT A;  2CWU A;  3PXM A;  3D9R A;  2CFW A;  4HM0 B;  4HM4 B;  4FMD A;  2GXF A;  3DY5 A;  4IIA A;  3RGA A;  5I97 A;  3PZW A;  5TGN A;  2L4V A;  2GBW B;  4XM4 A;  1M1X B;  4QWT A;  2CH9 A;  5IW9 A;  3NV0 A;  1OGZ A;  2XEP A;  1OHS A;  2F98 A;  2BMO B;  4R9L A;  1ZX2 A;  1ZE1 A;  1D6Y A;  4HM2 B;  3B7C A;  5IG5 A;  4R80 A;  3DUK A;  1O7G B;  1N5H A;  2UX0 A;  3DM8 A;  3EBT A;  2A15 A;  4RNZ A;  2ML5 A;  5ELU A;  2BMR B;  4HM8 B;  2W56 A;  5FW5 A;  1R4C A;  4ZM8 A;  3CD6 3;  2QEX 3;  1UW1 A;  1RKY A;  1VQN 3;  2E2V A;  4R9K A;  4RBN A;  1E97 A;  3K7C A;  5AIF A;  2Z77 A;  1OF5 A;  3FCS B;  1O7W B;  4G1M B;  2INX A;  1W6Y A;  2W9P A;  1RRL A;  5D83 A;  1QAK A;  1LVN A;  1N9E A;  1NU3 A;  2CG1 A;  1LXE A;  3G8Z A;  1UI7 A;  1VQK 3;  3ALA A;  3FZW A;  1STF I;  3LOY A;  2ML6 A;  1TIJ A;  2XGL A;  1RRH A;  3F7S A;  3JUO A;  2CWT A;  4L8P A;  5BVB A;  3S5C A;  2LYX A;  3WDG B;  4RZM A;  2WOH A;  4HBR A;  1OCV A;  1JRQ A;  4AKZ A;  2GEX A;  1VQ9 3;  2MC8 A;  2D42 A;  2CFD A;  1N5P A;  1ZO2 A;  1QJG A;  1YIT 3;  1YIJ 3;  1UI8 A;  3DGL A;  2J5T A;  3EN1 B;  3K0Z A;  4K1U A;  5AIG A;  3FH1 A;  1O7P B;  4N6T A;  4R4K A;  4HYZ A;  4WWU C;  2CFK A;  1VQ6 3;  1ULI B;  3GZX B;  1T5Y A;  2KCD A;  4HM6 B;  3M8C A;  4HVN A;  1D6Z A;  2GEY A;  3S27 A;  3DMC A;  1A67 A;  3EJV A;  3DXO A;  1V74 A;  1US1 A;  2KXG A;  1VQ4 3;  3U1W A;  3H51 A;  2W03 A;  3CCR 3;  3CCV 3;  1KQS 2;  4BTY A;  5IG4 A;  1JN5 B;  3OXA A;  1AVL A;  4WFO A;  4CCV A;  5IEP A;  1ISK A;  1M90 4;  3SOY A;  2Z7A A;  4HZ9 B;  2Z76 A;  3FG3 A;  1W01 A;  2CWW A;  1TFK A;  1WQL B;  3H3H A;  4HM7 B;  2FNQ A;  3V98 A;  4R1K A;  1Y4K A;  3S29 A;  3I56 3;  3T0U A;  3QRD A;  1EG9 B;  1GY6 A;  1IVU A;  5AYR B;  1S72 3;  1K8W A;  3X41 A;  1Z1S A;  3CCM 3;  2W6J H;  2CHC A;  4Q53 A;  3CCS 3;  2CK3 H;  2STD A;  3KE7 A;  1Q81 4;  2IUK A;  1JKG B;  5BXQ A;  2W9Q A;  5D81 A;  1PFP A;  3CXC 2;  5DRV A;  3HII A;  3LZA A;  3SX1 A;  1E3R A;  1YHQ 3;  2CKF B;  1VQ8 3;  4MMZ B;  2C10 A;  1ROV A;  3MG3 A;  2CC3 A;  1K41 A;  5CF1 A;  1FGT A;  4K90 B;  3G6E 3;  1VQP 3;  1CYU A;  2R4I A;  4L8O A;  3CU3 A;  2GBX B;  1Q7Y 4;  3T8U A;  2XSO B;  8CHO A;  1IT7 A;  1MNL A;  2CWV A;  4XBY A;  5CLK A;  1Q42 A;  3KN4 A;  1OUN A;  4EV5 A;  2CG0 A;  1VQO 3;  4LZI A;  3WA3 A;  5STD A;  2K0M A;  1NWW A;  3PGB