2DP9A

Crystal structure of conserved hypothetical protein ttha0113 from thermus thermophilus hb8
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
124
structure length
124
Chain Sequence
MDYMERPKLGLIVREPYASLIVDGRKVWEIRRRKTRHRGPLGIVSGGRLIGQADLVGVEGPFSVEELLAHQEKHLAEEAFLRAYAKDEPLYAWVLENAFRYEKPLHVPRRPGRVMFVDLSEVRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TTHA0113
publication title Crystal Structure of Conserved Hypothetical Protein TTHA0113 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 30
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04266 ASCH ASCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.30 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Hypothetical protein. 2dp9A01
1TE7A 1WK2A 2E5OA 3IUWA 1XNEA 2KKUA 2Z0TA 1S04A 2DP9A
chains in the Genus database with same CATH superfamily
1IQ8A 4CI3B 2E5OA 3M6XA 1IT8A 1XNEA 3ZV0C 3M6UA 4DMGA 3LWOA 1R3FA 2CX0A 2AUSA 2FRXA 2B78A 2CX1A 1ZL3A 3LWQA 3HJWA 1TE7A 1IT7A 3LWVA 4CI1B 1WXWA 2AS0A 2DP9A 1SQWA 2J5TA 2P38A 2KKUA 2Q07A 3M6VA 3LWRA 4Q1TA 3MQKA 3VSEA 2APOA 2AB4A 3HJYA 1WXXA 3IUWA 2J5VA 1J2BA 3M4XA 2ANEA 2Z0TA 1S04A 1Q7HA 3LWPA 3LJCA 4TZ4C 1R3EA 3C0KA 3M65A 3U28A 2CWWA 3HAXA 3M6WA 1ZE2A 1WK2A 2HVYA 3UAIA 1ZBOA 3D79A 3LDFA 1ZS7A 1SGVA 1T5YA 1UOYA 2RFKA 2EY4A 1K8WA 4CI2B 1ZE1A
chains in the Genus database with same CATH topology
4C26A 1TE7A 1WK2A 2E5OA 3IUWA 1XNEA 2KKUA 2Z0TA 1S04A 4P78C 1WHZA 2DP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TE7 A;  1WK2 A;  2E5O A;  3IUW A;  1XNE A;  2KKU A;  2Z0T A;  1S04 A;  2DP9 A; 
#chains in the Genus database with same CATH topology
 1IQ8 A;  4CI3 B;  2E5O A;  3M6X A;  1IT8 A;  1XNE A;  3ZV0 C;  3M6U A;  4DMG A;  3LWO A;  1R3F A;  2CX0 A;  2AUS A;  2FRX A;  2B78 A;  2CX1 A;  1ZL3 A;  3LWQ A;  3HJW A;  1TE7 A;  1IT7 A;  3LWV A;  4CI1 B;  1WXW A;  2AS0 A;  2DP9 A;  1SQW A;  2J5T A;  2P38 A;  2KKU A;  2Q07 A;  3M6V A;  3LWR A;  4Q1T A;  3MQK A;  3VSE A;  2APO A;  2AB4 A;  3HJY A;  1WXX A;  3IUW A;  2J5V A;  1J2B A;  3M4X A;  2ANE A;  2Z0T A;  1S04 A;  1Q7H A;  3LWP A;  3LJC A;  4TZ4 C;  1R3E A;  3C0K A;  3M65 A;  3U28 A;  2CWW A;  3HAX A;  3M6W A;  1ZE2 A;  1WK2 A;  2HVY A;  3UAI A;  1ZBO A;  3D79 A;  3LDF A;  1ZS7 A;  1SGV A;  1T5Y A;  1UOY A;  2RFK A;  2EY4 A;  1K8W A;  4CI2 B;  1ZE1 A; 
#chains in the Genus database with same CATH homology
 4C26 A;  1TE7 A;  1WK2 A;  2E5O A;  3IUW A;  1XNE A;  2KKU A;  2Z0T A;  1S04 A;  4P78 C;  1WHZ A;  2DP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...