3HJYA

Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate rna
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
327
structure length
320
Chain Sequence
RILPADIKREVLIKDENAETNPDWGFPPEKRPIEMHIQFGVINLDKPPGPTSHEVVAWIKKILNLEKAGHGGTLDPKVSGVLPVALEKATRVVQALLPAGKEYVALMHLHGDVPEDKIIQVMKEFEGEIIQRPPLLRTRKVYYIEVLEIEGRDVLFRVGVEAGTYIRSLIHHIGLALGVGAHMSELRRTRSGPFKEDETLITLHDLVDYYYFWKEDGIEEYFRKAIQPMEKAVEHLPKVWIKDSAVAAVTHGADLAVPGIAKLHAGIKRGDLVAIMTLKDELVALGKAMMTSQEMLEKTKGIAVDVEKVFMPRDWYPKLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pseudouridine synthase CBf5
publication title Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/rna
total genus 77
structure length 320
sequence length 327
ec nomenclature ec 5.4.99.25: tRNA pseudouridine(55) synthase.
pdb deposition date 2009-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01472 PUA PUA domain
A PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain)
A PF08068 DKCLD DKCLD (NUC011) domain
A PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.130.70 Mainly Beta Roll Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4 3hjyA01
3.30.2350.10 Alpha Beta 2-Layer Sandwich Pseudouridine synthase Pseudouridine synthase 3hjyA02
1KSLA 3MQKA 1V9FA 1R3FA 4LABA 2RFKA 3DH3A 1ZE1A 1XPIA 1ZL3A 1KSKA 1SGVA 3HJWA 3HJYA 3LWOA 2ISTA 1K8WA 3ZV0C 3LWPA 1V9KA 1ZE2A 1R3EA 1QYUA 2EY4A 1PRZA 3LWRA 2AUSA 3HAXA 2HVYA 3U28A 1KSVA 3UAIA 3LWQA 2AB4A 2I82A 3LWVA 4LGTA 2APOA
chains in the Genus database with same CATH superfamily
3LJCA 3M6VA 2Q07A 3M6XA 3M4XA 1XNEA 4LABA 2J5VA 3M6UA 1ZE1A 2FRXA 1Z2ZA 4CI1B 2ISTA 3D79A 3M6WA 1Q7HA 1SB7A 3HAXA 2HVYA 2CX0A 2KKUA 2Z0TA 1UOYA 4Q1TA 2CX1A 2J5TA 3MQKA 1S04A 3LDFA 1V9FA 1R3FA 1J2BA 2P38A 3C0KA 1ZL3A 2ANEA 1K8WA 3IUWA 1SI7A 2EY4A 3UAIA 3LWQA 2I82A 4LGTA 4DMGA 1SZWA 2B78A 2RFKA 1TE7A 2CWWA 1T5YA 1KSKA 1SGVA 3HJYA 2AS0A 1WXWA 3LWPA 1IQ8A 1PRZA 3LWRA 3VSEA 2AUSA 2DP9A 3U28A 1KSVA 2E5OA 2AB4A 2APOA 1V9KA 1KSLA 4CI2B 1IT8A 3DH3A 1XPIA 3HJWA 4CI3B 1IT7A 1SQWA 1ZS7A 3LWOA 4TZ4C 3ZV0C 3M65A 1R3EA 1ZE2A 1QYUA 1WK2A 1ZBOA 1WXXA 3LWVA
chains in the Genus database with same CATH topology
3M6VA 1KSLA 3MQKA 3M6XA 1SZWA 3M4XA 1V9FA 1R3FA 4LABA 2RFKA 3M6UA 1ZE1A 1XPIA 3DH3A 2FRXA 1Z2ZA 1ZL3A 1KSKA 1SGVA 3HJWA 3HJYA 3LWOA 2ISTA 1K8WA 3ZV0C 3LWPA 3M6WA 1SI7A 1V9KA 1ZE2A 1QYUA 1R3EA 2EY4A 1PRZA 3LWRA 1SB7A 2AUSA 3HAXA 2HVYA 3U28A 1KSVA 3UAIA 3LWQA 2AB4A 2I82A 1UOYA 3LWVA 4LGTA 2APOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSL A;  3MQK A;  1V9F A;  1R3F A;  4LAB A;  2RFK A;  3DH3 A;  1ZE1 A;  1XPI A;  1ZL3 A;  1KSK A;  1SGV A;  3HJW A;  3HJY A;  3LWO A;  2IST A;  1K8W A;  3ZV0 C;  3LWP A;  1V9K A;  1ZE2 A;  1R3E A;  1QYU A;  2EY4 A;  1PRZ A;  3LWR A;  2AUS A;  3HAX A;  2HVY A;  3U28 A;  1KSV A;  3UAI A;  3LWQ A;  2AB4 A;  2I82 A;  3LWV A;  4LGT A;  2APO A; 
#chains in the Genus database with same CATH topology
 3LJC A;  3M6V A;  2Q07 A;  3M6X A;  3M4X A;  1XNE A;  4LAB A;  2J5V A;  3M6U A;  1ZE1 A;  2FRX A;  1Z2Z A;  4CI1 B;  2IST A;  3D79 A;  3M6W A;  1Q7H A;  1SB7 A;  3HAX A;  2HVY A;  2CX0 A;  2KKU A;  2Z0T A;  1UOY A;  4Q1T A;  2CX1 A;  2J5T A;  3MQK A;  1S04 A;  3LDF A;  1V9F A;  1R3F A;  1J2B A;  2P38 A;  3C0K A;  1ZL3 A;  2ANE A;  1K8W A;  3IUW A;  1SI7 A;  2EY4 A;  3UAI A;  3LWQ A;  2I82 A;  4LGT A;  4DMG A;  1SZW A;  2B78 A;  2RFK A;  1TE7 A;  2CWW A;  1T5Y A;  1KSK A;  1SGV A;  3HJY A;  2AS0 A;  1WXW A;  3LWP A;  1IQ8 A;  1PRZ A;  3LWR A;  3VSE A;  2AUS A;  2DP9 A;  3U28 A;  1KSV A;  2E5O A;  2AB4 A;  2APO A;  1V9K A;  1KSL A;  4CI2 B;  1IT8 A;  3DH3 A;  1XPI A;  3HJW A;  4CI3 B;  1IT7 A;  1SQW A;  1ZS7 A;  3LWO A;  4TZ4 C;  3ZV0 C;  3M65 A;  1R3E A;  1ZE2 A;  1QYU A;  1WK2 A;  1ZBO A;  1WXX A;  3LWV A; 
#chains in the Genus database with same CATH homology
 3M6V A;  1KSL A;  3MQK A;  3M6X A;  1SZW A;  3M4X A;  1V9F A;  1R3F A;  4LAB A;  2RFK A;  3M6U A;  1ZE1 A;  1XPI A;  3DH3 A;  2FRX A;  1Z2Z A;  1ZL3 A;  1KSK A;  1SGV A;  3HJW A;  3HJY A;  3LWO A;  2IST A;  1K8W A;  3ZV0 C;  3LWP A;  3M6W A;  1SI7 A;  1V9K A;  1ZE2 A;  1QYU A;  1R3E A;  2EY4 A;  1PRZ A;  3LWR A;  1SB7 A;  2AUS A;  3HAX A;  2HVY A;  3U28 A;  1KSV A;  3UAI A;  3LWQ A;  2AB4 A;  2I82 A;  1UOY A;  3LWV A;  4LGT A;  2APO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...