A;  4LMI A;  4OVM A;  4EXR A;  2OWP A;  1EQK A;  1WNH A;  1IQX A;  2HML B;  3FKA A;  1JV2 B;  4XBX A;  1VQ5 3;  1QMA A;  3G0K A;  2W2C A;  4N6N B;  3VF1 A;  4H61 A;  1VQM 3;  2P09 A;  1KSI A;  2ZL8 A;  4FMB A;  1LNH A;  1VQL 3;  1Q40 B;  2XRX B;  6STD A;  3SVA A;  4FMA A;  3UL6 A;  4DMG A;  1EA2 A;  1WTH A;  3F8H A;  5EVH A;  2GU3 A;  3X3Z A;  1AVK A;  3LML A;  4AEQ A;  1GYB A;  3HIG A;  3CPO A;  3KSE D;  3PCS A;  4MEI A;  2IUJ A;  3LT8 A;  3WOF B;  3DGM A;  5KP4 A;  2P0M A;  3TDG A;  3SOA A;  7STD A;  1CQS A;  1NB3 I;  1DMQ A;  2RCD A;  4AKY A;  5G2G A;  3MG1 A;  4FCM A;  4K1V A;  4NHF A;  3L0R A;  1IVV A;  3PCR A;  1IK3 A;  2YFJ B;  2XF3 A;  1W00 A;  4N6M A;  3CC2 3;  3NX0 A;  1ZL3 A;  1D6U A;  3B4P A;  4O3V A;  2RFR A;  4X2H A;  1OHO A;  3KII A;  2AS0 A;  1AR0 A;  1N8Q A;  1YVB I;  3F9S A;  4WYK B;  1BUQ A;  3D3L A;  1FGO A;  2RGQ A;  3AMO A;  4KFD A;  4KZ1 A;  4XBT A;  4IPB A;  3UL5 A;  1FGR A;  3GRD A;  3CPW 2;  2QA4 3;  5IER A;  1U8C B;  3VSE A;  1WMP A;  2M7O A;  4HKV B;  2O3O A;  2CX0 A;  3NXJ A;  1JJ2 2;  2Z6B A;  4XDV A;  1SIH A;  4BTW A;  4CDL A;  3OW2 2;  2K54 A;  1O7M B;  3LDF A;  1DVC A;  3N9H A;  3CCJ 3;  2XR8 B;  4GB5 A;  1TU5 A;  2B1X B;  3CMA 3;  2HMO B;  3D79 A;  3F14 A;  3IMA B;  3LTC A;  1STD A;  4XDW A;  1U5O A;  3Q1C A;  2P05 A;  1G96 A;  2HMJ B;  1L5G B;  5JPP A;  3V92 A;  3IJE B;  2J5V A;  2XGN A;  3CNM A;  5IG0 A;  1SPU A;  3BNC A;  4N6U A;  1PU4 A;  4LEH A;  1IVW A;  4FCJ A;  3JUP A;  1YJW 3;  2QIY A;  2I9W A;  1W2B 2;  2BMQ B;  2F99 A;  3UNL A;  3LTA A;  3OWU A;  4X2O A;  2D1W A;  1A2K A;  3NBJ A;  1W6C A;  1GD3 A;  3OX9 A;  1W02 A;  3EBY A;  2HMN B;  3EF8 A;  1SGV A;  1UUV B;  4N3V A;  3NBR A;  1IT8 A;  2JQ5 A;  1Q40 A;  1A2V A;  2WO0 A;  4FMC A;  1YJN 3;  3JUQ A;  4MJD A;  1VZZ A;  4RNY A;  1E3V A;  3O8Y A;  2OQE C;  2PNC A;  4O02 B;  3MKI A;  3S67 A;  3VSY A;  2HMM B;  2WGO A;  2O9U X;  5JPU A;  3OV4 A;  2FXT A;  3HZP A;  3MWZ A;  3BLZ A;  1IV9 A;  1R3E A;  1FGM A;  1KWI A;  2V1L A;  3NM7 A;  3UB1 A;  1NB5 I;  1W6G A;  2BNG A;  3GAX A;  3HX8 A;  1Q7H A;  1TP6 A;  3MPH A;  4O8S A;  3X40 A;  3NM2 A;  3ECF A;  4J8T A;  4WP5 A;  3I0Y A;  3FG4 A;  5CF2 A;  1R3F A;  3LTD A;  4OK0 A;  1IV7 A;  1DYU A;  3DZL A;  3EQQ B;  1OAC A;  5ELJ A;  1QAL A;  1ZE2 A;  2RSX A;  4N6O B;  3V99 A;  4EC6 