2DP9A

Crystal structure of conserved hypothetical protein ttha0113 from thermus thermophilus hb8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
MDYMERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVEGPFSVEELLAHQEKHLAEEAFLRAYAKDEPLYAWVLENAFRYEKPLHVPRRPGRVMFVDLSEVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TTHA0113
publication title Crystal Structure of Conserved Hypothetical Protein TTHA0113 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 30
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 2dp9A01
1XNEA 2DP9A 2Z0TA 1TE7A 2KKUA 2E5OA 1WK2A 1S04A 3IUWA
chains in the Genus database with same CATH superfamily
2RFKA 1ZL3A 1WXXA 1XNEA 2J5TA 3C0KA 4DMGA 3ZV0C 2CX1A 2E5OA 2P38A 3HJYA 3LWRA 3HAXA 1T5YA 2AUSA 2CWWA 1ZE1A 2FRXA 1ZBOA 2DP9A 3M4XA 3LDFA 1UOYA 2J5VA 3LWPA 1WK2A 3U28A 3LWOA 1J2BA 2EY4A 1S04A 3IUWA 1IQ8A 3M6XA 4Q1TA 4CI3B 1R3EA 2Q07A 3M6WA 2B78A 4CI1B 3HJWA 1ZS7A 1TE7A 1Q7HA 1SQWA 3LJCA 1SGVA 2APOA 1WXWA 3M6UA 1IT7A 2ANEA 3VSEA 3UAIA 4CI2B 1ZE2A 2HVYA 3M6VA 3D79A 3MQKA 2AS0A 1IT8A 2AB4A 2Z0TA 2KKUA 1K8WA 3LWVA 3LWQA 2CX0A 3M65A 4TZ4C 1R3FA
chains in the Genus database with same CATH topology
1XNEA 2DP9A 2Z0TA 1TE7A 2KKUA 2E5OA 1WK2A 4P78C 4C26A 1S04A 3IUWA 1WHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNE A;  2DP9 A;  2Z0T A;  1TE7 A;  2KKU A;  2E5O A;  1WK2 A;  1S04 A;  3IUW A; 
#chains in the Genus database with same CATH topology
 2RFK A;  1ZL3 A;  1WXX A;  1XNE A;  2J5T A;  3C0K A;  4DMG A;  3ZV0 C;  2CX1 A;  2E5O A;  2P38 A;  3HJY A;  3LWR A;  3HAX A;  1T5Y A;  2AUS A;  2CWW A;  1ZE1 A;  2FRX A;  1ZBO A;  2DP9 A;  3M4X A;  3LDF A;  1UOY A;  2J5V A;  3LWP A;  1WK2 A;  3U28 A;  3LWO A;  1J2B A;  2EY4 A;  1S04 A;  3IUW A;  1IQ8 A;  3M6X A;  4Q1T A;  4CI3 B;  1R3E A;  2Q07 A;  3M6W A;  2B78 A;  4CI1 B;  3HJW A;  1ZS7 A;  1TE7 A;  1Q7H A;  1SQW A;  3LJC A;  1SGV A;  2APO A;  1WXW A;  3M6U A;  1IT7 A;  2ANE A;  3VSE A;  3UAI A;  4CI2 B;  1ZE2 A;  2HVY A;  3M6V A;  3D79 A;  3MQK A;  2AS0 A;  1IT8 A;  2AB4 A;  2Z0T A;  2KKU A;  1K8W A;  3LWV A;  3LWQ A;  2CX0 A;  3M65 A;  4TZ4 C;  1R3F A; 
#chains in the Genus database with same CATH homology
 1XNE A;  2DP9 A;  2Z0T A;  1TE7 A;  2KKU A;  2E5O A;  1WK2 A;  4P78 C;  4C26 A;  1S04 A;  3IUW A;  1WHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...