A;  5HGR A;  1IQ8 A;  2E2T A;  3BNB A;  1JB2 A;  3AMO B;  1K8A 4;  1FUW A;  3UJM A;  4FCZ A;  4WYK A;  3E99 A;  4STD A;  3U97 A;  1J2B A;  3STD A;  5IEN A;  1KD1 4;  1S5A A;  1CEW I;  2OQE A;  3SED A;  1KC8 4;  5IF6 A;  1QAF A;  3B4O A;  5DRE A;  1TFO A;  4LSO A;  2KRT A;  3T8N A;  5AIH A;  3BNE A;  3DGN A;  1QVG 2;  3LTB A;  1JKG A;  4H3U A;  5AYS C;  3F7X A;  1M9G A;  3EB8 A;  3EX9 A;  4N6L A;  4O2H A;  3QK9 A;  2XH9 A;  3WA2 X;  3LYG A;  3X3Y A;  3LXU X;  4TX4 A;  1A90 A;  3RGR A;  4KFF A;  5AI1 A;  2BHM A;  1WXW A;  3FF0 A;  1FGQ A;  1EKM A;  5KP1 A;  5IG3 A;  2CIU A;  3KKG A;  2BO9 B;  1HKX A;  2PZV A;  3EE1 A;  5AII A;  1F8N A;  2OOV A;  2OOV C;  5JBS A;  1ULJ B;  2AB4 A;  1RN7 A;  1IDP A;  1UUW B;  1OHP A;  3A76 A;  3FSD A;  3G4S 3;  1OPY A;  1RJO A;  4HZB B;  5EQL A;  2F86 B;  4MMX B;  3HI7 A;  2YFL B;  3CME 3;  5D82 A;  1TUH A;  1WMO A;  1AV4 A;  1YGE A;  1W7C A;  1M1K 4;  2OTJ 3;  2QGU A;  3CC7 3;  3NUV A;  3N54 B;  3EC9 A;  1DMN A;  2C11 A;  3GZY B;  4NRE A;  5AEW B;  3PYJ A;  3CCE 3;  4GL6 A;  3Q90 A;  2Q07 A;  1JNQ A;  1NJI 4;  1O7N B;  3BND A;  3WOE B;  5KP3 A;  1YI2 3;  1WXX A;  2GU1 A;  1Q86 4;  5CK6 A;  1Q82 4;  3X42 A;  1ZS7 A;  1IQY A;  1HU9 A;  1SII A;  2Y73 A;  3JUN A;  4N6V 0;  1DMM A;  2YFI B;  3C0K A;  4XB5 A;  4KFE A;  3PS8 A;  2MF7 A;  2W0Q A;  1GS3 A;  3JUM A;  3SLU A;  3CC4 3;  4JF8 A;  3NQZ A;  4HM1 B;  4EYC A;  2CFL A;  1NO3 A;  4PEJ A;  1MOL A;  2HMK B;  3NBB A;  2B24 B;  3GWR A;  4FR9 A;  2CW9 A;  1C7H A;  3I55 3;  1JB4 A;  4LGQ A;  1K28 A;  3Q2P A;  1WMN A;  4U13 A;  1W4N A;  1IU7 A;  3HK4 A;  1W2Z A;  2ZDJ A;  5CXO A;  3OWY A;  1ROA A;  2IA7 A;  3MSO A;  2W04 A;  5AEU B;  3ER7 A;  3LT9 A;  1GY7 A;  2CX1 A;  4MMY B;  3FF2 A;  3MHE A;  1K73 4;  4KVH A;  1OF5 B;  3EHC A;  3EN8 A;  1GD4 A;  2WOF A;  2P38 A;  4I4K A;  2Y74 A;  1IVX A;  2OTL 3;  2W56 B;  3FGY A;  1NDO B;  3KFQ C;  1LOX A;  3JVC A;  2XSH B;  4BTX A;  3UAI A;  3FG1 A;  1DVD A;  5LC7 A;  5A0O B;  3X3X A;  2XFT A;  2IMJ A;  1OH0 A;  3MYT A;  5LC6 A;  1N8R 4;  1W5Z A;  3K5T A;  3RDE A;  3OWS A;  2FGT A;  1JB5 A;  1JN5 A;  4L7K A;  3S28 A;  1QVF 2;  1GY5 A;  2CFG A;  3F40 A;  3NHX A;  5EEO A;  3MG2 A;  3CNX A;  2E2U A;  3G16 A;  2YX9 A;  3NV0 B;  4J9A A;  4ORL A;  1SJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...